Citrus Sinensis ID: 010860
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 499 | ||||||
| 224127696 | 500 | predicted protein [Populus trichocarpa] | 0.993 | 0.992 | 0.897 | 0.0 | |
| 253509575 | 502 | putative glycerol-3-phosphate acyltransf | 0.993 | 0.988 | 0.905 | 0.0 | |
| 255541618 | 501 | ER glycerol-phosphate acyltransferase [R | 0.997 | 0.994 | 0.893 | 0.0 | |
| 357514561 | 505 | ER glycerol-phosphate acyltransferase [M | 0.993 | 0.982 | 0.846 | 0.0 | |
| 300507125 | 500 | GPAT [Gossypium hirsutum] | 0.993 | 0.992 | 0.889 | 0.0 | |
| 356520398 | 499 | PREDICTED: probable glycerol-3-phosphate | 0.987 | 0.987 | 0.878 | 0.0 | |
| 356504372 | 500 | PREDICTED: probable glycerol-3-phosphate | 0.987 | 0.986 | 0.852 | 0.0 | |
| 449441458 | 500 | PREDICTED: probable glycerol-3-phosphate | 0.995 | 0.994 | 0.851 | 0.0 | |
| 308513539 | 504 | putative glycerol-3-phosphate O-acyltran | 0.989 | 0.980 | 0.802 | 0.0 | |
| 383289227 | 505 | sn-glycerol-3-phosphate acyltransferase | 0.995 | 0.984 | 0.798 | 0.0 |
| >gi|224127696|ref|XP_002320138.1| predicted protein [Populus trichocarpa] gi|222860911|gb|EEE98453.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 898 bits (2320), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 445/496 (89%), Positives = 474/496 (95%)
Query: 4 KPGRKFPPITECNGSAYGSIAADLDGTLLVSRSSFPYFMLVAVEAGGLLRGLALLVSLPI 63
KP +KFPPIT CNG+ + SIAADLDGTLLVS SSFPYFM+VAVEAG L RGL LL+SLPI
Sbjct: 5 KPAKKFPPITACNGTTHQSIAADLDGTLLVSSSSFPYFMIVAVEAGSLFRGLVLLLSLPI 64
Query: 64 AIIAYLFISEAIGIQILIFISFSGLKIRDIELASRAVLPRFYAADVRKESYEVFDKCERK 123
I++YLFISEA+GIQ+LIFIS SGLKIRDIEL SRAVLPRFYAADVR ES+EVFD+C+RK
Sbjct: 65 VIVSYLFISEALGIQMLIFISMSGLKIRDIELVSRAVLPRFYAADVRSESFEVFDRCKRK 124
Query: 124 VVVTANPTLMVEPFVKDFLGGDKVLGTEIEVNPRTKRATGFVKRPGVLVGKWKKLAVLKE 183
VVVTANPT+MVEPFVKDFLGGDKVLGTEIEVNP+TKRATGFVK+PGVLVGKWK+LAVLKE
Sbjct: 125 VVVTANPTIMVEPFVKDFLGGDKVLGTEIEVNPKTKRATGFVKKPGVLVGKWKELAVLKE 184
Query: 184 FGEDAPDLGIGDRQTDHDFMSICKEGYMVLPSKSAKPLPRDRLKSRIIFHDGRLVQRPDP 243
FGE+APDLGIGDR+TDHDFMS+CKEGYMV SKSA PLPRDRLK+RIIFHDGRLVQRPDP
Sbjct: 185 FGEEAPDLGIGDRKTDHDFMSLCKEGYMVHRSKSATPLPRDRLKNRIIFHDGRLVQRPDP 244
Query: 244 LNALITYIWLPFGFILSIIRVYFNLPLPERIVRYTYEMLGIHLVIRGNPPPAPSSGSPGN 303
LNALITYIWLPFGFILSIIRVYFNLPLPERIVRYTYEMLGIHLVIRG PPPAPS G+PGN
Sbjct: 245 LNALITYIWLPFGFILSIIRVYFNLPLPERIVRYTYEMLGIHLVIRGTPPPAPSPGTPGN 304
Query: 304 LYVCNHRTPLDPIVIAIALGRKVSCVTYSVSKLSRFLSPIPAIALTRDRAADAARISELL 363
LYVCNHRT LDPIVIAIALGRKVSCVTYSVS+LSRFLSPIPAIALTRDRAADAARIS +L
Sbjct: 305 LYVCNHRTALDPIVIAIALGRKVSCVTYSVSRLSRFLSPIPAIALTRDRAADAARISSIL 364
Query: 364 QKGDLVVCPEGTTCRENFLLRFSALFAEMSDRIVPVAVNCKQNMFYGTTVRGVKFWDPYF 423
QKGDLVVCPEGTTCRE FLLRFSALFAE+SDRIVPVAVNCKQNMFYGTTVRGVKFWDPYF
Sbjct: 365 QKGDLVVCPEGTTCREEFLLRFSALFAELSDRIVPVAVNCKQNMFYGTTVRGVKFWDPYF 424
Query: 424 FFMNPRPTYEVTFLDRLPEEMTCKAGGKSAIEVANYVQKVLGDVLGFECTGLTRKDKYML 483
FFMNPRPTYEVTFLDRLPEEMT KAGGKS+IEVANYVQKVLG+VLGFE TGLTRKDKY+L
Sbjct: 425 FFMNPRPTYEVTFLDRLPEEMTVKAGGKSSIEVANYVQKVLGEVLGFENTGLTRKDKYLL 484
Query: 484 LGGNDGKVESMYNSKK 499
LGGNDGKVESM+N+KK
Sbjct: 485 LGGNDGKVESMHNAKK 500
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|253509575|gb|ACT32032.1| putative glycerol-3-phosphate acyltransferase [Vernicia fordii] gi|308743345|gb|ADO40098.1| glycerol-3-phosphate acyltransferase 8 [Vernicia fordii] | Back alignment and taxonomy information |
|---|
| >gi|255541618|ref|XP_002511873.1| ER glycerol-phosphate acyltransferase [Ricinus communis] gi|223549053|gb|EEF50542.1| ER glycerol-phosphate acyltransferase [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|357514561|ref|XP_003627569.1| ER glycerol-phosphate acyltransferase [Medicago truncatula] gi|355521591|gb|AET02045.1| ER glycerol-phosphate acyltransferase [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|300507125|gb|ADK23938.1| GPAT [Gossypium hirsutum] | Back alignment and taxonomy information |
|---|
| >gi|356520398|ref|XP_003528849.1| PREDICTED: probable glycerol-3-phosphate acyltransferase 8-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356504372|ref|XP_003520970.1| PREDICTED: probable glycerol-3-phosphate acyltransferase 8-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449441458|ref|XP_004138499.1| PREDICTED: probable glycerol-3-phosphate acyltransferase 8-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|308513539|gb|ADO33168.1| putative glycerol-3-phosphate O-acyltransferase [Echium pitardii] | Back alignment and taxonomy information |
|---|
| >gi|383289227|gb|AFH02721.1| sn-glycerol-3-phosphate acyltransferase 4 isoform C1, partial [Brassica napus] gi|383289233|gb|AFH02724.1| sn-glycerol-3-phosphate acyltransferase 4 isoform C1, partial [Brassica napus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 499 | ||||||
| TAIR|locus:2126101 | 500 | GPAT8 "GLYCEROL-3-PHOSPHATE sn | 0.993 | 0.992 | 0.723 | 9e-196 | |
| TAIR|locus:2025381 | 503 | GPAT4 "GLYCEROL-3-PHOSPHATE sn | 0.991 | 0.984 | 0.715 | 2.5e-191 | |
| TAIR|locus:2042947 | 501 | GPAT6 "GLYCEROL-3-PHOSPHATE sn | 0.965 | 0.962 | 0.577 | 3.2e-152 | |
| TAIR|locus:2080687 | 502 | GPAT5 "GLYCEROL-3-PHOSPHATE sn | 0.953 | 0.948 | 0.425 | 1.9e-99 | |
| TAIR|locus:2152825 | 500 | GPAT7 "GLYCEROL-3-PHOSPHATE sn | 0.929 | 0.928 | 0.428 | 1.4e-94 | |
| TAIR|locus:2009225 | 585 | GPAT1 "GLYCEROL-3-PHOSPHATE sn | 0.917 | 0.782 | 0.417 | 1.3e-91 | |
| TAIR|locus:2204818 | 530 | GPAT2 "GLYCEROL-3-PHOSPHATE sn | 0.919 | 0.866 | 0.370 | 1.9e-76 | |
| TAIR|locus:2141410 | 520 | GPAT3 "GLYCEROL-3-PHOSPHATE sn | 0.907 | 0.871 | 0.372 | 9.6e-73 | |
| ZFIN|ZDB-GENE-030131-3375 | 423 | aup1 "ancient ubiquitous prote | 0.450 | 0.531 | 0.26 | 8.9e-05 |
| TAIR|locus:2126101 GPAT8 "GLYCEROL-3-PHOSPHATE sn-2-ACYLTRANSFERASE 8" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1896 (672.5 bits), Expect = 9.0e-196, P = 9.0e-196
Identities = 359/496 (72%), Positives = 405/496 (81%)
Query: 4 KPGRKFPPITECNGSAYGSIAADLDGTLLVSRSSFPYFMXXXXXXXXXXXXXXXXXXXPI 63
K + FPPITEC Y SIAADLDGTLL+SRSSFPYFM P
Sbjct: 5 KKSQNFPPITECRDGEYDSIAADLDGTLLLSRSSFPYFMLVAVEAGSLLRGLILLLSLPF 64
Query: 64 AIIAYLFISEAIGIQILIFISFSGLKIRDIELASRAVLPRFYAADVRKESYEVFDKCERK 123
II+YLF+SE++GIQILIFISF+GLKIRDIEL SRAVLPRFYAADVRK+S+EVFDKC+RK
Sbjct: 65 VIISYLFVSESLGIQILIFISFAGLKIRDIELVSRAVLPRFYAADVRKDSFEVFDKCKRK 124
Query: 124 VVVTANPTLMVEPFVKDFLGGDKVLGTEIEVNPRTKRATGFVKRPGVLVGKWKKLAVLKE 183
VVVTANP +MVE FVKD+LGGDKVLGTEIEVNP+T RATGFVK+PGVLVG K+LA+LKE
Sbjct: 125 VVVTANPIVMVEAFVKDYLGGDKVLGTEIEVNPKTNRATGFVKKPGVLVGDLKRLAILKE 184
Query: 184 FGEDAPDLGIGDRQTDHDFMSICKEGYMVLPSKSAKPLPRDRLKSRIIFHDGRLVQRPDP 243
FG ++PDLG+GDR +DHDFMS+CK+GYMV +KSA +P++RLK+RI+FHDGRL QRP P
Sbjct: 185 FGNESPDLGLGDRTSDHDFMSLCKKGYMVHATKSATTIPKERLKNRIVFHDGRLAQRPTP 244
Query: 244 LNALITYIWLPFGFILSIIRVYFNLPLPERIVRYTYEMLGIHLVIRXXXXXXXXXXXXXX 303
LNA+ITY+WLPFGFILSIIRVYFNLPLPER VRYTYEMLGIHL IR
Sbjct: 245 LNAIITYLWLPFGFILSIIRVYFNLPLPERFVRYTYEMLGIHLTIRGHRPPPPSPGTLGN 304
Query: 304 LYVCNHRTPLDPIVIAIALGRKVSCVTYSVSKLSRFLSPIPXXXXXXXXXXXXXXXSELL 363
LYV NHRT LDPI++AIALGRK+ CVTYSVS+LS LSPIP +LL
Sbjct: 305 LYVLNHRTALDPIIVAIALGRKICCVTYSVSRLSLMLSPIPAVALTRDRATDAANMRKLL 364
Query: 364 QKGDLVVCPEGTTCRENFLLRFSALFAEMSDRIVPVAVNCKQNMFYGTTVRGVKFWDPYF 423
+KGDLV+CPEGTTCRE +LLRFSALFAE+SDRIVPVA+NCKQ MF GTTVRGVKFWDPYF
Sbjct: 365 EKGDLVICPEGTTCREEYLLRFSALFAELSDRIVPVAMNCKQGMFNGTTVRGVKFWDPYF 424
Query: 424 FFMNPRPTYEVTFLDRLPEEMTCKAGGKSAIEVANYVQKVLGDVLGFECTGLTRKDKYML 483
FFMNPRP+YE TFLDRLPEEMT GGK+ IEVANYVQKV+G VLGFECT LTRKDKY+L
Sbjct: 425 FFMNPRPSYEATFLDRLPEEMTVNGGGKTPIEVANYVQKVIGAVLGFECTELTRKDKYLL 484
Query: 484 LGGNDGKVESMYNSKK 499
LGGNDGKVES+ N+KK
Sbjct: 485 LGGNDGKVESINNTKK 500
|
|
| TAIR|locus:2025381 GPAT4 "GLYCEROL-3-PHOSPHATE sn-2-ACYLTRANSFERASE 4" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2042947 GPAT6 "GLYCEROL-3-PHOSPHATE sn-2-ACYLTRANSFERASE 6" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2080687 GPAT5 "GLYCEROL-3-PHOSPHATE sn-2-ACYLTRANSFERASE 5" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2152825 GPAT7 "GLYCEROL-3-PHOSPHATE sn-2-ACYLTRANSFERASE 7" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2009225 GPAT1 "GLYCEROL-3-PHOSPHATE sn-2-ACYLTRANSFERASE 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2204818 GPAT2 "GLYCEROL-3-PHOSPHATE sn-2-ACYLTRANSFERASE 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2141410 GPAT3 "GLYCEROL-3-PHOSPHATE sn-2-ACYLTRANSFERASE 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030131-3375 aup1 "ancient ubiquitous protein 1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 499 | |||
| PLN02177 | 497 | PLN02177, PLN02177, glycerol-3-phosphate acyltrans | 0.0 | |
| PLN02499 | 498 | PLN02499, PLN02499, glycerol-3-phosphate acyltrans | 1e-180 | |
| PLN02588 | 525 | PLN02588, PLN02588, glycerol-3-phosphate acyltrans | 1e-117 | |
| cd06551 | 187 | cd06551, LPLAT, Lysophospholipid acyltransferases | 3e-20 | |
| cd07989 | 184 | cd07989, LPLAT_AGPAT-like, Lysophospholipid Acyltr | 8e-14 | |
| smart00563 | 118 | smart00563, PlsC, Phosphate acyltransferases | 8e-14 | |
| pfam01553 | 131 | pfam01553, Acyltransferase, Acyltransferase | 4e-11 | |
| cd07991 | 211 | cd07991, LPLAT_LPCAT1-like, Lysophospholipid Acylt | 7e-10 | |
| COG0204 | 255 | COG0204, PlsC, 1-acyl-sn-glycerol-3-phosphate acyl | 2e-05 | |
| TIGR01490 | 202 | TIGR01490, HAD-SF-IB-hyp1, HAD-superfamily subfami | 3e-04 | |
| pfam12710 | 122 | pfam12710, HAD, haloacid dehalogenase-like hydrola | 5e-04 | |
| COG0560 | 212 | COG0560, SerB, Phosphoserine phosphatase [Amino ac | 0.001 |
| >gnl|CDD|215118 PLN02177, PLN02177, glycerol-3-phosphate acyltransferase | Back alignment and domain information |
|---|
Score = 741 bits (1914), Expect = 0.0
Identities = 323/489 (66%), Positives = 407/489 (83%), Gaps = 5/489 (1%)
Query: 7 RKFPPITECN--GSAYGSIAADLDGTLLVSRSSFPYFMLVAVEAGGLLRGLALLVSLPIA 64
R+F PI++C+ G + ++AADLDGTLL+SRS+FPY++LVA+EAG LLR L LL+S+P
Sbjct: 7 RRFEPISKCSSEGRSNQTVAADLDGTLLISRSAFPYYLLVALEAGSLLRALILLLSVPFV 66
Query: 65 IIAYLFISEAIGIQILIFISFSGLKIRDIELASRAVLPRFYAADVRKESYEVFDKCERKV 124
YLFISE++ I+ +FI+F+GLKIRDIEL SR+VLP+FYA DV E++ VF+ ++
Sbjct: 67 YFTYLFISESLAIKTFVFIAFAGLKIRDIELVSRSVLPKFYAEDVHPETWRVFNSFGKRY 126
Query: 125 VVTANPTLMVEPFVKDFLGGDKVLGTEIEVNPRTKRATGFVKRPGVLVGKWKKLAVLKEF 184
++TA+P +MVEPFVK FLG DKVLGTE+EV+ ++ RATGF+K+PGVLVG K+ AVLKEF
Sbjct: 127 IITASPRIMVEPFVKTFLGADKVLGTELEVS-KSGRATGFMKKPGVLVGDHKRDAVLKEF 185
Query: 185 GEDAPDLGIGDRQTDHDFMSICKEGYMVLPSKSAKPLPRDRLKSRIIFHDGRLVQRPDPL 244
G+ PDLG+GDR+TDHDFMSICKEGYMV P +PLPR++L S +IFH+GRLVQRP PL
Sbjct: 186 GDALPDLGLGDRETDHDFMSICKEGYMV-PRTKCEPLPRNKLLSPVIFHEGRLVQRPTPL 244
Query: 245 NALITYIWLPFGFILSIIRVYFNLPLPERIVRYTYEMLGIHLVIRGNPPPAPSSGSPGNL 304
AL+T++W+P GFILS++RVY N+PLPERI RY Y++LGI L+++GNPPP P G PG L
Sbjct: 245 VALLTFLWMPIGFILSLLRVYLNIPLPERIARYNYKLLGIRLIVKGNPPPPPKKGQPGVL 304
Query: 305 YVCNHRTPLDPIVIAIALGRKVSCVTYSVSKLSRFLSPIPAIALTRDRAADAARISELLQ 364
+VCNHRT LDP+V A+ALGRK+SCVTYS+SK S +SPI A+AL+R+R DAA I LL+
Sbjct: 305 FVCNHRTVLDPVVTAVALGRKISCVTYSISKFSELISPIKAVALSREREKDAANIKRLLE 364
Query: 365 KGDLVVCPEGTTCRENFLLRFSALFAEMSDRIVPVAVNCKQNMFYGTTVRGVKFWDPYFF 424
+GDLV+CPEGTTCRE FLLRFSALFAE++DRIVPVA+N KQ+MF+GTTVRG K DPYF
Sbjct: 365 EGDLVICPEGTTCREPFLLRFSALFAELTDRIVPVAINTKQSMFHGTTVRGYKLLDPYFV 424
Query: 425 FMNPRPTYEVTFLDRLPEEMTCKAGGKSAIEVANYVQKVLGDVLGFECTGLTRKDKYMLL 484
FMNPRPTYE+TFL++LP+E+TCK GGKS IEVANY+Q+VL LGFECT LTRKDKY +L
Sbjct: 425 FMNPRPTYEITFLNQLPKELTCK-GGKSPIEVANYIQRVLAGTLGFECTNLTRKDKYAIL 483
Query: 485 GGNDGKVES 493
G DG+V S
Sbjct: 484 AGTDGRVPS 492
|
Length = 497 |
| >gnl|CDD|178115 PLN02499, PLN02499, glycerol-3-phosphate acyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|215320 PLN02588, PLN02588, glycerol-3-phosphate acyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|153244 cd06551, LPLAT, Lysophospholipid acyltransferases (LPLATs) of glycerophospholipid biosynthesis | Back alignment and domain information |
|---|
| >gnl|CDD|153251 cd07989, LPLAT_AGPAT-like, Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: AGPAT-like | Back alignment and domain information |
|---|
| >gnl|CDD|214724 smart00563, PlsC, Phosphate acyltransferases | Back alignment and domain information |
|---|
| >gnl|CDD|216567 pfam01553, Acyltransferase, Acyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|153253 cd07991, LPLAT_LPCAT1-like, Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: LPCAT1-like | Back alignment and domain information |
|---|
| >gnl|CDD|223282 COG0204, PlsC, 1-acyl-sn-glycerol-3-phosphate acyltransferase [Lipid metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|233436 TIGR01490, HAD-SF-IB-hyp1, HAD-superfamily subfamily IB hydrolase, TIGR01490 | Back alignment and domain information |
|---|
| >gnl|CDD|221729 pfam12710, HAD, haloacid dehalogenase-like hydrolase | Back alignment and domain information |
|---|
| >gnl|CDD|223634 COG0560, SerB, Phosphoserine phosphatase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 499 | |||
| PLN02177 | 497 | glycerol-3-phosphate acyltransferase | 100.0 | |
| PLN02499 | 498 | glycerol-3-phosphate acyltransferase | 100.0 | |
| PLN02588 | 525 | glycerol-3-phosphate acyltransferase | 100.0 | |
| TIGR01545 | 210 | YfhB_g-proteo haloacid dehalogenase superfamily, s | 100.0 | |
| KOG2848 | 276 | consensus 1-acyl-sn-glycerol-3-phosphate acyltrans | 99.97 | |
| PRK11590 | 211 | hypothetical protein; Provisional | 99.97 | |
| TIGR01490 | 202 | HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrol | 99.97 | |
| cd07991 | 211 | LPLAT_LPCAT1-like Lysophospholipid Acyltransferase | 99.96 | |
| COG0560 | 212 | SerB Phosphoserine phosphatase [Amino acid transpo | 99.96 | |
| PLN02833 | 376 | glycerol acyltransferase family protein | 99.96 | |
| PRK15018 | 245 | 1-acyl-sn-glycerol-3-phosphate acyltransferase; Pr | 99.96 | |
| PTZ00261 | 355 | acyltransferase; Provisional | 99.89 | |
| PLN02901 | 214 | 1-acyl-sn-glycerol-3-phosphate acyltransferase | 99.88 | |
| cd07992 | 203 | LPLAT_AAK14816-like Lysophospholipid Acyltransfera | 99.87 | |
| cd07986 | 210 | LPLAT_ACT14924-like Lysophospholipid Acyltransfera | 99.84 | |
| PRK06814 | 1140 | acylglycerophosphoethanolamine acyltransferase; Pr | 99.84 | |
| TIGR02137 | 203 | HSK-PSP phosphoserine phosphatase/homoserine phosp | 99.83 | |
| cd07988 | 163 | LPLAT_ABO13168-like Lysophospholipid Acyltransfera | 99.83 | |
| COG0204 | 255 | PlsC 1-acyl-sn-glycerol-3-phosphate acyltransferas | 99.83 | |
| PRK08043 | 718 | bifunctional acyl-[acyl carrier protein] synthetas | 99.82 | |
| PLN02783 | 315 | diacylglycerol O-acyltransferase | 99.81 | |
| PRK08633 | 1146 | 2-acyl-glycerophospho-ethanolamine acyltransferase | 99.8 | |
| TIGR01488 | 177 | HAD-SF-IB Haloacid Dehalogenase superfamily, subfa | 99.78 | |
| cd07993 | 205 | LPLAT_DHAPAT-like Lysophospholipid Acyltransferase | 99.77 | |
| cd07987 | 212 | LPLAT_MGAT-like Lysophospholipid Acyltransferases | 99.77 | |
| cd06551 | 187 | LPLAT Lysophospholipid acyltransferases (LPLATs) o | 99.75 | |
| PRK14014 | 301 | putative acyltransferase; Provisional | 99.74 | |
| PRK11133 | 322 | serB phosphoserine phosphatase; Provisional | 99.73 | |
| PRK08238 | 479 | hypothetical protein; Validated | 99.72 | |
| PF12710 | 192 | HAD: haloacid dehalogenase-like hydrolase; PDB: 3P | 99.71 | |
| cd07985 | 235 | LPLAT_GPAT Lysophospholipid Acyltransferases (LPLA | 99.7 | |
| PRK03355 | 783 | glycerol-3-phosphate acyltransferase; Validated | 99.7 | |
| TIGR00530 | 130 | AGP_acyltrn 1-acyl-sn-glycerol-3-phosphate acyltra | 99.69 | |
| cd07983 | 189 | LPLAT_DUF374-like Lysophospholipid Acyltransferase | 99.69 | |
| TIGR01491 | 201 | HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPa | 99.66 | |
| PF01553 | 132 | Acyltransferase: Acyltransferase; InterPro: IPR002 | 99.66 | |
| TIGR00338 | 219 | serB phosphoserine phosphatase SerB. Phosphoserine | 99.65 | |
| TIGR03703 | 799 | plsB glycerol-3-phosphate O-acyltransferase. Membe | 99.61 | |
| PRK04974 | 818 | glycerol-3-phosphate acyltransferase; Validated | 99.58 | |
| TIGR03333 | 214 | salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl | 99.56 | |
| cd07989 | 184 | LPLAT_AGPAT-like Lysophospholipid Acyltransferases | 99.54 | |
| PLN02510 | 374 | probable 1-acyl-sn-glycerol-3-phosphate acyltransf | 99.53 | |
| cd07990 | 193 | LPLAT_LCLAT1-like Lysophospholipid Acyltransferase | 99.51 | |
| PTZ00374 | 1108 | dihydroxyacetone phosphate acyltransferase; Provis | 99.44 | |
| PLN02954 | 224 | phosphoserine phosphatase | 99.44 | |
| PRK11915 | 621 | glycerol-3-phosphate acyltransferase; Reviewed | 99.43 | |
| PLN02380 | 376 | 1-acyl-sn-glycerol-3-phosphate acyltransferase | 99.42 | |
| smart00563 | 118 | PlsC Phosphate acyltransferases. Function in phosp | 99.38 | |
| PRK09552 | 219 | mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosp | 99.36 | |
| cd07984 | 192 | LPLAT_LABLAT-like Lysophospholipid Acyltransferase | 99.36 | |
| PRK13582 | 205 | thrH phosphoserine phosphatase; Provisional | 99.35 | |
| KOG1615 | 227 | consensus Phosphoserine phosphatase [Amino acid tr | 99.28 | |
| TIGR01489 | 188 | DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopent | 99.24 | |
| KOG2898 | 354 | consensus Predicted phosphate acyltransferase, con | 99.0 | |
| KOG4666 | 412 | consensus Predicted phosphate acyltransferase, con | 98.97 | |
| TIGR01544 | 277 | HAD-SF-IE haloacid dehalogenase superfamily, subfa | 98.83 | |
| TIGR01449 | 213 | PGP_bact 2-phosphoglycolate phosphatase, prokaryot | 98.83 | |
| KOG2847 | 286 | consensus Phosphate acyltransferase [Lipid transpo | 98.82 | |
| PRK10826 | 222 | 2-deoxyglucose-6-phosphatase; Provisional | 98.79 | |
| PRK13222 | 226 | phosphoglycolate phosphatase; Provisional | 98.77 | |
| cd01427 | 139 | HAD_like Haloacid dehalogenase-like hydrolases. Th | 98.7 | |
| PF06888 | 234 | Put_Phosphatase: Putative Phosphatase; InterPro: I | 98.68 | |
| PRK13223 | 272 | phosphoglycolate phosphatase; Provisional | 98.65 | |
| KOG3120 | 256 | consensus Predicted haloacid dehalogenase-like hyd | 98.56 | |
| PRK13226 | 229 | phosphoglycolate phosphatase; Provisional | 98.55 | |
| TIGR03351 | 220 | PhnX-like phosphonatase-like hydrolase. This clade | 98.5 | |
| TIGR01422 | 253 | phosphonatase phosphonoacetaldehyde hydrolase. Thi | 98.46 | |
| PRK13288 | 214 | pyrophosphatase PpaX; Provisional | 98.45 | |
| TIGR02009 | 185 | PGMB-YQAB-SF beta-phosphoglucomutase family hydrol | 98.44 | |
| COG4359 | 220 | Uncharacterized conserved protein [Function unknow | 98.42 | |
| TIGR02253 | 221 | CTE7 HAD superfamily (subfamily IA) hydrolase, TIG | 98.41 | |
| TIGR01428 | 198 | HAD_type_II 2-haloalkanoic acid dehalogenase, type | 98.37 | |
| KOG1505 | 346 | consensus Lysophosphatidic acid acyltransferase LP | 98.36 | |
| TIGR01672 | 237 | AphA HAD superfamily (subfamily IIIB) phosphatase, | 98.29 | |
| PRK13478 | 267 | phosphonoacetaldehyde hydrolase; Provisional | 98.27 | |
| PRK06698 | 459 | bifunctional 5'-methylthioadenosine/S-adenosylhomo | 98.27 | |
| COG0546 | 220 | Gph Predicted phosphatases [General function predi | 98.25 | |
| PRK13225 | 273 | phosphoglycolate phosphatase; Provisional | 98.24 | |
| PRK11587 | 218 | putative phosphatase; Provisional | 98.22 | |
| PLN02770 | 248 | haloacid dehalogenase-like hydrolase family protei | 98.22 | |
| TIGR01454 | 205 | AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthes | 98.21 | |
| TIGR01548 | 197 | HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, | 98.21 | |
| PRK10725 | 188 | fructose-1-P/6-phosphogluconate phosphatase; Provi | 98.21 | |
| TIGR02254 | 224 | YjjG/YfnB HAD superfamily (subfamily IA) hydrolase | 98.2 | |
| PF00702 | 215 | Hydrolase: haloacid dehalogenase-like hydrolase; I | 98.18 | |
| TIGR01990 | 185 | bPGM beta-phosphoglucomutase. The enzyme from L. l | 98.16 | |
| TIGR01509 | 183 | HAD-SF-IA-v3 haloacid dehalogenase superfamily, su | 98.15 | |
| PLN02575 | 381 | haloacid dehalogenase-like hydrolase | 98.13 | |
| PLN03243 | 260 | haloacid dehalogenase-like hydrolase; Provisional | 98.13 | |
| TIGR02252 | 203 | DREG-2 REG-2-like, HAD superfamily (subfamily IA) | 98.08 | |
| TIGR01497 | 675 | kdpB K+-transporting ATPase, B subunit. One sequen | 98.05 | |
| PRK10563 | 221 | 6-phosphogluconate phosphatase; Provisional | 97.99 | |
| PRK14988 | 224 | GMP/IMP nucleotidase; Provisional | 97.96 | |
| PLN02940 | 382 | riboflavin kinase | 97.92 | |
| COG2937 | 810 | PlsB Glycerol-3-phosphate O-acyltransferase [Lipid | 97.92 | |
| PRK08419 | 298 | lipid A biosynthesis lauroyl acyltransferase; Revi | 97.92 | |
| PLN02349 | 426 | glycerol-3-phosphate acyltransferase | 97.86 | |
| PLN02779 | 286 | haloacid dehalogenase-like hydrolase family protei | 97.85 | |
| PHA02597 | 197 | 30.2 hypothetical protein; Provisional | 97.84 | |
| TIGR01993 | 184 | Pyr-5-nucltdase pyrimidine 5'-nucleotidase. These | 97.83 | |
| TIGR01670 | 154 | YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-pho | 97.81 | |
| PF13419 | 176 | HAD_2: Haloacid dehalogenase-like hydrolase; PDB: | 97.81 | |
| PRK07920 | 298 | lipid A biosynthesis lauroyl acyltransferase; Prov | 97.78 | |
| PRK12702 | 302 | mannosyl-3-phosphoglycerate phosphatase; Reviewed | 97.77 | |
| PLN02919 | 1057 | haloacid dehalogenase-like hydrolase family protei | 97.75 | |
| PRK11009 | 237 | aphA acid phosphatase/phosphotransferase; Provisio | 97.65 | |
| COG2217 | 713 | ZntA Cation transport ATPase [Inorganic ion transp | 97.62 | |
| PRK09456 | 199 | ?-D-glucose-1-phosphatase; Provisional | 97.62 | |
| TIGR01493 | 175 | HAD-SF-IA-v2 Haloacid dehalogenase superfamily, su | 97.61 | |
| TIGR01511 | 562 | ATPase-IB1_Cu copper-(or silver)-translocating P-t | 97.59 | |
| PRK09449 | 224 | dUMP phosphatase; Provisional | 97.58 | |
| PRK00192 | 273 | mannosyl-3-phosphoglycerate phosphatase; Reviewed | 97.49 | |
| TIGR01549 | 154 | HAD-SF-IA-v1 haloacid dehalogenase superfamily, su | 97.49 | |
| COG1011 | 229 | Predicted hydrolase (HAD superfamily) [General fun | 97.48 | |
| PRK01122 | 679 | potassium-transporting ATPase subunit B; Provision | 97.46 | |
| PRK10671 | 834 | copA copper exporting ATPase; Provisional | 97.45 | |
| COG0637 | 221 | Predicted phosphatase/phosphohexomutase [General f | 97.41 | |
| KOG3729 | 715 | consensus Mitochondrial glycerol-3-phosphate acylt | 97.37 | |
| COG2121 | 214 | Uncharacterized protein conserved in bacteria [Fun | 97.29 | |
| PRK14010 | 673 | potassium-transporting ATPase subunit B; Provision | 97.26 | |
| PRK09484 | 183 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphata | 97.26 | |
| COG1560 | 308 | HtrB Lauroyl/myristoyl acyltransferase [Cell envel | 97.16 | |
| PRK10748 | 238 | flavin mononucleotide phosphatase; Provisional | 97.15 | |
| COG4030 | 315 | Uncharacterized protein conserved in archaea [Func | 97.13 | |
| COG3700 | 237 | AphA Acid phosphatase (class B) [General function | 97.12 | |
| TIGR01512 | 536 | ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translo | 97.1 | |
| TIGR01525 | 556 | ATPase-IB_hvy heavy metal translocating P-type ATP | 97.09 | |
| TIGR02726 | 169 | phenyl_P_delta phenylphosphate carboxylase, delta | 97.04 | |
| PF03279 | 295 | Lip_A_acyltrans: Bacterial lipid A biosynthesis ac | 96.93 | |
| TIGR01524 | 867 | ATPase-IIIB_Mg magnesium-translocating P-type ATPa | 96.87 | |
| COG1778 | 170 | Low specificity phosphatase (HAD superfamily) [Gen | 96.81 | |
| KOG0207 | 951 | consensus Cation transport ATPase [Inorganic ion t | 96.78 | |
| TIGR01681 | 128 | HAD-SF-IIIC HAD-superfamily phosphatase, subfamily | 96.78 | |
| TIGR02247 | 211 | HAD-1A3-hyp Epoxide hydrolase N-terminal domain-li | 96.77 | |
| PRK11033 | 741 | zntA zinc/cadmium/mercury/lead-transporting ATPase | 96.7 | |
| TIGR01664 | 166 | DNA-3'-Pase DNA 3'-phosphatase. The central phosph | 96.54 | |
| TIGR01523 | 1053 | ATPase-IID_K-Na potassium and/or sodium efflux P-t | 96.53 | |
| COG2216 | 681 | KdpB High-affinity K+ transport system, ATPase cha | 96.5 | |
| KOG3730 | 685 | consensus Acyl-CoA:dihydroxyactetone-phosphate acy | 96.5 | |
| PRK10517 | 902 | magnesium-transporting ATPase MgtA; Provisional | 96.39 | |
| PRK15122 | 903 | magnesium-transporting ATPase; Provisional | 96.33 | |
| TIGR01647 | 755 | ATPase-IIIA_H plasma-membrane proton-efflux P-type | 96.23 | |
| TIGR01517 | 941 | ATPase-IIB_Ca plasma-membrane calcium-translocatin | 96.18 | |
| TIGR01691 | 220 | enolase-ppase 2,3-diketo-5-methylthio-1-phosphopen | 96.1 | |
| TIGR01116 | 917 | ATPase-IIA1_Ca sarco/endoplasmic reticulum calcium | 96.08 | |
| PRK06628 | 290 | lipid A biosynthesis lauroyl acyltransferase; Prov | 96.07 | |
| PRK03669 | 271 | mannosyl-3-phosphoglycerate phosphatase; Reviewed | 96.02 | |
| TIGR01522 | 884 | ATPase-IIA2_Ca golgi membrane calcium-translocatin | 95.96 | |
| PF05822 | 246 | UMPH-1: Pyrimidine 5'-nucleotidase (UMPH-1); Inter | 95.89 | |
| PRK06946 | 293 | lipid A biosynthesis lauroyl acyltransferase; Prov | 95.89 | |
| PRK06553 | 308 | lipid A biosynthesis lauroyl acyltransferase; Prov | 95.85 | |
| TIGR01663 | 526 | PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase | 95.77 | |
| PRK10530 | 272 | pyridoxal phosphate (PLP) phosphatase; Provisional | 95.69 | |
| PRK14502 | 694 | bifunctional mannosyl-3-phosphoglycerate synthase/ | 95.43 | |
| TIGR02463 | 221 | MPGP_rel mannosyl-3-phosphoglycerate phosphatase-r | 95.43 | |
| TIGR01533 | 266 | lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) famil | 95.4 | |
| KOG2914 | 222 | consensus Predicted haloacid-halidohydrolase and r | 95.36 | |
| COG0474 | 917 | MgtA Cation transport ATPase [Inorganic ion transp | 95.36 | |
| PRK10976 | 266 | putative hydrolase; Provisional | 95.35 | |
| PRK10513 | 270 | sugar phosphate phosphatase; Provisional | 95.32 | |
| PLN02811 | 220 | hydrolase | 95.3 | |
| PRK10530 | 272 | pyridoxal phosphate (PLP) phosphatase; Provisional | 95.29 | |
| TIGR01494 | 499 | ATPase_P-type ATPase, P-type (transporting), HAD s | 95.25 | |
| PRK08943 | 314 | lipid A biosynthesis (KDO)2-(lauroyl)-lipid IVA ac | 95.22 | |
| TIGR02208 | 305 | lipid_A_msbB lipid A biosynthesis (KDO)2-(lauroyl) | 95.2 | |
| PRK06860 | 309 | lipid A biosynthesis lauroyl acyltransferase; Prov | 95.19 | |
| TIGR01486 | 256 | HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosph | 95.11 | |
| TIGR01487 | 215 | SPP-like sucrose-phosphate phosphatase-like hydrol | 95.1 | |
| PRK03669 | 271 | mannosyl-3-phosphoglycerate phosphatase; Reviewed | 95.09 | |
| PRK05646 | 310 | lipid A biosynthesis lauroyl acyltransferase; Prov | 95.05 | |
| PRK08734 | 305 | lipid A biosynthesis lauroyl acyltransferase; Prov | 95.04 | |
| COG0561 | 264 | Cof Predicted hydrolases of the HAD superfamily [G | 94.96 | |
| PF08282 | 254 | Hydrolase_3: haloacid dehalogenase-like hydrolase; | 94.92 | |
| PRK10513 | 270 | sugar phosphate phosphatase; Provisional | 94.92 | |
| PRK15126 | 272 | thiamin pyrimidine pyrophosphate hydrolase; Provis | 94.91 | |
| PRK08706 | 289 | lipid A biosynthesis lauroyl acyltransferase; Prov | 94.91 | |
| TIGR02461 | 225 | osmo_MPG_phos mannosyl-3-phosphoglycerate phosphat | 94.9 | |
| PRK15126 | 272 | thiamin pyrimidine pyrophosphate hydrolase; Provis | 94.82 | |
| PRK01158 | 230 | phosphoglycolate phosphatase; Provisional | 94.81 | |
| TIGR01106 | 997 | ATPase-IIC_X-K sodium or proton efflux -- potassiu | 94.72 | |
| COG3769 | 274 | Predicted hydrolase (HAD superfamily) [General fun | 94.64 | |
| PRK10976 | 266 | putative hydrolase; Provisional | 94.55 | |
| COG4087 | 152 | Soluble P-type ATPase [General function prediction | 94.53 | |
| TIGR01482 | 225 | SPP-subfamily Sucrose-phosphate phosphatase subfam | 94.53 | |
| smart00775 | 157 | LNS2 LNS2 domain. This domain is found in Saccharo | 94.15 | |
| PRK08733 | 306 | lipid A biosynthesis lauroyl acyltransferase; Prov | 94.14 | |
| PRK08905 | 289 | lipid A biosynthesis lauroyl acyltransferase; Vali | 94.07 | |
| PRK01158 | 230 | phosphoglycolate phosphatase; Provisional | 93.8 | |
| PLN02887 | 580 | hydrolase family protein | 93.57 | |
| PRK12702 | 302 | mannosyl-3-phosphoglycerate phosphatase; Reviewed | 93.2 | |
| TIGR02207 | 303 | lipid_A_htrB lipid A biosynthesis lauroyl (or palm | 93.13 | |
| TIGR01675 | 229 | plant-AP plant acid phosphatase. This model explic | 93.03 | |
| TIGR01657 | 1054 | P-ATPase-V P-type ATPase of unknown pump specifici | 92.88 | |
| PRK05906 | 454 | lipid A biosynthesis lauroyl acyltransferase; Prov | 92.51 | |
| TIGR00099 | 256 | Cof-subfamily Cof subfamily of IIB subfamily of ha | 92.49 | |
| PRK08025 | 305 | lipid A biosynthesis palmitoleoyl acyltransferase; | 92.28 | |
| TIGR01652 | 1057 | ATPase-Plipid phospholipid-translocating P-type AT | 92.26 | |
| PF08645 | 159 | PNK3P: Polynucleotide kinase 3 phosphatase; InterP | 91.94 | |
| PTZ00174 | 247 | phosphomannomutase; Provisional | 91.75 | |
| PF05116 | 247 | S6PP: Sucrose-6F-phosphate phosphohydrolase; Inter | 91.62 | |
| PLN02382 | 413 | probable sucrose-phosphatase | 91.61 | |
| PRK15174 | 656 | Vi polysaccharide export protein VexE; Provisional | 91.61 | |
| TIGR02471 | 236 | sucr_syn_bact_C sucrose phosphate synthase, sucros | 91.58 | |
| TIGR01662 | 132 | HAD-SF-IIIA HAD-superfamily hydrolase, subfamily I | 91.43 | |
| PF03982 | 297 | DAGAT: Diacylglycerol acyltransferase ; InterPro: | 91.43 | |
| PRK14502 | 694 | bifunctional mannosyl-3-phosphoglycerate synthase/ | 91.37 | |
| TIGR01484 | 204 | HAD-SF-IIB HAD-superfamily hydrolase, subfamily II | 91.31 | |
| PRK05645 | 295 | lipid A biosynthesis lauroyl acyltransferase; Prov | 91.02 | |
| TIGR01261 | 161 | hisB_Nterm histidinol-phosphatase. This model desc | 90.85 | |
| PLN02887 | 580 | hydrolase family protein | 90.65 | |
| KOG3109 | 244 | consensus Haloacid dehalogenase-like hydrolase [Ge | 90.63 | |
| PHA02530 | 300 | pseT polynucleotide kinase; Provisional | 90.61 | |
| KOG0202 | 972 | consensus Ca2+ transporting ATPase [Inorganic ion | 90.49 | |
| TIGR01485 | 249 | SPP_plant-cyano sucrose-6F-phosphate phosphohydrol | 90.17 | |
| PRK05446 | 354 | imidazole glycerol-phosphate dehydratase/histidino | 87.36 | |
| PLN03190 | 1178 | aminophospholipid translocase; Provisional | 86.69 | |
| TIGR00213 | 176 | GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase | 86.58 | |
| TIGR01689 | 126 | EcbF-BcbF capsule biosynthesis phosphatase. Due to | 86.05 | |
| PRK08942 | 181 | D,D-heptose 1,7-bisphosphate phosphatase; Validate | 85.32 | |
| PRK10187 | 266 | trehalose-6-phosphate phosphatase; Provisional | 85.01 | |
| PTZ00174 | 247 | phosphomannomutase; Provisional | 84.95 | |
| TIGR01656 | 147 | Histidinol-ppas histidinol-phosphate phosphatase f | 84.93 | |
| smart00577 | 148 | CPDc catalytic domain of ctd-like phosphatases. | 84.79 | |
| KOG3128 | 298 | consensus Uncharacterized conserved protein [Funct | 84.5 | |
| PRK06769 | 173 | hypothetical protein; Validated | 84.1 | |
| TIGR01684 | 301 | viral_ppase viral phosphatase. These proteins also | 83.58 | |
| TIGR01685 | 174 | MDP-1 magnesium-dependent phosphatase-1. This mode | 81.76 | |
| PLN02423 | 245 | phosphomannomutase | 81.14 | |
| PLN02423 | 245 | phosphomannomutase | 81.14 | |
| TIGR01668 | 170 | YqeG_hyp_ppase HAD superfamily (subfamily IIIA) ph | 81.11 | |
| TIGR02244 | 343 | HAD-IG-Ncltidse HAD superfamily (subfamily IG) hyd | 80.97 | |
| smart00775 | 157 | LNS2 LNS2 domain. This domain is found in Saccharo | 80.76 | |
| PF12689 | 169 | Acid_PPase: Acid Phosphatase; InterPro: IPR010036 | 80.47 | |
| COG3176 | 292 | Putative hemolysin [General function prediction on | 80.1 |
| >PLN02177 glycerol-3-phosphate acyltransferase | Back alignment and domain information |
|---|
Probab=100.00 E-value=4.9e-97 Score=777.10 Aligned_cols=490 Identities=66% Similarity=1.183 Sum_probs=446.4
Q ss_pred CCCCCCccccCC--CCCeEEEEecCCceeecCCchHHHHHHHHHhcchHHHHHHHhhHHHHHHHhhcCChhHHHHHHHHH
Q 010860 6 GRKFPPITECNG--SAYGSIAADLDGTLLVSRSSFPYFMLVAVEAGGLLRGLALLVSLPIAIIAYLFISEAIGIQILIFI 83 (499)
Q Consensus 6 ~~~~~~~~~~~~--~~~~~avFD~DgTL~~~~s~~~~~~~~~~~~~~~~r~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~ 83 (499)
.|.||+|++|++ ..+.+++|||||||+.++|+|.+|+.++++++++++.+..+..+|++++++..++++..++.+++.
T Consensus 6 ~~~~~~~~~~~~~~~~~~~~~FDfDGTLt~~~s~f~~Fll~A~~~~~~~r~lllll~~P~~~l~~~~~~~~~~~~~l~~~ 85 (497)
T PLN02177 6 SRRFEPISKCSSEGRSNQTVAADLDGTLLISRSAFPYYLLVALEAGSLLRALILLLSVPFVYFTYLFISESLAIKTFVFI 85 (497)
T ss_pred cCCCCccccCCcccccccEEEEecCCcccCCCCccHHHHHHHcccchHHHHHHHHHHhHHHHHHHhcCCchhHHHHHHHH
Confidence 477999999977 577899999999999999999999999888788888877766778888665446677778888889
Q ss_pred HhcCCCHHHHHHHHHHHhhhHHHhhccHHHHHHHHhCCCEEEEeCCcHHHHHHHHhhhcCCcEEEeCeEEEecCCCceee
Q 010860 84 SFSGLKIRDIELASRAVLPRFYAADVRKESYEVFDKCERKVVVTANPTLMVEPFVKDFLGGDKVLGTEIEVNPRTKRATG 163 (499)
Q Consensus 84 ~l~G~~~~~l~~~~~~~~~~~~~~~i~~~~~~~~~~~G~vvlvSas~~~~v~~ia~~~lg~d~vigt~l~~~~~~g~~tG 163 (499)
+|+|++++++++++++|+++++.+.+++++++.++++|++||||||++.+|+|||+++||+|+||||+++++. +|++||
T Consensus 86 ~f~G~~~~el~~~~r~~l~~f~~~~l~~~a~~~~~~~g~~vvVSASp~~~Vepfa~~~LGid~VIgTeLev~~-~G~~TG 164 (497)
T PLN02177 86 AFAGLKIRDIELVSRSVLPKFYAEDVHPETWRVFNSFGKRYIITASPRIMVEPFVKTFLGADKVLGTELEVSK-SGRATG 164 (497)
T ss_pred HHcCCCHHHHHHHHHHHHHHHHHHhcCHHHHHHHHhCCCEEEEECCcHHHHHHHHHHcCCCCEEEecccEECc-CCEEee
Confidence 9999999999999999999998889999999999999966999999999999999877999999999999832 899999
Q ss_pred eEecCCcccchhHHHHHHHHhCCCCCeEEEeCCcCcHHHHhccccCeecCCCCCCCCCCcccCCceeEEccCccCCCCCh
Q 010860 164 FVKRPGVLVGKWKKLAVLKEFGEDAPDLGIGDRQTDHDFMSICKEGYMVLPSKSAKPLPRDRLKSRIIFHDGRLVQRPDP 243 (499)
Q Consensus 164 ~~~~~~~~~g~~K~~~l~~~~~~~~~~~aygDS~~D~pmL~~a~~~~~Vnp~~~~~~~~~~~~~~~~~f~~~r~~~~~~~ 243 (499)
++.|++||+|++|++++++++|.+..++|||||.+|+|||++|+++|+||+++ |+++|+.++.+|++|||||++++|+|
T Consensus 165 ~i~g~~~c~Ge~Kv~rl~~~~g~~~~~~aYgDS~sD~plL~~a~e~y~V~~~~-~~~~~~~~~~~~~~fhdgrl~~~p~~ 243 (497)
T PLN02177 165 FMKKPGVLVGDHKRDAVLKEFGDALPDLGLGDRETDHDFMSICKEGYMVPRTK-CEPLPRNKLLSPVIFHEGRLVQRPTP 243 (497)
T ss_pred eecCCCCCccHHHHHHHHHHhCCCCceEEEECCccHHHHHHhCCccEEeCCCC-CCcCCcccCCCceeeeCCcccCCCCH
Confidence 99997678999999999998885445699999999999999999999999955 99999999999999999999999999
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHhhccchHHHHHHHHHhhcEEEEEcCCCCCCCCCCCCCeEEEecCCCCChHHHHHHHhC
Q 010860 244 LNALITYIWLPFGFILSIIRVYFNLPLPERIVRYTYEMLGIHLVIRGNPPPAPSSGSPGNLYVCNHRTPLDPIVIAIALG 323 (499)
Q Consensus 244 ~~~l~~~~~~p~~~~l~~~r~~~~~~~p~~~~~~~~~~~Gi~v~v~G~~~~p~~~~~~p~iiVaNH~S~lD~~~l~~~~~ 323 (499)
+.++++++|+|+|++|+++|+++++.+|.+|++.+++++|++++|+|.+++|+...++++|+||||+|++|++++.+.++
T Consensus 244 ~~~l~~~~~~p~g~~l~~~r~~~~~~lp~~~~~~~~~~~Gv~v~v~G~e~~p~~~~~~~~l~v~NHqS~lD~~~l~~al~ 323 (497)
T PLN02177 244 LVALLTFLWMPIGFILSLLRVYLNIPLPERIARYNYKLLGIRLIVKGNPPPPPKKGQPGVLFVCNHRTVLDPVVTAVALG 323 (497)
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHhhhhHHHHHHHHHHHcCcEEEEEcCCCCCcccCCCCeEEEECCCCcchHHHHHHHcC
Confidence 99999999999999999999999999999999999999999999999999874223479999999999999999999998
Q ss_pred CccceeeecccccccccccCCeeEeecCCHHHHHHHHHHhhCCCEEEecCCeecCCCcccccchhhhhcCCcEEEEEEee
Q 010860 324 RKVSCVTYSVSKLSRFLSPIPAIALTRDRAADAARISELLQKGDLVVCPEGTTCRENFLLRFSALFAEMSDRIVPVAVNC 403 (499)
Q Consensus 324 ~~~~~v~~~v~k~~~~~~~~~~i~i~R~~~~~~~~~~~~l~~G~l~IFPEGTrt~~~~l~~Fk~~~~~~~~pVvPV~I~~ 403 (499)
+++.++.++++++++++.++++++++|++.++..++++.+++|+++|||||||++++.+++||++++++.+|||||+|.+
T Consensus 324 ~~~~~v~~~~~~l~~~l~~i~~~~ldR~r~~~~~~~~~lL~~g~lvIFPEGTrs~~~~l~~Fk~~fa~l~~pIVPVAI~~ 403 (497)
T PLN02177 324 RKISCVTYSISKFSELISPIKAVALSREREKDAANIKRLLEEGDLVICPEGTTCREPFLLRFSALFAELTDRIVPVAINT 403 (497)
T ss_pred CCeEEEeehHHHHHHHHHhcCEEEEeCCChHHHHHHHHHHhcCCEEECcCcCCCCCCCcchHHHHHHHHCCcEEEEEEEc
Confidence 88777777777777788899999999998777788889999999999999999999999999999988889999999999
Q ss_pred ccCCccccccCCcccccccccccCCCCeEEEEEccccCCcccccCCCCCHHHHHHHHHHHHHHhhCCcccCCCHHHHHHh
Q 010860 404 KQNMFYGTTVRGVKFWDPYFFFMNPRPTYEVTFLDRLPEEMTCKAGGKSAIEVANYVQKVLGDVLGFECTGLTRKDKYML 483 (499)
Q Consensus 404 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~v~~l~pi~~~~~~~~~~~~~~~la~~v~~~i~~~l~~~~~~~t~~dk~~~ 483 (499)
+..+|++++.++++++|++|++|+|++.++|+||+|++++..|. .+++..++|++||+.|+++|++++|++|.+|||+.
T Consensus 404 ~~~~f~~~t~~~~~~~d~~~~~~~p~~~y~V~fL~~l~~~~~~~-~~~~~~evAn~Vq~~i~~~lg~~~t~~tr~dk~~~ 482 (497)
T PLN02177 404 KQSMFHGTTVRGYKLLDPYFVFMNPRPTYEITFLNQLPKELTCK-GGKSPIEVANYIQRVLAGTLGFECTNLTRKDKYAI 482 (497)
T ss_pred ccccccccccccceecchhhhhcCCCceEEEEECCCCChhhccc-CCCCHHHHHHHHHHHHHHhhCceeccccHHHHHHH
Confidence 99999988889999999999999999999999999999985333 57899999999999999999999999999999999
Q ss_pred hcCCCccccccccCC
Q 010860 484 LGGNDGKVESMYNSK 498 (499)
Q Consensus 484 l~~~~~~~~~~~~~~ 498 (499)
|.||+|.|++..+.|
T Consensus 483 l~gn~g~v~~~~~~~ 497 (497)
T PLN02177 483 LAGTDGRVPSKKEKK 497 (497)
T ss_pred hcCCCccccCCCCCC
Confidence 999999998876543
|
|
| >PLN02499 glycerol-3-phosphate acyltransferase | Back alignment and domain information |
|---|
| >PLN02588 glycerol-3-phosphate acyltransferase | Back alignment and domain information |
|---|
| >TIGR01545 YfhB_g-proteo haloacid dehalogenase superfamily, subfamily IF hydrolase, YfhB | Back alignment and domain information |
|---|
| >KOG2848 consensus 1-acyl-sn-glycerol-3-phosphate acyltransferase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11590 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01490 HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrolase, TIGR01490 | Back alignment and domain information |
|---|
| >cd07991 LPLAT_LPCAT1-like Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: LPCAT1-like | Back alignment and domain information |
|---|
| >COG0560 SerB Phosphoserine phosphatase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02833 glycerol acyltransferase family protein | Back alignment and domain information |
|---|
| >PRK15018 1-acyl-sn-glycerol-3-phosphate acyltransferase; Provisional | Back alignment and domain information |
|---|
| >PTZ00261 acyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02901 1-acyl-sn-glycerol-3-phosphate acyltransferase | Back alignment and domain information |
|---|
| >cd07992 LPLAT_AAK14816-like Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: Unknown AAK14816-like | Back alignment and domain information |
|---|
| >cd07986 LPLAT_ACT14924-like Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: Unknown ACT14924 | Back alignment and domain information |
|---|
| >PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR02137 HSK-PSP phosphoserine phosphatase/homoserine phosphotransferase bifunctional protein | Back alignment and domain information |
|---|
| >cd07988 LPLAT_ABO13168-like Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: Unknown ABO13168 | Back alignment and domain information |
|---|
| >COG0204 PlsC 1-acyl-sn-glycerol-3-phosphate acyltransferase [Lipid metabolism] | Back alignment and domain information |
|---|
| >PRK08043 bifunctional acyl-[acyl carrier protein] synthetase/2-acylglycerophosphoethanolamine acyltransferase; Validated | Back alignment and domain information |
|---|
| >PLN02783 diacylglycerol O-acyltransferase | Back alignment and domain information |
|---|
| >PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated | Back alignment and domain information |
|---|
| >TIGR01488 HAD-SF-IB Haloacid Dehalogenase superfamily, subfamily IB, phosphoserine phosphatase-like | Back alignment and domain information |
|---|
| >cd07993 LPLAT_DHAPAT-like Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: GPAT-like | Back alignment and domain information |
|---|
| >cd07987 LPLAT_MGAT-like Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: MGAT-like | Back alignment and domain information |
|---|
| >cd06551 LPLAT Lysophospholipid acyltransferases (LPLATs) of glycerophospholipid biosynthesis | Back alignment and domain information |
|---|
| >PRK14014 putative acyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK11133 serB phosphoserine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK08238 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF12710 HAD: haloacid dehalogenase-like hydrolase; PDB: 3P96_A 3N28_A 3FVV_A 1RKU_A 1RKV_A 1Y8A_A 2FEA_B 3KD3_B | Back alignment and domain information |
|---|
| >cd07985 LPLAT_GPAT Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: GPAT | Back alignment and domain information |
|---|
| >PRK03355 glycerol-3-phosphate acyltransferase; Validated | Back alignment and domain information |
|---|
| >TIGR00530 AGP_acyltrn 1-acyl-sn-glycerol-3-phosphate acyltransferases | Back alignment and domain information |
|---|
| >cd07983 LPLAT_DUF374-like Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: DUF374 | Back alignment and domain information |
|---|
| >TIGR01491 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPase-like hydrolase, archaeal | Back alignment and domain information |
|---|
| >PF01553 Acyltransferase: Acyltransferase; InterPro: IPR002123 This family contains acyltransferases involved in phospholipid biosynthesis and other proteins of unknown function [] | Back alignment and domain information |
|---|
| >TIGR00338 serB phosphoserine phosphatase SerB | Back alignment and domain information |
|---|
| >TIGR03703 plsB glycerol-3-phosphate O-acyltransferase | Back alignment and domain information |
|---|
| >PRK04974 glycerol-3-phosphate acyltransferase; Validated | Back alignment and domain information |
|---|
| >TIGR03333 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase | Back alignment and domain information |
|---|
| >cd07989 LPLAT_AGPAT-like Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: AGPAT-like | Back alignment and domain information |
|---|
| >PLN02510 probable 1-acyl-sn-glycerol-3-phosphate acyltransferase | Back alignment and domain information |
|---|
| >cd07990 LPLAT_LCLAT1-like Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: LCLAT1-like | Back alignment and domain information |
|---|
| >PTZ00374 dihydroxyacetone phosphate acyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02954 phosphoserine phosphatase | Back alignment and domain information |
|---|
| >PRK11915 glycerol-3-phosphate acyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PLN02380 1-acyl-sn-glycerol-3-phosphate acyltransferase | Back alignment and domain information |
|---|
| >smart00563 PlsC Phosphate acyltransferases | Back alignment and domain information |
|---|
| >PRK09552 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >cd07984 LPLAT_LABLAT-like Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: LABLAT-like | Back alignment and domain information |
|---|
| >PRK13582 thrH phosphoserine phosphatase; Provisional | Back alignment and domain information |
|---|
| >KOG1615 consensus Phosphoserine phosphatase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01489 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopentane phosphatase | Back alignment and domain information |
|---|
| >KOG2898 consensus Predicted phosphate acyltransferase, contains PlsC domain [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG4666 consensus Predicted phosphate acyltransferase, contains PlsC domain [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01544 HAD-SF-IE haloacid dehalogenase superfamily, subfamily IE hydrolase, TIGR01544 | Back alignment and domain information |
|---|
| >TIGR01449 PGP_bact 2-phosphoglycolate phosphatase, prokaryotic | Back alignment and domain information |
|---|
| >KOG2847 consensus Phosphate acyltransferase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10826 2-deoxyglucose-6-phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK13222 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >cd01427 HAD_like Haloacid dehalogenase-like hydrolases | Back alignment and domain information |
|---|
| >PF06888 Put_Phosphatase: Putative Phosphatase; InterPro: IPR016965 This group represents phosphatases related to PHOSPHO1 and PHOSPHO2 [] | Back alignment and domain information |
|---|
| >PRK13223 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >KOG3120 consensus Predicted haloacid dehalogenase-like hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK13226 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR03351 PhnX-like phosphonatase-like hydrolase | Back alignment and domain information |
|---|
| >TIGR01422 phosphonatase phosphonoacetaldehyde hydrolase | Back alignment and domain information |
|---|
| >PRK13288 pyrophosphatase PpaX; Provisional | Back alignment and domain information |
|---|
| >TIGR02009 PGMB-YQAB-SF beta-phosphoglucomutase family hydrolase | Back alignment and domain information |
|---|
| >COG4359 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >TIGR02253 CTE7 HAD superfamily (subfamily IA) hydrolase, TIGR02253 | Back alignment and domain information |
|---|
| >TIGR01428 HAD_type_II 2-haloalkanoic acid dehalogenase, type II | Back alignment and domain information |
|---|
| >KOG1505 consensus Lysophosphatidic acid acyltransferase LPAAT and related acyltransferases [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01672 AphA HAD superfamily (subfamily IIIB) phosphatase, TIGR01672 | Back alignment and domain information |
|---|
| >PRK13478 phosphonoacetaldehyde hydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK06698 bifunctional 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase/phosphatase; Validated | Back alignment and domain information |
|---|
| >COG0546 Gph Predicted phosphatases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK13225 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK11587 putative phosphatase; Provisional | Back alignment and domain information |
|---|
| >PLN02770 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >TIGR01454 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthesis related protein | Back alignment and domain information |
|---|
| >TIGR01548 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, subfamily IA hydrolase, TIGR01548 | Back alignment and domain information |
|---|
| >PRK10725 fructose-1-P/6-phosphogluconate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR02254 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase, TIGR02254 | Back alignment and domain information |
|---|
| >PF00702 Hydrolase: haloacid dehalogenase-like hydrolase; InterPro: IPR005834 This group of hydrolase enzymes is structurally different from the alpha/beta hydrolase family (abhydrolase) | Back alignment and domain information |
|---|
| >TIGR01990 bPGM beta-phosphoglucomutase | Back alignment and domain information |
|---|
| >TIGR01509 HAD-SF-IA-v3 haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED | Back alignment and domain information |
|---|
| >PLN02575 haloacid dehalogenase-like hydrolase | Back alignment and domain information |
|---|
| >PLN03243 haloacid dehalogenase-like hydrolase; Provisional | Back alignment and domain information |
|---|
| >TIGR02252 DREG-2 REG-2-like, HAD superfamily (subfamily IA) hydrolase | Back alignment and domain information |
|---|
| >TIGR01497 kdpB K+-transporting ATPase, B subunit | Back alignment and domain information |
|---|
| >PRK10563 6-phosphogluconate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK14988 GMP/IMP nucleotidase; Provisional | Back alignment and domain information |
|---|
| >PLN02940 riboflavin kinase | Back alignment and domain information |
|---|
| >COG2937 PlsB Glycerol-3-phosphate O-acyltransferase [Lipid metabolism] | Back alignment and domain information |
|---|
| >PRK08419 lipid A biosynthesis lauroyl acyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PLN02349 glycerol-3-phosphate acyltransferase | Back alignment and domain information |
|---|
| >PLN02779 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >PHA02597 30 | Back alignment and domain information |
|---|
| >TIGR01993 Pyr-5-nucltdase pyrimidine 5'-nucleotidase | Back alignment and domain information |
|---|
| >TIGR01670 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI family | Back alignment and domain information |
|---|
| >PF13419 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 2FI1_A 2I6X_A 3SD7_A 4F71_A 4DFD_B 4F72_B 4DCC_A 3DDH_A 3KZX_A 2B0C_A | Back alignment and domain information |
|---|
| >PRK07920 lipid A biosynthesis lauroyl acyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK12702 mannosyl-3-phosphoglycerate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >PLN02919 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >PRK11009 aphA acid phosphatase/phosphotransferase; Provisional | Back alignment and domain information |
|---|
| >COG2217 ZntA Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK09456 ?-D-glucose-1-phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01493 HAD-SF-IA-v2 Haloacid dehalogenase superfamily, subfamily IA, variant 2 with 3rd motif like haloacid dehalogenase | Back alignment and domain information |
|---|
| >TIGR01511 ATPase-IB1_Cu copper-(or silver)-translocating P-type ATPase | Back alignment and domain information |
|---|
| >PRK09449 dUMP phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK00192 mannosyl-3-phosphoglycerate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01549 HAD-SF-IA-v1 haloacid dehalogenase superfamily, subfamily IA, variant 1 with third motif having Dx(3-4)D or Dx(3-4)E | Back alignment and domain information |
|---|
| >COG1011 Predicted hydrolase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK01122 potassium-transporting ATPase subunit B; Provisional | Back alignment and domain information |
|---|
| >PRK10671 copA copper exporting ATPase; Provisional | Back alignment and domain information |
|---|
| >COG0637 Predicted phosphatase/phosphohexomutase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3729 consensus Mitochondrial glycerol-3-phosphate acyltransferase GPAT [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >COG2121 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PRK14010 potassium-transporting ATPase subunit B; Provisional | Back alignment and domain information |
|---|
| >PRK09484 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; Provisional | Back alignment and domain information |
|---|
| >COG1560 HtrB Lauroyl/myristoyl acyltransferase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PRK10748 flavin mononucleotide phosphatase; Provisional | Back alignment and domain information |
|---|
| >COG4030 Uncharacterized protein conserved in archaea [Function unknown] | Back alignment and domain information |
|---|
| >COG3700 AphA Acid phosphatase (class B) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01512 ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type ATPase | Back alignment and domain information |
|---|
| >TIGR01525 ATPase-IB_hvy heavy metal translocating P-type ATPase | Back alignment and domain information |
|---|
| >TIGR02726 phenyl_P_delta phenylphosphate carboxylase, delta subunit | Back alignment and domain information |
|---|
| >PF03279 Lip_A_acyltrans: Bacterial lipid A biosynthesis acyltransferase; InterPro: IPR004960 Bacterial lipopolysachharides (LPS) are glycolipids that make up the outer monolayer of the outer membranes of most Gram-negative bacteria | Back alignment and domain information |
|---|
| >TIGR01524 ATPase-IIIB_Mg magnesium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >COG1778 Low specificity phosphatase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0207 consensus Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01681 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily IIIC | Back alignment and domain information |
|---|
| >TIGR02247 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-like phosphatase | Back alignment and domain information |
|---|
| >PRK11033 zntA zinc/cadmium/mercury/lead-transporting ATPase; Provisional | Back alignment and domain information |
|---|
| >TIGR01664 DNA-3'-Pase DNA 3'-phosphatase | Back alignment and domain information |
|---|
| >TIGR01523 ATPase-IID_K-Na potassium and/or sodium efflux P-type ATPase, fungal-type | Back alignment and domain information |
|---|
| >COG2216 KdpB High-affinity K+ transport system, ATPase chain B [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG3730 consensus Acyl-CoA:dihydroxyactetone-phosphate acyltransferase DHAPAT [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10517 magnesium-transporting ATPase MgtA; Provisional | Back alignment and domain information |
|---|
| >PRK15122 magnesium-transporting ATPase; Provisional | Back alignment and domain information |
|---|
| >TIGR01647 ATPase-IIIA_H plasma-membrane proton-efflux P-type ATPase | Back alignment and domain information |
|---|
| >TIGR01517 ATPase-IIB_Ca plasma-membrane calcium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >TIGR01691 enolase-ppase 2,3-diketo-5-methylthio-1-phosphopentane phosphatase | Back alignment and domain information |
|---|
| >TIGR01116 ATPase-IIA1_Ca sarco/endoplasmic reticulum calcium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >PRK06628 lipid A biosynthesis lauroyl acyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK03669 mannosyl-3-phosphoglycerate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01522 ATPase-IIA2_Ca golgi membrane calcium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >PF05822 UMPH-1: Pyrimidine 5'-nucleotidase (UMPH-1); InterPro: IPR006434 This family is a small group of metazoan sequences with sequences from Arabidopsis thaliana (Mouse-ear cress) and rice | Back alignment and domain information |
|---|
| >PRK06946 lipid A biosynthesis lauroyl acyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06553 lipid A biosynthesis lauroyl acyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase | Back alignment and domain information |
|---|
| >PRK10530 pyridoxal phosphate (PLP) phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK14502 bifunctional mannosyl-3-phosphoglycerate synthase/mannosyl-3 phosphoglycerate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR02463 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-related protein | Back alignment and domain information |
|---|
| >TIGR01533 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) family | Back alignment and domain information |
|---|
| >KOG2914 consensus Predicted haloacid-halidohydrolase and related hydrolases [General function prediction only] | Back alignment and domain information |
|---|
| >COG0474 MgtA Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10976 putative hydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK10513 sugar phosphate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PLN02811 hydrolase | Back alignment and domain information |
|---|
| >PRK10530 pyridoxal phosphate (PLP) phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01494 ATPase_P-type ATPase, P-type (transporting), HAD superfamily, subfamily IC | Back alignment and domain information |
|---|
| >PRK08943 lipid A biosynthesis (KDO)2-(lauroyl)-lipid IVA acyltransferase; Validated | Back alignment and domain information |
|---|
| >TIGR02208 lipid_A_msbB lipid A biosynthesis (KDO)2-(lauroyl)-lipid IVA acyltransferase | Back alignment and domain information |
|---|
| >PRK06860 lipid A biosynthesis lauroyl acyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01486 HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosphatase family | Back alignment and domain information |
|---|
| >TIGR01487 SPP-like sucrose-phosphate phosphatase-like hydrolase, Archaeal | Back alignment and domain information |
|---|
| >PRK03669 mannosyl-3-phosphoglycerate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >PRK05646 lipid A biosynthesis lauroyl acyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK08734 lipid A biosynthesis lauroyl acyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG0561 Cof Predicted hydrolases of the HAD superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >PF08282 Hydrolase_3: haloacid dehalogenase-like hydrolase; InterPro: IPR013200 The Haloacid Dehydrogenase (HAD) superfamily includes phosphatases, phosphonatases, P-type ATPases, beta-phosphoglucomutases, phosphomannomutases, and dehalogenases, which are involved in a variety of cellular processes ranging from amino acid biosynthesis to detoxification [] | Back alignment and domain information |
|---|
| >PRK10513 sugar phosphate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK15126 thiamin pyrimidine pyrophosphate hydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK08706 lipid A biosynthesis lauroyl acyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR02461 osmo_MPG_phos mannosyl-3-phosphoglycerate phosphatase | Back alignment and domain information |
|---|
| >PRK15126 thiamin pyrimidine pyrophosphate hydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK01158 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01106 ATPase-IIC_X-K sodium or proton efflux -- potassium uptake antiporter, P-type ATPase, alpha subunit | Back alignment and domain information |
|---|
| >COG3769 Predicted hydrolase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10976 putative hydrolase; Provisional | Back alignment and domain information |
|---|
| >COG4087 Soluble P-type ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01482 SPP-subfamily Sucrose-phosphate phosphatase subfamily | Back alignment and domain information |
|---|
| >smart00775 LNS2 LNS2 domain | Back alignment and domain information |
|---|
| >PRK08733 lipid A biosynthesis lauroyl acyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK08905 lipid A biosynthesis lauroyl acyltransferase; Validated | Back alignment and domain information |
|---|
| >PRK01158 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PLN02887 hydrolase family protein | Back alignment and domain information |
|---|
| >PRK12702 mannosyl-3-phosphoglycerate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >TIGR02207 lipid_A_htrB lipid A biosynthesis lauroyl (or palmitoleoyl) acyltransferase | Back alignment and domain information |
|---|
| >TIGR01675 plant-AP plant acid phosphatase | Back alignment and domain information |
|---|
| >TIGR01657 P-ATPase-V P-type ATPase of unknown pump specificity (type V) | Back alignment and domain information |
|---|
| >PRK05906 lipid A biosynthesis lauroyl acyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR00099 Cof-subfamily Cof subfamily of IIB subfamily of haloacid dehalogenase superfamily | Back alignment and domain information |
|---|
| >PRK08025 lipid A biosynthesis palmitoleoyl acyltransferase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01652 ATPase-Plipid phospholipid-translocating P-type ATPase, flippase | Back alignment and domain information |
|---|
| >PF08645 PNK3P: Polynucleotide kinase 3 phosphatase; InterPro: IPR013954 Polynucleotide kinase 3 phosphatases play a role in the repair of single breaks in DNA induced by DNA-damaging agents such as gamma radiation and camptothecin [] | Back alignment and domain information |
|---|
| >PTZ00174 phosphomannomutase; Provisional | Back alignment and domain information |
|---|
| >PF05116 S6PP: Sucrose-6F-phosphate phosphohydrolase; InterPro: IPR006380 This family of sequences represent sucrose phosphate phosphohydrolase (SPP) from plants and cyanobacteria [] | Back alignment and domain information |
|---|
| >PLN02382 probable sucrose-phosphatase | Back alignment and domain information |
|---|
| >PRK15174 Vi polysaccharide export protein VexE; Provisional | Back alignment and domain information |
|---|
| >TIGR02471 sucr_syn_bact_C sucrose phosphate synthase, sucrose phosphatase-like domain, bacterial | Back alignment and domain information |
|---|
| >TIGR01662 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily IIIA | Back alignment and domain information |
|---|
| >PF03982 DAGAT: Diacylglycerol acyltransferase ; InterPro: IPR007130 The terminal step of triacylglycerol (TAG) formation is catalysed by the enzyme diacylglycerol acyltransferase (DAGAT) [, ] | Back alignment and domain information |
|---|
| >PRK14502 bifunctional mannosyl-3-phosphoglycerate synthase/mannosyl-3 phosphoglycerate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01484 HAD-SF-IIB HAD-superfamily hydrolase, subfamily IIB | Back alignment and domain information |
|---|
| >PRK05645 lipid A biosynthesis lauroyl acyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01261 hisB_Nterm histidinol-phosphatase | Back alignment and domain information |
|---|
| >PLN02887 hydrolase family protein | Back alignment and domain information |
|---|
| >KOG3109 consensus Haloacid dehalogenase-like hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02530 pseT polynucleotide kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0202 consensus Ca2+ transporting ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01485 SPP_plant-cyano sucrose-6F-phosphate phosphohydrolase | Back alignment and domain information |
|---|
| >PRK05446 imidazole glycerol-phosphate dehydratase/histidinol phosphatase; Provisional | Back alignment and domain information |
|---|
| >PLN03190 aminophospholipid translocase; Provisional | Back alignment and domain information |
|---|
| >TIGR00213 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase | Back alignment and domain information |
|---|
| >TIGR01689 EcbF-BcbF capsule biosynthesis phosphatase | Back alignment and domain information |
|---|
| >PRK08942 D,D-heptose 1,7-bisphosphate phosphatase; Validated | Back alignment and domain information |
|---|
| >PRK10187 trehalose-6-phosphate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PTZ00174 phosphomannomutase; Provisional | Back alignment and domain information |
|---|
| >TIGR01656 Histidinol-ppas histidinol-phosphate phosphatase family domain | Back alignment and domain information |
|---|
| >smart00577 CPDc catalytic domain of ctd-like phosphatases | Back alignment and domain information |
|---|
| >KOG3128 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK06769 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR01684 viral_ppase viral phosphatase | Back alignment and domain information |
|---|
| >TIGR01685 MDP-1 magnesium-dependent phosphatase-1 | Back alignment and domain information |
|---|
| >PLN02423 phosphomannomutase | Back alignment and domain information |
|---|
| >PLN02423 phosphomannomutase | Back alignment and domain information |
|---|
| >TIGR01668 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) phosphatase, TIGR01668 | Back alignment and domain information |
|---|
| >TIGR02244 HAD-IG-Ncltidse HAD superfamily (subfamily IG) hydrolase, 5'-nucleotidase | Back alignment and domain information |
|---|
| >smart00775 LNS2 LNS2 domain | Back alignment and domain information |
|---|
| >PF12689 Acid_PPase: Acid Phosphatase; InterPro: IPR010036 This entry represents two closely related clades of sequences from eukaryotes and archaea | Back alignment and domain information |
|---|
| >COG3176 Putative hemolysin [General function prediction only] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 499 | |||
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 6e-10 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-08 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-05 |
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Score = 61.0 bits (147), Expect = 6e-10
Identities = 86/550 (15%), Positives = 153/550 (27%), Gaps = 175/550 (31%)
Query: 88 LKIRDIELASRAVLPR------FYAADVRKESYEVFDKCERKVVVTANPTLMVEPFVKDF 141
+D++ +++L + + D + +F K MV+ FV++
Sbjct: 33 FDCKDVQDMPKSILSKEEIDHIIMSKDAVSGTLRLFWTLLSK------QEEMVQKFVEEV 86
Query: 142 LGGD-KVLGTEIEVNPRTKR--------------------ATGFVKRP------------ 168
L + K L + I+ R A V R
Sbjct: 87 LRINYKFLMSPIKTEQRQPSMMTRMYIEQRDRLYNDNQVFAKYNVSRLQPYLKLRQALLE 146
Query: 169 -----GVLV------GKWKKLA--VLKEFG-EDAPDLGI-----GDRQTDHDFMSICKEG 209
VL+ GK +A V + + D I + + + + ++
Sbjct: 147 LRPAKNVLIDGVLGSGKTW-VALDVCLSYKVQCKMDFKIFWLNLKNCNSPETVLEMLQKL 205
Query: 210 YMVL-PSKSAKPLPRDRLKSRIIFHDG-----RLVQRPDPLNALI-------TYIWLPFG 256
+ P+ +++ +K RI H RL++ N L+ W F
Sbjct: 206 LYQIDPNWTSRSDHSSNIKLRI--HSIQAELRRLLKSKPYENCLLVLLNVQNAKAWNAFN 263
Query: 257 F---ILSIIR-----------VYFNLPLPERIVRYTY-EMLGIHLVIRGNPPPA-PSSGS 300
IL R ++ L + T E+ + L P P
Sbjct: 264 LSCKILLTTRFKQVTDFLSAATTTHISLDHHSMTLTPDEVKSLLLKYLDCRPQDLPREVL 323
Query: 301 PGNLYVCNHRTPLDPIVIAI--ALGRKVSCV-----TYSVSKLSR-------FLSP---- 342
N P ++I R + KL+ L P
Sbjct: 324 TTN-----------PRRLSIIAESIRDGLATWDNWKHVNCDKLTTIIESSLNVLEPAEYR 372
Query: 343 --------------IPAIALTR----DRAADAARISELLQKGDLVVC-PEGTTCR-ENFL 382
IP I L+ +D + L K LV P+ +T +
Sbjct: 373 KMFDRLSVFPPSAHIPTILLSLIWFDVIKSDVMVVVNKLHKYSLVEKQPKESTISIPSIY 432
Query: 383 LRFSALF---AEMSDRIVPVAVNCKQNMFYGTTVRGVKFWDPYFFF------MNPRPTYE 433
L + IV N + + + + D YF+ N
Sbjct: 433 LELKVKLENEYALHRSIVD-HYNIPKT--FDSDDLIPPYLDQYFYSHIGHHLKNIEHPER 489
Query: 434 VT-----FLD-RLPEEMTCKAGGKSAIEVANYVQKVLGDVLGFECTGLTRKDKYMLLGGN 487
+T FLD R E+ +A + + L + ++ Y+ N
Sbjct: 490 MTLFRMVFLDFRFLEQKIRHDS--TAWNASGSILNTLQQLKFYK--------PYICD--N 537
Query: 488 DGKVESMYNS 497
D K E + N+
Sbjct: 538 DPKYERLVNA 547
|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 499 | |||
| 3fvv_A | 232 | Uncharacterized protein; unknown function, structu | 99.9 | |
| 4as2_A | 327 | Phosphorylcholine phosphatase; hydrolase, HAD supe | 99.86 | |
| 4gxt_A | 385 | A conserved functionally unknown protein; structur | 99.86 | |
| 1iuq_A | 367 | Glycerol-3-phosphate acyltransferase; open twisted | 99.79 | |
| 3p96_A | 415 | Phosphoserine phosphatase SERB; ssgcid, structural | 99.56 | |
| 3m1y_A | 217 | Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, | 99.55 | |
| 4eze_A | 317 | Haloacid dehalogenase-like hydrolase; magnesium bi | 99.53 | |
| 4ap9_A | 201 | Phosphoserine phosphatase; hydrolase, haloacid deh | 99.45 | |
| 3kd3_A | 219 | Phosphoserine phosphohydrolase-like protein; csgid | 99.42 | |
| 1l7m_A | 211 | Phosphoserine phosphatase; rossmann fold, four-hel | 99.4 | |
| 3n28_A | 335 | Phosphoserine phosphatase; HAD family hydrolase, s | 99.35 | |
| 2fea_A | 236 | 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate | 99.24 | |
| 1nnl_A | 225 | L-3-phosphoserine phosphatase; PSP, HPSP, phospho- | 99.11 | |
| 1rku_A | 206 | Homoserine kinase; phosphoserine phosphatase, phos | 99.04 | |
| 2pib_A | 216 | Phosphorylated carbohydrates phosphatase TM_1254; | 98.98 | |
| 4fe3_A | 297 | Cytosolic 5'-nucleotidase 3; substrate complex, HA | 98.96 | |
| 4ex6_A | 237 | ALNB; modified rossman fold, phosphatase, magnesiu | 98.95 | |
| 2hsz_A | 243 | Novel predicted phosphatase; structural genomics, | 98.91 | |
| 3mmz_A | 176 | Putative HAD family hydrolase; structural genomics | 98.91 | |
| 2no4_A | 240 | (S)-2-haloacid dehalogenase IVA; HAD superfamily, | 98.9 | |
| 3e58_A | 214 | Putative beta-phosphoglucomutase; structu genomics | 98.89 | |
| 3cnh_A | 200 | Hydrolase family protein; NP_295428.1, predicted h | 98.88 | |
| 2om6_A | 235 | Probable phosphoserine phosphatase; rossmann fold, | 98.88 | |
| 3um9_A | 230 | Haloacid dehalogenase, type II; haloacid dehalogen | 98.86 | |
| 4eek_A | 259 | Beta-phosphoglucomutase-related protein; hydrolase | 98.86 | |
| 1zrn_A | 232 | L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseud | 98.86 | |
| 3s6j_A | 233 | Hydrolase, haloacid dehalogenase-like family; stru | 98.85 | |
| 3mc1_A | 226 | Predicted phosphatase, HAD family; PSI2, NYSGXRC, | 98.85 | |
| 3sd7_A | 240 | Putative phosphatase; structural genomics, haloaci | 98.85 | |
| 2hoq_A | 241 | Putative HAD-hydrolase PH1655; haloacid dehalogena | 98.82 | |
| 3kzx_A | 231 | HAD-superfamily hydrolase, subfamily IA, variant; | 98.8 | |
| 1te2_A | 226 | Putative phosphatase; structural genomics, phospha | 98.78 | |
| 3iru_A | 277 | Phoshonoacetaldehyde hydrolase like protein; phosp | 98.77 | |
| 2fdr_A | 229 | Conserved hypothetical protein; SAD, structural ge | 98.77 | |
| 3nuq_A | 282 | Protein SSM1, putative nucleotide phosphatase; sup | 98.76 | |
| 3d6j_A | 225 | Putative haloacid dehalogenase-like hydrolase; str | 98.75 | |
| 1qq5_A | 253 | Protein (L-2-haloacid dehalogenase); hydrolase; 1. | 98.75 | |
| 3mn1_A | 189 | Probable YRBI family phosphatase; structural genom | 98.74 | |
| 3umb_A | 233 | Dehalogenase-like hydrolase; 2.20A {Ralstonia sola | 98.73 | |
| 1y8a_A | 332 | Hypothetical protein AF1437; structural genomics, | 98.73 | |
| 3ij5_A | 211 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; | 98.72 | |
| 3nas_A | 233 | Beta-PGM, beta-phosphoglucomutase; PSI, structural | 98.72 | |
| 2wf7_A | 221 | Beta-PGM, beta-phosphoglucomutase; transition stat | 98.71 | |
| 2go7_A | 207 | Hydrolase, haloacid dehalogenase-like family; stru | 98.71 | |
| 1swv_A | 267 | Phosphonoacetaldehyde hydrolase; HAD enzyme superf | 98.7 | |
| 2fi1_A | 190 | Hydrolase, haloacid dehalogenase-like family; stru | 98.68 | |
| 2hcf_A | 234 | Hydrolase, haloacid dehalogenase-like family; NP_6 | 98.68 | |
| 2i6x_A | 211 | Hydrolase, haloacid dehalogenase-like family; HAD | 98.68 | |
| 3l5k_A | 250 | Protein GS1, haloacid dehalogenase-like hydrolase | 98.67 | |
| 2nyv_A | 222 | Pgpase, PGP, phosphoglycolate phosphatase; structu | 98.67 | |
| 2b0c_A | 206 | Putative phosphatase; alpha-D-glucose-1-phosphate, | 98.66 | |
| 3m9l_A | 205 | Hydrolase, haloacid dehalogenase-like family; HAD | 98.66 | |
| 3qnm_A | 240 | Haloacid dehalogenase-like hydrolase; structural g | 98.65 | |
| 2hdo_A | 209 | Phosphoglycolate phosphatase; NP_784602.1, structu | 98.63 | |
| 3qxg_A | 243 | Inorganic pyrophosphatase; hydrolase, magnesium bi | 98.63 | |
| 3dv9_A | 247 | Beta-phosphoglucomutase; structural genomics, APC6 | 98.61 | |
| 1k1e_A | 180 | Deoxy-D-mannose-octulosonate 8-phosphate phosphat; | 98.59 | |
| 3n07_A | 195 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; | 98.56 | |
| 3skx_A | 280 | Copper-exporting P-type ATPase B; P1B-ATPase, ATP | 98.55 | |
| 2hi0_A | 240 | Putative phosphoglycolate phosphatase; YP_619066.1 | 98.54 | |
| 3k1z_A | 263 | Haloacid dehalogenase-like hydrolase domain-conta | 98.53 | |
| 2qlt_A | 275 | (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, sac | 98.51 | |
| 4dcc_A | 229 | Putative haloacid dehalogenase-like hydrolase; mag | 98.5 | |
| 3umc_A | 254 | Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeru | 98.49 | |
| 3gyg_A | 289 | NTD biosynthesis operon putative hydrolase NTDB; P | 98.48 | |
| 3e8m_A | 164 | Acylneuraminate cytidylyltransferase; 2-keto-3-deo | 98.48 | |
| 2w43_A | 201 | Hypothetical 2-haloalkanoic acid dehalogenase; hyd | 98.46 | |
| 2p9j_A | 162 | Hypothetical protein AQ2171; secsg, riken, PSI, st | 98.46 | |
| 3ed5_A | 238 | YFNB; APC60080, bacillus subtilis subsp. subtilis | 98.44 | |
| 3ddh_A | 234 | Putative haloacid dehalogenase-like family hydrol; | 98.43 | |
| 2ah5_A | 210 | COG0546: predicted phosphatases; MCSG, structural | 98.43 | |
| 3kbb_A | 216 | Phosphorylated carbohydrates phosphatase TM_1254; | 98.42 | |
| 2p11_A | 231 | Hypothetical protein; putative haloacid dehalogena | 98.4 | |
| 3umg_A | 254 | Haloacid dehalogenase; defluorinase, hydrolase; 2. | 98.32 | |
| 2r8e_A | 188 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphata | 98.32 | |
| 2pke_A | 251 | Haloacid delahogenase-like family hydrolase; NP_63 | 98.28 | |
| 3smv_A | 240 | S-(-)-azetidine-2-carboxylate hydrolase; haloacid | 98.28 | |
| 3u26_A | 234 | PF00702 domain protein; structural genomics, PSI-b | 98.27 | |
| 2zg6_A | 220 | Putative uncharacterized protein ST2620, probable | 98.26 | |
| 2gfh_A | 260 | Haloacid dehalogenase-like hydrolase domain conta; | 98.26 | |
| 4dw8_A | 279 | Haloacid dehalogenase-like hydrolase; HAD, putativ | 98.2 | |
| 3dnp_A | 290 | Stress response protein YHAX; structural PSI-2, pr | 98.17 | |
| 3vay_A | 230 | HAD-superfamily hydrolase; rossmann fold, haloacid | 98.16 | |
| 2g80_A | 253 | Protein UTR4; YEL038W, UTR4 protein (unknown trans | 98.13 | |
| 3mpo_A | 279 | Predicted hydrolase of the HAD superfamily; SGX, P | 98.13 | |
| 3dao_A | 283 | Putative phosphatse; structural genomics, joint ce | 98.12 | |
| 3fzq_A | 274 | Putative hydrolase; YP_001086940.1, putative haloa | 97.91 | |
| 1wr8_A | 231 | Phosphoglycolate phosphatase; alpha / beta core do | 97.88 | |
| 3l8h_A | 179 | Putative haloacid dehalogenase-like hydrolase; HAD | 97.87 | |
| 2yj3_A | 263 | Copper-transporting ATPase; hydrolase, P-type ATPa | 97.08 | |
| 3l7y_A | 304 | Putative uncharacterized protein SMU.1108C; hydrol | 97.83 | |
| 1yns_A | 261 | E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo | 97.8 | |
| 3pgv_A | 285 | Haloacid dehalogenase-like hydrolase; structural g | 97.73 | |
| 4gib_A | 250 | Beta-phosphoglucomutase; rossmann fold, HAD-like, | 97.73 | |
| 1l6r_A | 227 | Hypothetical protein TA0175; structural genomics, | 97.65 | |
| 3i28_A | 555 | Epoxide hydrolase 2; aromatic hydrocarbons catabol | 97.64 | |
| 3j08_A | 645 | COPA, copper-exporting P-type ATPase A; copper tra | 97.61 | |
| 3rfu_A | 736 | Copper efflux ATPase; alpha helical, CPC, CXXC, AT | 97.59 | |
| 3j09_A | 723 | COPA, copper-exporting P-type ATPase A; copper tra | 97.54 | |
| 3a1c_A | 287 | Probable copper-exporting P-type ATPase A; ATP-bin | 97.48 | |
| 2c4n_A | 250 | Protein NAGD; nucleotide phosphatase, HAD superfam | 97.44 | |
| 4g9b_A | 243 | Beta-PGM, beta-phosphoglucomutase; HAD, putative p | 97.44 | |
| 3ewi_A | 168 | N-acylneuraminate cytidylyltransferase; beta barre | 97.36 | |
| 3pct_A | 260 | Class C acid phosphatase; hydrolase, outer membran | 97.35 | |
| 3n1u_A | 191 | Hydrolase, HAD superfamily, subfamily III A; struc | 97.32 | |
| 3ocu_A | 262 | Lipoprotein E; hydrolase, outer membrane; HET: NMN | 97.1 | |
| 2b82_A | 211 | APHA, class B acid phosphatase; DDDD acid phosphat | 97.02 | |
| 3ar4_A | 995 | Sarcoplasmic/endoplasmic reticulum calcium ATPase; | 97.01 | |
| 1mhs_A | 920 | Proton pump, plasma membrane ATPase; ION transport | 96.99 | |
| 2x4d_A | 271 | HLHPP, phospholysine phosphohistidine inorganic py | 96.87 | |
| 3b8c_A | 885 | ATPase 2, plasma membrane-type; P-type ATPase, pro | 96.87 | |
| 2i33_A | 258 | Acid phosphatase; HAD superfamily, hydrolase; 1.57 | 96.79 | |
| 2oda_A | 196 | Hypothetical protein pspto_2114; haloacid dehaloge | 96.74 | |
| 2zxe_A | 1028 | Na, K-ATPase alpha subunit; membrane protein, ION | 96.71 | |
| 3zvl_A | 416 | Bifunctional polynucleotide phosphatase/kinase; hy | 96.68 | |
| 2ho4_A | 259 | Haloacid dehalogenase-like hydrolase domain contai | 96.57 | |
| 1q92_A | 197 | 5(3)-deoxyribonucleotidase; alpha-beta rossman fol | 96.54 | |
| 3ixz_A | 1034 | Potassium-transporting ATPase alpha; ION pump, H+, | 96.47 | |
| 2i7d_A | 193 | 5'(3')-deoxyribonucleotidase, cytosolic type; hydr | 96.15 | |
| 2wm8_A | 187 | MDP-1, magnesium-dependent phosphatase 1; haloacid | 96.04 | |
| 1nrw_A | 288 | Hypothetical protein, haloacid dehalogenase-like h | 95.98 | |
| 1u02_A | 239 | Trehalose-6-phosphate phosphatase related protein; | 95.31 | |
| 1xvi_A | 275 | MPGP, YEDP, putative mannosyl-3-phosphoglycerate p | 95.23 | |
| 1rkq_A | 282 | Hypothetical protein YIDA; two domain structure wi | 95.17 | |
| 3qgm_A | 268 | P-nitrophenyl phosphatase (PHO2); structural genom | 95.04 | |
| 2gmw_A | 211 | D,D-heptose 1,7-bisphosphate phosphatase; Zn-bindi | 95.03 | |
| 2pq0_A | 258 | Hypothetical conserved protein GK1056; hyopthetica | 94.92 | |
| 2rbk_A | 261 | Putative uncharacterized protein; HAD-like phospha | 94.78 | |
| 3pdw_A | 266 | Uncharacterized hydrolase YUTF; structural genomic | 94.76 | |
| 2pq0_A | 258 | Hypothetical conserved protein GK1056; hyopthetica | 94.43 | |
| 2pr7_A | 137 | Haloacid dehalogenase/epoxide hydrolase family; NP | 94.4 | |
| 1nf2_A | 268 | Phosphatase; structural proteomics, HAD NEW fold, | 94.16 | |
| 2o2x_A | 218 | Hypothetical protein; structural genomics, joint c | 94.13 | |
| 2zos_A | 249 | MPGP, mannosyl-3-phosphoglycerate phosphatase; hal | 94.07 | |
| 3f9r_A | 246 | Phosphomannomutase; trypanosome glycobiology struc | 94.04 | |
| 2b30_A | 301 | Pvivax hypothetical protein; SGPP, structural geno | 93.96 | |
| 3epr_A | 264 | Hydrolase, haloacid dehalogenase-like family; stru | 93.72 | |
| 3r4c_A | 268 | Hydrolase, haloacid dehalogenase-like hydrolase; h | 93.71 | |
| 3ib6_A | 189 | Uncharacterized protein; structural genomics, unkn | 93.58 | |
| 1rlm_A | 271 | Phosphatase; HAD family, rossman fold, hydrolase; | 92.98 | |
| 3zx4_A | 259 | MPGP, mannosyl-3-phosphoglycerate phosphatase; hyd | 92.15 | |
| 1s2o_A | 244 | SPP, sucrose-phosphatase; phosphohydrolase, HAD su | 91.86 | |
| 1rkq_A | 282 | Hypothetical protein YIDA; two domain structure wi | 91.33 | |
| 1xvi_A | 275 | MPGP, YEDP, putative mannosyl-3-phosphoglycerate p | 91.08 | |
| 2b30_A | 301 | Pvivax hypothetical protein; SGPP, structural geno | 90.85 | |
| 1nrw_A | 288 | Hypothetical protein, haloacid dehalogenase-like h | 90.72 | |
| 1xpj_A | 126 | Hypothetical protein; structural genomics, MCSG, p | 90.65 | |
| 2fpr_A | 176 | Histidine biosynthesis bifunctional protein HISB; | 89.81 | |
| 2fue_A | 262 | PMM 1, PMMH-22, phosphomannomutase 1; enzyme-produ | 89.81 | |
| 3nvb_A | 387 | Uncharacterized protein; protein FKBH, protein fkb | 89.56 | |
| 2amy_A | 246 | PMM 2, phosphomannomutase 2; HS.459855, HS.313504, | 89.13 | |
| 3bwv_A | 180 | Putative 5'(3')-deoxyribonucleotidase; NP_764060.1 | 88.83 | |
| 2obb_A | 142 | Hypothetical protein; structural genomics, PSI-2, | 88.7 | |
| 2rbk_A | 261 | Putative uncharacterized protein; HAD-like phospha | 88.15 | |
| 1nf2_A | 268 | Phosphatase; structural proteomics, HAD NEW fold, | 87.18 | |
| 3r4c_A | 268 | Hydrolase, haloacid dehalogenase-like hydrolase; h | 87.02 | |
| 3f9r_A | 246 | Phosphomannomutase; trypanosome glycobiology struc | 86.18 | |
| 2amy_A | 246 | PMM 2, phosphomannomutase 2; HS.459855, HS.313504, | 86.08 | |
| 1qyi_A | 384 | ZR25, hypothetical protein; structural genomics, P | 84.22 | |
| 1rlm_A | 271 | Phosphatase; HAD family, rossman fold, hydrolase; | 83.93 | |
| 3zx4_A | 259 | MPGP, mannosyl-3-phosphoglycerate phosphatase; hyd | 82.95 | |
| 1ltq_A | 301 | Polynucleotide kinase; phosphatase, alpha/beta, P- | 82.61 | |
| 2fue_A | 262 | PMM 1, PMMH-22, phosphomannomutase 1; enzyme-produ | 81.83 | |
| 1yv9_A | 264 | Hydrolase, haloacid dehalogenase family; hypotheti | 81.81 | |
| 2wm8_A | 187 | MDP-1, magnesium-dependent phosphatase 1; haloacid | 81.74 |
| >3fvv_A Uncharacterized protein; unknown function, structural genomics, PSI,MCSG, protein STR initiative, midwest center for structural genomics; 2.10A {Bordetella pertussis} | Back alignment and structure |
|---|
Probab=99.90 E-value=1.9e-23 Score=198.95 Aligned_cols=208 Identities=13% Similarity=0.084 Sum_probs=153.0
Q ss_pred CeEEEEecCCceeecCCchHHHHHHHHHhcch--HHHHHHHhhHHHHH-HHhhcCChhHHHHHHHHHHhcCCCHHHHHHH
Q 010860 20 YGSIAADLDGTLLVSRSSFPYFMLVAVEAGGL--LRGLALLVSLPIAI-IAYLFISEAIGIQILIFISFSGLKIRDIELA 96 (499)
Q Consensus 20 ~~~avFD~DgTL~~~~s~~~~~~~~~~~~~~~--~r~~~~~~~~p~~~-~~~~~~~~~~~~~~~~~~~l~G~~~~~l~~~ 96 (499)
.++++|||||||+++++.+.+.... ...+.. ...... ....... ......+... ........+.|.+.++++++
T Consensus 4 ~k~viFDlDGTL~d~~~~~~~~~~~-~~~~~~~~~~~~~~-~~~~~~~~~~~g~~~~~~-~~~~~~~~~~~~~~~~~~~~ 80 (232)
T 3fvv_A 4 RRLALFDLDHTLLPLDSDYQWADFL-ARTGRAGDPAEARR-RNDDLMERYNRGELTAEQ-AAEFMLGLLAAHSPVELAAW 80 (232)
T ss_dssp CEEEEECCBTTTBSSCHHHHHHHHH-HHTTSSSSHHHHHH-HHHHHHHHHHHTCSCHHH-HHHHHHHHHHTSCHHHHHHH
T ss_pred CcEEEEeCCCCCcCCchHHHHHHHH-HHcCCCCccHHHHH-HHHHHHHHHHCCCCCHHH-HHHHHHHHhcCCCHHHHHHH
Confidence 4799999999999987765433332 222211 111111 0111111 1112233333 22344556789999999999
Q ss_pred HHHHhhhHHHhhccHHHHH---HHHhCC-CEEEEeCCcHHHHHHHHhhhcCCcEEEeCeEEEecCCCceeeeEecCCccc
Q 010860 97 SRAVLPRFYAADVRKESYE---VFDKCE-RKVVVTANPTLMVEPFVKDFLGGDKVLGTEIEVNPRTKRATGFVKRPGVLV 172 (499)
Q Consensus 97 ~~~~~~~~~~~~i~~~~~~---~~~~~G-~vvlvSas~~~~v~~ia~~~lg~d~vigt~l~~~~~~g~~tG~~~~~~~~~ 172 (499)
.++++.+.+.+.++|.+.+ .++++| +++|+|+|++.+++++++. +|+++++++.+.+. +|+++|++.++. +.
T Consensus 81 ~~~~~~~~~~~~~~~g~~~~l~~l~~~g~~~~ivS~~~~~~~~~~~~~-~g~~~~~~~~~~~~--~~~~~g~~~~~~-~~ 156 (232)
T 3fvv_A 81 HEEFMRDVIRPSLTVQAVDVVRGHLAAGDLCALVTATNSFVTAPIARA-FGVQHLIATDPEYR--DGRYTGRIEGTP-SF 156 (232)
T ss_dssp HHHHHHHTTGGGCCHHHHHHHHHHHHTTCEEEEEESSCHHHHHHHHHH-TTCCEEEECEEEEE--TTEEEEEEESSC-SS
T ss_pred HHHHHHHhhhhhcCHHHHHHHHHHHHCCCEEEEEeCCCHHHHHHHHHH-cCCCEEEEcceEEE--CCEEeeeecCCC-Cc
Confidence 9999888776677887766 688999 9999999999999999999 99999999999998 999999999865 48
Q ss_pred chhHHHHHHHHhC------C-CCCeEEEeCCcCcHHHHhccccCeecCCCCCCCCCCcccCCceeEEcc
Q 010860 173 GKWKKLAVLKEFG------E-DAPDLGIGDRQTDHDFMSICKEGYMVLPSKSAKPLPRDRLKSRIIFHD 234 (499)
Q Consensus 173 g~~K~~~l~~~~~------~-~~~~~aygDS~~D~pmL~~a~~~~~Vnp~~~~~~~~~~~~~~~~~f~~ 234 (499)
+..|...+++++. . ...+++||||.+|++|++.|+.+++|||++......+.+.|+.+.|.+
T Consensus 157 ~~~K~~~~~~~~~~~~~~~~~~~~~~~vGDs~~D~~~~~~ag~~~~~~~~~~l~~~a~~~~w~~~~~~~ 225 (232)
T 3fvv_A 157 REGKVVRVNQWLAGMGLALGDFAESYFYSDSVNDVPLLEAVTRPIAANPSPGLREIAQARGWQVIDLFD 225 (232)
T ss_dssp THHHHHHHHHHHHHTTCCGGGSSEEEEEECCGGGHHHHHHSSEEEEESCCHHHHHHHHHHTCEEECCC-
T ss_pred chHHHHHHHHHHHHcCCCcCchhheEEEeCCHhhHHHHHhCCCeEEECcCHHHHHHHHHCCCcEeehhh
Confidence 9999988887653 1 124789999999999999999999999999887777766665544544
|
| >4as2_A Phosphorylcholine phosphatase; hydrolase, HAD superfamily, alkylammonium compounds; HET: BTB; 2.12A {Pseudomonas aeruginosa} PDB: 4as3_A* | Back alignment and structure |
|---|
| >4gxt_A A conserved functionally unknown protein; structural genomics, PSI-biology; 1.82A {Anaerococcus prevotii} | Back alignment and structure |
|---|
| >1iuq_A Glycerol-3-phosphate acyltransferase; open twisted alpha/beta, four helix bundle; 1.55A {Cucurbita moschata} SCOP: c.112.1.1 PDB: 1k30_A | Back alignment and structure |
|---|
| >3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} | Back alignment and structure |
|---|
| >3m1y_A Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, phophoserine phosphatase, protein structure initiative, structural genomics; 2.40A {Helicobacter pylori} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >4eze_A Haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 2.27A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >4ap9_A Phosphoserine phosphatase; hydrolase, haloacid dehalogenase superfamily, NDSB; HET: 1PS; 1.78A {Thermococcus onnurineus} PDB: 4b6j_A | Back alignment and structure |
|---|
| >3kd3_A Phosphoserine phosphohydrolase-like protein; csgid, niaid, S genomics, national institute of allergy and infectious DISE (niaid); 1.70A {Francisella tularensis subsp} | Back alignment and structure |
|---|
| >1l7m_A Phosphoserine phosphatase; rossmann fold, four-helix bundle, B-hairpin, structural genomics, BSGC structure funded by NIH; 1.48A {Methanocaldococcus jannaschii} SCOP: c.108.1.4 PDB: 1f5s_A 1l7n_A 1l7p_A* 1l7o_A* 1j97_A* | Back alignment and structure |
|---|
| >3n28_A Phosphoserine phosphatase; HAD family hydrolase, structural genomics, PSI, protein STRU initiative, nysgrc; 2.30A {Vibrio cholerae} | Back alignment and structure |
|---|
| >2fea_A 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; 2633731, structural genomics, joint center for structural GE JCSG; HET: MSE; 2.00A {Bacillus subtilis} SCOP: c.108.1.20 | Back alignment and structure |
|---|
| >1nnl_A L-3-phosphoserine phosphatase; PSP, HPSP, phospho-aspartyl, hydrolase; 1.53A {Homo sapiens} SCOP: c.108.1.4 PDB: 1l8l_A* 1l8o_A | Back alignment and structure |
|---|
| >1rku_A Homoserine kinase; phosphoserine phosphatase, phosphoserine:homoserine phosphotransferase, THRH, phosphoserine phosphoryl donor; 1.47A {Pseudomonas aeruginosa} SCOP: c.108.1.11 PDB: 1rkv_A | Back alignment and structure |
|---|
| >4fe3_A Cytosolic 5'-nucleotidase 3; substrate complex, HAD-like, protein binding; HET: U5P; 1.74A {Mus musculus} PDB: 2g09_A* 2bdu_A* 2g08_A 2g06_A* 2g0a_A* 2q4t_A* 2g07_A* 2jga_A 2vkq_A 2cn1_A | Back alignment and structure |
|---|
| >4ex6_A ALNB; modified rossman fold, phosphatase, magnesium binding, hydro; 1.25A {Streptomyces SP} PDB: 4ex7_A | Back alignment and structure |
|---|
| >2hsz_A Novel predicted phosphatase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: UNL; 1.90A {Haemophilus somnus 129PT} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >3mmz_A Putative HAD family hydrolase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.84A {Streptomyces avermitilis} | Back alignment and structure |
|---|
| >2no4_A (S)-2-haloacid dehalogenase IVA; HAD superfamily, rossman fold, hydrol; 1.93A {Burkholderia cepacia} PDB: 2no5_A* | Back alignment and structure |
|---|
| >3e58_A Putative beta-phosphoglucomutase; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.86A {Streptococcus thermophilus lmg 18311} | Back alignment and structure |
|---|
| >3cnh_A Hydrolase family protein; NP_295428.1, predicted hydrolase of haloacid dehalogenase-LI superfamily; HET: MSE PG4; 1.66A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >2om6_A Probable phosphoserine phosphatase; rossmann fold, B-hairpin, four-helix bundle, structural GENO NPPSFA; 2.20A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3um9_A Haloacid dehalogenase, type II; haloacid dehalogenase-like hydrolase protein superfamily, defluorinase, hydrolase; 2.19A {Polaromonas SP} | Back alignment and structure |
|---|
| >4eek_A Beta-phosphoglucomutase-related protein; hydrolase, magnesium binding site, enzyme function initiativ; 1.60A {Deinococcus radiodurans} PDB: 4eel_A* 4een_A | Back alignment and structure |
|---|
| >1zrn_A L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseudomonas SP} SCOP: c.108.1.1 PDB: 1zrm_A 1jud_A 1qh9_A | Back alignment and structure |
|---|
| >3s6j_A Hydrolase, haloacid dehalogenase-like family; structural genomics, PSI-2; 2.20A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3mc1_A Predicted phosphatase, HAD family; PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.93A {Clostridium acetobutylicum} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3sd7_A Putative phosphatase; structural genomics, haloacid dehalogenase-like hydrolase, H center for structural genomics of infectious diseases; HET: PGE; 1.70A {Clostridium difficile} | Back alignment and structure |
|---|
| >2hoq_A Putative HAD-hydrolase PH1655; haloacid dehalogenase, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.70A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3kzx_A HAD-superfamily hydrolase, subfamily IA, variant; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 1.90A {Ehrlichia chaffeensis} | Back alignment and structure |
|---|
| >1te2_A Putative phosphatase; structural genomics, phosphates, PSI, protein S initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Escherichia coli} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >3iru_A Phoshonoacetaldehyde hydrolase like protein; phosphonoacetaldehyde hydrolase like P structural genomics, PSI-2, protein structure initiative; 2.30A {Oleispira antarctica} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >2fdr_A Conserved hypothetical protein; SAD, structural genomics, agrobacter tumefaciens, HAD-superfamily hydrolase; 2.00A {Agrobacterium tumefaciens str} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >3nuq_A Protein SSM1, putative nucleotide phosphatase; suppresses the 6-AU sensitivity of transcription elongation II; 1.70A {Saccharomyces cerevisiae} PDB: 3onn_A 3opx_A* | Back alignment and structure |
|---|
| >3d6j_A Putative haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} | Back alignment and structure |
|---|
| >1qq5_A Protein (L-2-haloacid dehalogenase); hydrolase; 1.52A {Xanthobacter autotrophicus} SCOP: c.108.1.1 PDB: 1qq6_A* 1qq7_A* 1aq6_A | Back alignment and structure |
|---|
| >3mn1_A Probable YRBI family phosphatase; structural genomics, PSI, protein structure initiative, NYSG phosphatase; 1.80A {Pseudomonas syringae PV} PDB: 3nrj_A | Back alignment and structure |
|---|
| >3umb_A Dehalogenase-like hydrolase; 2.20A {Ralstonia solanacearum} | Back alignment and structure |
|---|
| >1y8a_A Hypothetical protein AF1437; structural genomics, protein structu initiative, PSI, midwest center for structural genomics; 1.40A {Archaeoglobus fulgidus} SCOP: c.108.1.24 | Back alignment and structure |
|---|
| >3ij5_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; IDP022 hydrolase, lipopolysaccharide biosynthesis, magnesium, STRU genomics; 1.95A {Yersinia pestis} | Back alignment and structure |
|---|
| >3nas_A Beta-PGM, beta-phosphoglucomutase; PSI, structural genomics, protein structure initiative, NEW research center for structural genomics; 3.00A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2wf7_A Beta-PGM, beta-phosphoglucomutase; transition state analogue, haloacid dehalogenase superfamily, isomerase, phosphotransferase; HET: G7P; 1.05A {Lactococcus lactis} PDB: 1o03_A* 1z4n_A* 1z4o_A* 1zol_A 2wf5_A* 2wf6_A* 1o08_A* 2wf8_A* 2wf9_A* 2wfa_A 2whe_A 1lvh_A* 3fm9_A | Back alignment and structure |
|---|
| >2go7_A Hydrolase, haloacid dehalogenase-like family; structural genomics, joint center for structural genomics, J protein structure initiative; 2.10A {Streptococcus pneumoniae} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >1swv_A Phosphonoacetaldehyde hydrolase; HAD enzyme superfamily, phosphonotase, metal binding; 2.30A {Bacillus cereus} SCOP: c.108.1.3 PDB: 1sww_A 2iof_A* 2ioh_A 1rql_A 1rqn_A 2iof_K* 1rdf_A 1fez_A | Back alignment and structure |
|---|
| >2fi1_A Hydrolase, haloacid dehalogenase-like family; structural genomics, haloacid dehalogenase-like F PSI, protein structure initiative; 1.40A {Streptococcus pneumoniae} SCOP: c.108.1.3 | Back alignment and structure |
|---|
| >2hcf_A Hydrolase, haloacid dehalogenase-like family; NP_662590.1, ST genomics, PSI-2, protein structure initiative; 1.80A {Chlorobaculum tepidum} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >2i6x_A Hydrolase, haloacid dehalogenase-like family; HAD superfamily, struct genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >3l5k_A Protein GS1, haloacid dehalogenase-like hydrolase domain- containing protein 1A; HDHD1A, haloacid dehalogenase-like hydrolase domain containing 1A; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2nyv_A Pgpase, PGP, phosphoglycolate phosphatase; structural genomics, PSI-2, protein structure initiative; 2.10A {Aquifex aeolicus} PDB: 2yy6_A | Back alignment and structure |
|---|
| >2b0c_A Putative phosphatase; alpha-D-glucose-1-phosphate, structural genomic protein structure initiative, midwest center for structural genomics, MCSG; HET: G1P; 2.00A {Escherichia coli} SCOP: c.108.1.2 | Back alignment and structure |
|---|
| >3m9l_A Hydrolase, haloacid dehalogenase-like family; HAD family hydrolase, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Pseudomonas fluorescens} PDB: 2ybd_A* 3r09_A* | Back alignment and structure |
|---|
| >3qnm_A Haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 1.70A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >2hdo_A Phosphoglycolate phosphatase; NP_784602.1, structur genomics, PSI-2, protein structure initiative, joint center structural genomics; HET: MSE; 1.50A {Lactobacillus plantarum} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >3qxg_A Inorganic pyrophosphatase; hydrolase, magnesium binding site, NEW YORK research center for structural genomics; HET: TLA; 1.24A {Bacteroides thetaiotaomicron} PDB: 3qu2_A* 3qx7_A 3quq_A* 3r9k_A 3qut_A 3qu9_A* 3qu7_A 3qu5_A 3qyp_A 3quc_A 3qub_A 3qu4_A | Back alignment and structure |
|---|
| >3dv9_A Beta-phosphoglucomutase; structural genomics, APC60149, PSI- protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.72A {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >1k1e_A Deoxy-D-mannose-octulosonate 8-phosphate phosphat; structural genomics, KDO 8-P phosphatase, structure function project, S2F; HET: MES; 1.67A {Haemophilus influenzae RD} SCOP: c.108.1.5 PDB: 1j8d_A* | Back alignment and structure |
|---|
| >3n07_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; structural genomics, phosphatase, PSI-2, protein structure initiative; HET: MSE; 1.76A {Vibrio cholerae} | Back alignment and structure |
|---|
| >3skx_A Copper-exporting P-type ATPase B; P1B-ATPase, ATP binding domain, copper(II) transporter, MEMB protein, hydrolase; 1.59A {Archaeoglobus fulgidus} PDB: 3sky_A* | Back alignment and structure |
|---|
| >2hi0_A Putative phosphoglycolate phosphatase; YP_619066.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.51A {Lactobacillus delbrueckii} | Back alignment and structure |
|---|
| >3k1z_A Haloacid dehalogenase-like hydrolase domain-conta protein 3; HDHD3, haloacid dehalogenase-like hydrolase domain containin structural genomics; 1.55A {Homo sapiens} | Back alignment and structure |
|---|
| >2qlt_A (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, saccharom cerevisiae, structural genomics, PSI-2, protein structure initiative; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4dcc_A Putative haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 1.65A {Bacteroides thetaiotaomicron} PDB: 4dfd_A 4f71_A 4f72_A | Back alignment and structure |
|---|
| >3umc_A Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3gyg_A NTD biosynthesis operon putative hydrolase NTDB; PF05116, PF08282, MCSG, PSI-2, haloacid dehalogenase-like HY structural genomics; 2.45A {Bacillus subtilis subsp} | Back alignment and structure |
|---|
| >3e8m_A Acylneuraminate cytidylyltransferase; 2-keto-3-deoxynononic acid 9-phosphate phosphohydrolase, nucleotidyltransferase; HET: PEG PG4 EDO PGE; 1.10A {Bacteroides thetaiotaomicron} PDB: 3e84_A 3e81_A* | Back alignment and structure |
|---|
| >2w43_A Hypothetical 2-haloalkanoic acid dehalogenase; hydrolase, metabolic process; HET: MES; 1.66A {Sulfolobus tokodaii} PDB: 2w11_A | Back alignment and structure |
|---|
| >2p9j_A Hypothetical protein AQ2171; secsg, riken, PSI, structural GENO protein structure initiative, southeast collaboratory for S genomics; 2.40A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3ed5_A YFNB; APC60080, bacillus subtilis subsp. subtilis STR. 168, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.72A {Bacillus subtilis} PDB: 3i76_A | Back alignment and structure |
|---|
| >3ddh_A Putative haloacid dehalogenase-like family hydrol; hydrolase, HAD superfamily, ST genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2ah5_A COG0546: predicted phosphatases; MCSG, structural genomics, hydrola haloacid dehalogenase-like, PSI; 1.74A {Streptococcus pneumoniae} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >3kbb_A Phosphorylated carbohydrates phosphatase TM_1254; hydrolase, arbohydrate metabolism, COBA magnesium, manganese, metal-binding, nickel; HET: MSE GOL; 1.74A {Thermotoga maritima MSB8} | Back alignment and structure |
|---|
| >2p11_A Hypothetical protein; putative haloacid dehalogenase-like hydrolase, structural GE joint center for structural genomics, JCSG; 2.20A {Burkholderia xenovorans} | Back alignment and structure |
|---|
| >3umg_A Haloacid dehalogenase; defluorinase, hydrolase; 2.25A {Rhodococcus jostii} | Back alignment and structure |
|---|
| >2r8e_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; YRBI, divalent metal, HAD superfamily, KDO 8-P, hydrolase; 1.40A {Escherichia coli O6} PDB: 2r8x_A 2r8y_A 2r8z_A 3hyc_A 3i6b_A* | Back alignment and structure |
|---|
| >2pke_A Haloacid delahogenase-like family hydrolase; NP_639141.1, ST genomics, joint center for structural genomics, JCSG; 1.81A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3smv_A S-(-)-azetidine-2-carboxylate hydrolase; haloacid dehalogenase superfamily, L-azetidine-2- carboxylate; HET: GOL; 1.38A {Pseudomonas} | Back alignment and structure |
|---|
| >3u26_A PF00702 domain protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, unknown function; 1.59A {Pyrococcus horikoshii} SCOP: c.108.1.1 PDB: 1x42_A | Back alignment and structure |
|---|
| >2zg6_A Putative uncharacterized protein ST2620, probable 2-haloalkanoic; probable 2-haloalkanoic acid dehalogenase, hydrolase, structural genomics; 2.40A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >2gfh_A Haloacid dehalogenase-like hydrolase domain conta; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.90A {Mus musculus} SCOP: c.108.1.6 PDB: 2w4m_A | Back alignment and structure |
|---|
| >4dw8_A Haloacid dehalogenase-like hydrolase; HAD, putative phosphatase, enzyme function initiative, EFI, structural genomics; 1.50A {Bacteroides thetaiotaomicron} PDB: 3niw_A 4dwo_A | Back alignment and structure |
|---|
| >3dnp_A Stress response protein YHAX; structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG, unknown function; HET: MSE; 1.85A {Bacillus subtilis} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3vay_A HAD-superfamily hydrolase; rossmann fold, haloacid dehalogenase; 1.98A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >2g80_A Protein UTR4; YEL038W, UTR4 protein (unknown transcript 4 protein), struct genomics, PSI, protein structure initiative; 2.28A {Saccharomyces cerevisiae} SCOP: c.108.1.22 | Back alignment and structure |
|---|
| >3mpo_A Predicted hydrolase of the HAD superfamily; SGX, PSI, structural genomics, protein structure initiative; 2.90A {Lactobacillus brevis} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3dao_A Putative phosphatse; structural genomics, joint center for S genomics, JCSG, protein structure initiative, PSI-2, hydrol; HET: MSE 1PE CIT; 1.80A {Eubacterium rectale} | Back alignment and structure |
|---|
| >3fzq_A Putative hydrolase; YP_001086940.1, putative haloacid dehalogenase-like hydrolas structural genomics, joint center for structural genomics; HET: MSE; 2.10A {Clostridium difficile} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >1wr8_A Phosphoglycolate phosphatase; alpha / beta core domain, HAD superfamily, structural genomi structural genomics/proteomics initiative, RSGI; 1.60A {Pyrococcus horikoshii} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >3l8h_A Putative haloacid dehalogenase-like hydrolase; HAD superfamily, GMHB, D-glycero-D-manno-heptose-1, 7-bispho phosphatase; HET: FX1; 1.68A {Bordetella bronchiseptica} | Back alignment and structure |
|---|
| >2yj3_A Copper-transporting ATPase; hydrolase, P-type ATPase, COPB, heavy metal translocation; 2.20A {Sulfolobus solfataricus} PDB: 2iye_A 2yj6_A* 2yj5_A* 2yj4_A* | Back alignment and structure |
|---|
| >3l7y_A Putative uncharacterized protein SMU.1108C; hydrolase; 2.00A {Streptococcus mutans} | Back alignment and structure |
|---|
| >1yns_A E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo sapiens} SCOP: c.108.1.22 PDB: 1zs9_A | Back alignment and structure |
|---|
| >3pgv_A Haloacid dehalogenase-like hydrolase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: EPE; 2.39A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >4gib_A Beta-phosphoglucomutase; rossmann fold, HAD-like, structural genomics, center for structural genomics of infectious DISE csgid, isomerase; 2.27A {Clostridium difficile} | Back alignment and structure |
|---|
| >1l6r_A Hypothetical protein TA0175; structural genomics, putative hydrolas midwest center for structural genomics, MCSG, PSI; 1.40A {Thermoplasma acidophilum} SCOP: c.108.1.10 PDB: 1kyt_A | Back alignment and structure |
|---|
| >3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* | Back alignment and structure |
|---|
| >3j08_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3rfu_A Copper efflux ATPase; alpha helical, CPC, CXXC, ATP-binding, hydrolase, ION transp magnesium, Cu+, membrane, metal-binding; 3.20A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3a1c_A Probable copper-exporting P-type ATPase A; ATP-binding, cell membrane, copper transport, hydrolase, ION transport, magnesium, membrane; HET: ACP; 1.85A {Archaeoglobus fulgidus} PDB: 3a1d_A* 3a1e_A* 2b8e_A 2voy_J 2voy_I | Back alignment and structure |
|---|
| >2c4n_A Protein NAGD; nucleotide phosphatase, HAD superfamily, UMP phosphatase, carbohydrate metabolism, hydrolase; 1.8A {Escherichia coli} SCOP: c.108.1.14 | Back alignment and structure |
|---|
| >4g9b_A Beta-PGM, beta-phosphoglucomutase; HAD, putative phosphoglucomutase, enzyme function initiative structural genomics, isomerase; 1.70A {Escherichia coli} | Back alignment and structure |
|---|
| >3ewi_A N-acylneuraminate cytidylyltransferase; beta barrel, HAD-like, rossmannoid fold, nucleotidyltransferase, nucleus; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >3pct_A Class C acid phosphatase; hydrolase, outer membrane; 1.85A {Pasteurella multocida} | Back alignment and structure |
|---|
| >3n1u_A Hydrolase, HAD superfamily, subfamily III A; structural genomics, PSI-2; 1.80A {Legionella pneumophila} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3ocu_A Lipoprotein E; hydrolase, outer membrane; HET: NMN; 1.35A {Haemophilus influenzae} PDB: 3ocv_A* 3ocw_A* 3ocx_A* 3ocz_A* 3ocy_A* 3sf0_A* 2hlk_A 2hll_A 3et4_A 3et5_A | Back alignment and structure |
|---|
| >2b82_A APHA, class B acid phosphatase; DDDD acid phosphatase, metallo-ENZ hydrolase; HET: ADN; 1.25A {Escherichia coli} SCOP: c.108.1.12 PDB: 2b8j_A* 2hf7_A 1rmt_A* 1n9k_A 1rmq_A 1n8n_A* 1rmy_A* 2g1a_A* 3cz4_A 2heg_A* 1z5g_A 1z5u_A* 1z88_A 2aut_A | Back alignment and structure |
|---|
| >3ar4_A Sarcoplasmic/endoplasmic reticulum calcium ATPase; P-type ATPase, hydrolase, calcium transport, calcium binding binding; HET: ATP TG1 PTY; 2.15A {Oryctolagus cuniculus} PDB: 2ear_A* 2eas_A* 2eat_A* 2eau_A* 2dqs_A* 2zbe_A 2zbf_A* 2zbg_A* 3ar2_A* 2zbd_A* 3ar3_A* 3ar5_A* 3ar6_A* 3ar7_A* 3ar8_A* 3ar9_A* 3n5k_A* 1kju_A 1iwo_A 1t5s_A* ... | Back alignment and structure |
|---|
| >1mhs_A Proton pump, plasma membrane ATPase; ION transport, membrane protein, P-type ATPase, active transport, cryo-electron microscopy; 8.00A {Neurospora crassa} SCOP: i.18.1.1 | Back alignment and structure |
|---|
| >2x4d_A HLHPP, phospholysine phosphohistidine inorganic pyrophos phosphatase; hydrolase; 1.92A {Homo sapiens} | Back alignment and structure |
|---|
| >3b8c_A ATPase 2, plasma membrane-type; P-type ATPase, proton pump, ATP-binding, hydrogen ION transport, hydrolase, ION transport; HET: ACP; 3.60A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2i33_A Acid phosphatase; HAD superfamily, hydrolase; 1.57A {Bacillus anthracis} PDB: 2i34_A | Back alignment and structure |
|---|
| >2oda_A Hypothetical protein pspto_2114; haloacid dehalogenase, phosphonoacetaldehyde hydrolase, protein binding; HET: EPE; 1.90A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >2zxe_A Na, K-ATPase alpha subunit; membrane protein, ION pump, ATPase, K+ binding, haloacid dehydrogenease superfamily, phosphate analogue; HET: CLR NAG NDG; 2.40A {Squalus acanthias} PDB: 3a3y_A* 3b8e_A* 3kdp_A* 3n2f_A* 3n23_A* 1mo7_A 1mo8_A* 1q3i_A | Back alignment and structure |
|---|
| >3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* | Back alignment and structure |
|---|
| >2ho4_A Haloacid dehalogenase-like hydrolase domain containing 2; HDHD2, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; 2.20A {Mus musculus} PDB: 3hlt_A | Back alignment and structure |
|---|
| >1q92_A 5(3)-deoxyribonucleotidase; alpha-beta rossman fold, hydrolase; HET: DRM; 1.40A {Homo sapiens} SCOP: c.108.1.8 PDB: 1mh9_A* 1q91_A* 1z4m_A* 1z4i_A* 1z4j_A* 1z4l_A* 1z4k_A* 1z4p_X* 1z4q_A* 2jau_A* 2jaw_A* 3u19_A* 3u13_A 4e88_A | Back alignment and structure |
|---|
| >3ixz_A Potassium-transporting ATPase alpha; ION pump, H+, K+-ATPase, P-type ATPase, membrane protein, hydrolase, aluminium fluoride, ATP-binding; 6.50A {Sus scrofa} PDB: 2yn9_A 2xzb_A 1iwc_A 1iwf_A | Back alignment and structure |
|---|
| >2i7d_A 5'(3')-deoxyribonucleotidase, cytosolic type; hydrolase; HET: DUR; 1.20A {Homo sapiens} PDB: 2jar_A* 2jao_A* | Back alignment and structure |
|---|
| >2wm8_A MDP-1, magnesium-dependent phosphatase 1; haloacid dehalogenase, protein phosphatase, hydrolase, magne metal-binding; 1.75A {Homo sapiens} PDB: 1u7o_A 1u7p_A | Back alignment and structure |
|---|
| >1nrw_A Hypothetical protein, haloacid dehalogenase-like hydrolase; structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >1u02_A Trehalose-6-phosphate phosphatase related protein; structural genomics, PSI; 1.92A {Thermoplasma acidophilum} SCOP: c.108.1.15 | Back alignment and structure |
|---|
| >1xvi_A MPGP, YEDP, putative mannosyl-3-phosphoglycerate phosphatase; hypothetical protein, conserved protein, phophatase-like domain; HET: 1PE PG4 PGE; 2.26A {Escherichia coli K12} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >1rkq_A Hypothetical protein YIDA; two domain structure with beta-alpha sandwich. stucture contains A magnesium ION., PSI, protein structure initiative; 1.40A {Escherichia coli} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >3qgm_A P-nitrophenyl phosphatase (PHO2); structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 2.00A {Archaeoglobus fulgidus} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >2gmw_A D,D-heptose 1,7-bisphosphate phosphatase; Zn-binding protein, hydrolase; 1.50A {Escherichia coli} SCOP: c.108.1.19 PDB: 3esq_A 3esr_A 3l1u_A 3l1v_A 3l8e_A 3l8f_A 3l8g_A* | Back alignment and structure |
|---|
| >2pq0_A Hypothetical conserved protein GK1056; hyopthetical protein, structural genomics, unknown function; 2.60A {Geobacillus kaustophilus} PDB: 2qyh_A | Back alignment and structure |
|---|
| >2rbk_A Putative uncharacterized protein; HAD-like phosphatase, unknown function; 1.00A {Bacteroides thetaiotaomicron} SCOP: c.108.1.10 PDB: 1ymq_A 2rb5_A 2rav_A 2rar_A | Back alignment and structure |
|---|
| >3pdw_A Uncharacterized hydrolase YUTF; structural genomics, PSI2, NYSGXRC, protein structure initia YORK SGX research center for structural genomics; 1.60A {Bacillus subtilis} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >2pq0_A Hypothetical conserved protein GK1056; hyopthetical protein, structural genomics, unknown function; 2.60A {Geobacillus kaustophilus} PDB: 2qyh_A | Back alignment and structure |
|---|
| >2pr7_A Haloacid dehalogenase/epoxide hydrolase family; NP_599989.1, uncharacterized protein, structural genomics; 1.44A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >1nf2_A Phosphatase; structural proteomics, HAD NEW fold, structural genomics, BSGC structure funded by NIH structure initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >2o2x_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; 1.50A {Mesorhizobium loti} SCOP: c.108.1.19 | Back alignment and structure |
|---|
| >2zos_A MPGP, mannosyl-3-phosphoglycerate phosphatase; haloacid dehalogenase like hydrolase, mannosylglycerate, cytoplasm, hydrolase, magnesium; 1.70A {Pyrococcus horikoshii} PDB: 1wzc_A | Back alignment and structure |
|---|
| >3f9r_A Phosphomannomutase; trypanosome glycobiology structural genomics, isomerase, structural genomics consortium, SGC; 1.85A {Trypanosoma brucei} SCOP: c.108.1.0 PDB: 2i54_A* 2i55_A* | Back alignment and structure |
|---|
| >2b30_A Pvivax hypothetical protein; SGPP, structural genomics, PSI, protein structure initiative; 2.70A {Plasmodium vivax} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >3epr_A Hydrolase, haloacid dehalogenase-like family; structural genomics, unknown function, HAD superfamily hydro PSI-2; 1.55A {Streptococcus agalactiae serogroup V} SCOP: c.108.1.14 PDB: 1ys9_A 1wvi_A 1ydf_A | Back alignment and structure |
|---|
| >3r4c_A Hydrolase, haloacid dehalogenase-like hydrolase; haloalkanoate dehalogenase enzyme superfamily, phosphohydrol hydrolase; 1.82A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3ib6_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.20A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1rlm_A Phosphatase; HAD family, rossman fold, hydrolase; 1.90A {Escherichia coli} SCOP: c.108.1.10 PDB: 1rlt_A 1rlo_A* 2hf2_A | Back alignment and structure |
|---|
| >3zx4_A MPGP, mannosyl-3-phosphoglycerate phosphatase; hydrolase, haloalkanoid acid dehalogenase-like phosphatase, crystallographic snapshot; HET: 2M8; 1.74A {Thermus thermophilus} PDB: 3zty_A 3zu6_A* 3ztw_A* 3zw7_A* 3zwd_A* 3zwk_A 3zup_A* 3zx5_A* | Back alignment and structure |
|---|
| >1s2o_A SPP, sucrose-phosphatase; phosphohydrolase, HAD superfamily, cyanobacteria; 1.40A {Synechocystis SP} SCOP: c.108.1.10 PDB: 1tj3_A 1tj4_A* 1tj5_A* 1u2s_A* 1u2t_A* 2b1q_A* 2b1r_A* 2d2v_A* | Back alignment and structure |
|---|
| >1rkq_A Hypothetical protein YIDA; two domain structure with beta-alpha sandwich. stucture contains A magnesium ION., PSI, protein structure initiative; 1.40A {Escherichia coli} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >1xvi_A MPGP, YEDP, putative mannosyl-3-phosphoglycerate phosphatase; hypothetical protein, conserved protein, phophatase-like domain; HET: 1PE PG4 PGE; 2.26A {Escherichia coli K12} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >2b30_A Pvivax hypothetical protein; SGPP, structural genomics, PSI, protein structure initiative; 2.70A {Plasmodium vivax} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >1nrw_A Hypothetical protein, haloacid dehalogenase-like hydrolase; structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >1xpj_A Hypothetical protein; structural genomics, MCSG, protein STR initiative, PSI, midwest center for structural genomics, UN function; HET: TLA; 2.30A {Vibrio cholerae} SCOP: c.108.1.18 | Back alignment and structure |
|---|
| >2fpr_A Histidine biosynthesis bifunctional protein HISB; histidinola phosphate phosphatase, bifunctional enzyme structural genomics; 1.70A {Escherichia coli} SCOP: c.108.1.19 PDB: 2fps_A 2fpu_A* 2fpx_A 2fpw_A* | Back alignment and structure |
|---|
| >2fue_A PMM 1, PMMH-22, phosphomannomutase 1; enzyme-product complex, protein glycosyl carbohydrate-deficient glycoprotein syndrome; HET: MSE M1P; 1.75A {Homo sapiens} SCOP: c.108.1.10 PDB: 2fuc_A* | Back alignment and structure |
|---|
| >2amy_A PMM 2, phosphomannomutase 2; HS.459855, HS.313504, BC008310, phosphatase, PFAM PF03332, H superfamily, jaecken disease; 2.09A {Homo sapiens} SCOP: c.108.1.10 PDB: 2q4r_A | Back alignment and structure |
|---|
| >3bwv_A Putative 5'(3')-deoxyribonucleotidase; NP_764060.1, deoxyribonucleotidase-like protein; HET: MSE; 1.55A {Staphylococcus epidermidis} | Back alignment and structure |
|---|
| >2obb_A Hypothetical protein; structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic unknown function; 2.20A {Bacteroides thetaiotaomicron} SCOP: c.108.1.25 | Back alignment and structure |
|---|
| >2rbk_A Putative uncharacterized protein; HAD-like phosphatase, unknown function; 1.00A {Bacteroides thetaiotaomicron} SCOP: c.108.1.10 PDB: 1ymq_A 2rb5_A 2rav_A 2rar_A | Back alignment and structure |
|---|
| >1nf2_A Phosphatase; structural proteomics, HAD NEW fold, structural genomics, BSGC structure funded by NIH structure initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >3r4c_A Hydrolase, haloacid dehalogenase-like hydrolase; haloalkanoate dehalogenase enzyme superfamily, phosphohydrol hydrolase; 1.82A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3f9r_A Phosphomannomutase; trypanosome glycobiology structural genomics, isomerase, structural genomics consortium, SGC; 1.85A {Trypanosoma brucei} SCOP: c.108.1.0 PDB: 2i54_A* 2i55_A* | Back alignment and structure |
|---|
| >2amy_A PMM 2, phosphomannomutase 2; HS.459855, HS.313504, BC008310, phosphatase, PFAM PF03332, H superfamily, jaecken disease; 2.09A {Homo sapiens} SCOP: c.108.1.10 PDB: 2q4r_A | Back alignment and structure |
|---|
| >1qyi_A ZR25, hypothetical protein; structural genomics, PSI, protein structure initiative, NORT structural genomics consortium, NESG; 2.50A {Staphylococcus aureus subsp} SCOP: c.108.1.13 | Back alignment and structure |
|---|
| >1rlm_A Phosphatase; HAD family, rossman fold, hydrolase; 1.90A {Escherichia coli} SCOP: c.108.1.10 PDB: 1rlt_A 1rlo_A* 2hf2_A | Back alignment and structure |
|---|
| >3zx4_A MPGP, mannosyl-3-phosphoglycerate phosphatase; hydrolase, haloalkanoid acid dehalogenase-like phosphatase, crystallographic snapshot; HET: 2M8; 1.74A {Thermus thermophilus} PDB: 3zty_A 3zu6_A* 3ztw_A* 3zw7_A* 3zwd_A* 3zwk_A 3zup_A* 3zx5_A* | Back alignment and structure |
|---|
| >1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A | Back alignment and structure |
|---|
| >2fue_A PMM 1, PMMH-22, phosphomannomutase 1; enzyme-product complex, protein glycosyl carbohydrate-deficient glycoprotein syndrome; HET: MSE M1P; 1.75A {Homo sapiens} SCOP: c.108.1.10 PDB: 2fuc_A* | Back alignment and structure |
|---|
| >1yv9_A Hydrolase, haloacid dehalogenase family; hypothetical protein, struc genomics, PSI, protein structure initiative; 2.80A {Enterococcus faecalis} SCOP: c.108.1.14 | Back alignment and structure |
|---|
| >2wm8_A MDP-1, magnesium-dependent phosphatase 1; haloacid dehalogenase, protein phosphatase, hydrolase, magne metal-binding; 1.75A {Homo sapiens} PDB: 1u7o_A 1u7p_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 499 | |||
| d1nnla_ | 217 | Phosphoserine phosphatase {Human (Homo sapiens) [T | 99.79 | |
| d1j97a_ | 210 | Phosphoserine phosphatase {Archaeon Methanococcus | 99.55 | |
| d1iuqa_ | 367 | Glycerol-3-phosphate (1)-acyltransferase {Cushaw s | 99.55 | |
| d2feaa1 | 226 | 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate | 99.48 | |
| d1rkua_ | 206 | Homoserine kinase ThrH {Pseudomonas aeruginosa [Ta | 99.31 | |
| d2bdua1 | 291 | Cytosolic 5'-nucleotidase III {Mouse (Mus musculus | 99.14 | |
| d1te2a_ | 218 | Phosphatase YniC {Escherichia coli [TaxId: 562]} | 98.59 | |
| d1nrwa_ | 285 | Hypothetical protein YwpJ {Bacillus subtilis [TaxI | 98.34 | |
| d2hsza1 | 224 | Phosphoglycolate phosphatase Gph {Haemophilus somn | 98.32 | |
| d2go7a1 | 204 | Hypothetical protein SP2064 {Streptococcus pneumon | 98.32 | |
| d1wr8a_ | 230 | Phosphoglycolate phosphatase, PGPase {Pyrococcus h | 98.3 | |
| d1l6ra_ | 225 | Phosphoglycolate phosphatase, PGPase {Archaeon The | 98.2 | |
| d2hdoa1 | 207 | Phosphoglycolate phosphatase {Lactobacillus planta | 98.1 | |
| d2ah5a1 | 210 | predicted phosphatase SP0104 {Streptococcus pneumo | 98.07 | |
| d2hcfa1 | 228 | Hypothetical protein CT1708 {Chlorobium tepidum [T | 98.06 | |
| d2b8ea1 | 135 | Cation-transporting ATPase {Archaeon Archaeoglobus | 98.05 | |
| d1swva_ | 257 | Phosphonoacetaldehyde hydrolase {Bacillus cereus [ | 98.02 | |
| d2fi1a1 | 187 | Putative hydrolase SP0805 {Streptococcus pneumonia | 97.99 | |
| d1o08a_ | 221 | beta-Phosphoglucomutase {Lactococcus lactis [TaxId | 97.88 | |
| d1qq5a_ | 245 | L-2-Haloacid dehalogenase, HAD {Xanthobacter autot | 97.86 | |
| d1zrna_ | 220 | L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., s | 97.84 | |
| d2fdra1 | 222 | Hypothetical protein Atu0790 {Agrobacterium tumefa | 97.83 | |
| d2b0ca1 | 197 | Putative phosphatase YihX {Escherichia coli [TaxId | 97.68 | |
| d1x42a1 | 230 | Hypothetical protein PH0459 {Archaeon Pyrococcus h | 97.68 | |
| d2gfha1 | 247 | N-acylneuraminate-9-phosphatase NANP {Mouse (Mus m | 97.65 | |
| d1u7pa_ | 164 | Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mu | 97.59 | |
| d1zs9a1 | 253 | E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} | 97.54 | |
| d1ltqa1 | 149 | Polynucleotide kinase, phosphatase domain {Bacteri | 97.5 | |
| d1wpga2 | 168 | Calcium ATPase, catalytic domain P {Rabbit (Orycto | 97.15 | |
| d1y8aa1 | 308 | Hypothetical protein AF1437 {Archaeon Archaeoglobu | 97.14 | |
| d1k1ea_ | 177 | Probable phosphatase YrbI {Haemophilus influenzae, | 97.0 | |
| d1cr6a1 | 222 | Epoxide hydrolase, N-terminal domain {Mouse (Mus m | 96.75 | |
| d1s2oa1 | 244 | Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc | 96.69 | |
| d1wzca1 | 243 | Putative mannosyl-3-phosphoglycerate phosphatase M | 96.39 | |
| d1zd3a1 | 225 | Epoxide hydrolase, N-terminal domain {Human (Homo | 96.34 | |
| d1xvia_ | 232 | Putative mannosyl-3-phosphoglycerate phosphatase M | 96.11 | |
| d1u02a_ | 229 | Trehalose-6-phosphate phosphatase related protein | 95.92 | |
| d2g80a1 | 225 | Protein UTR4 {Baker's yeast (Saccharomyces cerevis | 95.71 | |
| d1rlma_ | 269 | Sugar phosphatase SupH (YbiV) {Escherichia coli [T | 95.64 | |
| d1rkqa_ | 271 | Hypothetical protein YidA {Escherichia coli [TaxId | 95.63 | |
| d1wzca1 | 243 | Putative mannosyl-3-phosphoglycerate phosphatase M | 95.29 | |
| d2rbka1 | 260 | Sugar-phosphate phosphatase BT4131 {Bacteroides th | 95.0 | |
| d1nf2a_ | 267 | Hypothetical protein TM0651 {Thermotoga maritima [ | 94.95 | |
| d1qyia_ | 380 | Hypothetical protein MW1667 (SA1546) {Staphylococc | 94.81 | |
| d2b30a1 | 283 | PFL1270w orthologue {Plasmodium vivax [TaxId: 5855 | 94.78 | |
| d1rkqa_ | 271 | Hypothetical protein YidA {Escherichia coli [TaxId | 94.73 | |
| d2b82a1 | 209 | Class B acid phosphatase, AphA {Escherichia coli [ | 94.15 | |
| d2fuea1 | 244 | Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: | 93.75 | |
| d1rlma_ | 269 | Sugar phosphatase SupH (YbiV) {Escherichia coli [T | 93.41 | |
| d2amya1 | 243 | Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: | 91.42 | |
| d2amya1 | 243 | Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: | 91.36 | |
| d2fuea1 | 244 | Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: | 89.24 | |
| d2c4na1 | 250 | NagD {Escherichia coli [TaxId: 562]} | 84.94 | |
| d2b30a1 | 283 | PFL1270w orthologue {Plasmodium vivax [TaxId: 5855 | 84.43 | |
| d2rbka1 | 260 | Sugar-phosphate phosphatase BT4131 {Bacteroides th | 84.0 | |
| d1vjra_ | 261 | Hypothetical protein TM1742 {Thermotoga maritima [ | 83.97 | |
| d1yj5a1 | 195 | 5' polynucleotide kinase-3' phosphatase, middle do | 83.31 | |
| d1s2oa1 | 244 | Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc | 83.23 | |
| d1nf2a_ | 267 | Hypothetical protein TM0651 {Thermotoga maritima [ | 83.02 | |
| d1u02a_ | 229 | Trehalose-6-phosphate phosphatase related protein | 81.15 |
| >d1nnla_ c.108.1.4 (A:) Phosphoserine phosphatase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: HAD-like superfamily: HAD-like family: Phosphoserine phosphatase domain: Phosphoserine phosphatase species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.79 E-value=1e-19 Score=170.63 Aligned_cols=185 Identities=9% Similarity=-0.001 Sum_probs=123.1
Q ss_pred CeEEEEecCCceeecCCchHHHHHHHHHhcchHHHHHHHhhHHHHHHHhhcCChhHHHHHHHHHHhcCCCHHHHHHHHHH
Q 010860 20 YGSIAADLDGTLLVSRSSFPYFMLVAVEAGGLLRGLALLVSLPIAIIAYLFISEAIGIQILIFISFSGLKIRDIELASRA 99 (499)
Q Consensus 20 ~~~avFD~DgTL~~~~s~~~~~~~~~~~~~~~~r~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~l~G~~~~~l~~~~~~ 99 (499)
++.++|||||||+++++ +..+... .+...-...+.. ..+....+....++.. ...++|...+.++.+.+.
T Consensus 10 ~~aV~FD~DGTLi~~e~-~~~l~~~-~g~~~~~~~~~~-------~~~~g~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~ 79 (217)
T d1nnla_ 10 ADAVCFDVDSTVIREEG-IDELAKI-CGVEDAVSEMTR-------RAMGGAVPFKAALTER-LALIQPSREQVQRLIAEQ 79 (217)
T ss_dssp CSEEEEETBTTTBSSCH-HHHHHHH-TTCTTTC-------------------CHHHHHHHH-HHHHCCCHHHHHHHHHHS
T ss_pred CCEEEEcCccccCCccH-HHHHHHH-cCChHHHHHHHH-------HHHcCCCCHHHHHHHH-HHhcccchHHHHHHHHhh
Confidence 46789999999999754 4444432 111111111100 0001111111112222 245677665555443331
Q ss_pred HhhhHHHhhccHHH---HHHHHhCC-CEEEEeCCcHHHHHHHHhhhcCCc--EEEeCeEEEecCCCceeeeEecCCcccc
Q 010860 100 VLPRFYAADVRKES---YEVFDKCE-RKVVVTANPTLMVEPFVKDFLGGD--KVLGTEIEVNPRTKRATGFVKRPGVLVG 173 (499)
Q Consensus 100 ~~~~~~~~~i~~~~---~~~~~~~G-~vvlvSas~~~~v~~ia~~~lg~d--~vigt~l~~~~~~g~~tG~~~~~~~~~g 173 (499)
...++|.+ +++||++| +++||||+++.+++++++. ||+| +++|+++.+.. +|++||...+.+++.+
T Consensus 80 ------~~~l~pg~~~~i~~lk~~G~~~~ivS~~~~~~v~~i~~~-lgi~~~~v~an~~~~~~-~G~~~g~~~~~p~~~~ 151 (217)
T d1nnla_ 80 ------PPHLTPGIRELVSRLQERNVQVFLISGGFRSIVEHVASK-LNIPATNVFANRLKFYF-NGEYAGFDETQPTAES 151 (217)
T ss_dssp ------CCCBCTTHHHHHHHHHHTTCEEEEEEEEEHHHHHHHHHH-TTCCGGGEEEECEEECT-TSCEEEECTTSGGGST
T ss_pred ------ccccCHHHHHHHHHHHhCCCEEEEECCCchHHHHHHHHH-hCCcccceeeeeeeeee-hhccccceeeeeeecc
Confidence 12244544 45899999 9999999999999999999 9996 69999999874 8999998877666678
Q ss_pred hhHHHHHHHHhC--CCCCeEEEeCCcCcHHHHhccccCeecCCCCCCCCCC
Q 010860 174 KWKKLAVLKEFG--EDAPDLGIGDRQTDHDFMSICKEGYMVLPSKSAKPLP 222 (499)
Q Consensus 174 ~~K~~~l~~~~~--~~~~~~aygDS~~D~pmL~~a~~~~~Vnp~~~~~~~~ 222 (499)
.+|++.++++.. ....+++||||.+|++|++.|+.++++||++..+.+.
T Consensus 152 ~~K~~~v~~~~~~~~~~~~~~vGDs~~Di~~~~~ag~~va~~~~~~~~~~~ 202 (217)
T d1nnla_ 152 GGKGKVIKLLKEKFHFKKIIMIGDGATDMEACPPADAFIGFGGNVIRQQVK 202 (217)
T ss_dssp THHHHHHHHHHHHHCCSCEEEEESSHHHHTTTTTSSEEEEECSSCCCHHHH
T ss_pred chHHHHHHHHHhccCccccEEEEeCHhhHHHHHhCCceEEECCCHHHHHHH
Confidence 889988887642 1235899999999999999999999999987655443
|
| >d1j97a_ c.108.1.4 (A:) Phosphoserine phosphatase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1iuqa_ c.112.1.1 (A:) Glycerol-3-phosphate (1)-acyltransferase {Cushaw squash (Cucurbita moschata) [TaxId: 3662]} | Back information, alignment and structure |
|---|
| >d2feaa1 c.108.1.20 (A:2-227) 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase MtnX {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1rkua_ c.108.1.11 (A:) Homoserine kinase ThrH {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2bdua1 c.108.1.21 (A:7-297) Cytosolic 5'-nucleotidase III {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1te2a_ c.108.1.6 (A:) Phosphatase YniC {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nrwa_ c.108.1.10 (A:) Hypothetical protein YwpJ {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2hsza1 c.108.1.6 (A:1-224) Phosphoglycolate phosphatase Gph {Haemophilus somnus [TaxId: 731]} | Back information, alignment and structure |
|---|
| >d2go7a1 c.108.1.6 (A:3-206) Hypothetical protein SP2064 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1wr8a_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1l6ra_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d2hdoa1 c.108.1.6 (A:1-207) Phosphoglycolate phosphatase {Lactobacillus plantarum [TaxId: 1590]} | Back information, alignment and structure |
|---|
| >d2ah5a1 c.108.1.6 (A:1-210) predicted phosphatase SP0104 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2hcfa1 c.108.1.6 (A:2-229) Hypothetical protein CT1708 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d2b8ea1 c.108.1.7 (A:416-434,A:548-663) Cation-transporting ATPase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1swva_ c.108.1.3 (A:) Phosphonoacetaldehyde hydrolase {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d2fi1a1 c.108.1.3 (A:4-190) Putative hydrolase SP0805 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1o08a_ c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1qq5a_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Xanthobacter autotrophicus [TaxId: 280]} | Back information, alignment and structure |
|---|
| >d1zrna_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., strain YL [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d2fdra1 c.108.1.6 (A:3-224) Hypothetical protein Atu0790 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d2b0ca1 c.108.1.2 (A:8-204) Putative phosphatase YihX {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1x42a1 c.108.1.1 (A:1-230) Hypothetical protein PH0459 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2gfha1 c.108.1.6 (A:1-247) N-acylneuraminate-9-phosphatase NANP {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1u7pa_ c.108.1.17 (A:) Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zs9a1 c.108.1.22 (A:4-256) E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ltqa1 c.108.1.9 (A:153-301) Polynucleotide kinase, phosphatase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1wpga2 c.108.1.7 (A:344-360,A:600-750) Calcium ATPase, catalytic domain P {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d1y8aa1 c.108.1.24 (A:1-308) Hypothetical protein AF1437 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1k1ea_ c.108.1.5 (A:) Probable phosphatase YrbI {Haemophilus influenzae, HI1679 [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1cr6a1 c.108.1.2 (A:4-225) Epoxide hydrolase, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1s2oa1 c.108.1.10 (A:1-244) Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 6803 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d1wzca1 c.108.1.10 (A:1-243) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1zd3a1 c.108.1.2 (A:2-224) Epoxide hydrolase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xvia_ c.108.1.10 (A:) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1u02a_ c.108.1.15 (A:) Trehalose-6-phosphate phosphatase related protein {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d2g80a1 c.108.1.22 (A:17-241) Protein UTR4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1rlma_ c.108.1.10 (A:) Sugar phosphatase SupH (YbiV) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1rkqa_ c.108.1.10 (A:) Hypothetical protein YidA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wzca1 c.108.1.10 (A:1-243) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2rbka1 c.108.1.10 (A:2-261) Sugar-phosphate phosphatase BT4131 {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d1nf2a_ c.108.1.10 (A:) Hypothetical protein TM0651 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1qyia_ c.108.1.13 (A:) Hypothetical protein MW1667 (SA1546) {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2b30a1 c.108.1.10 (A:18-300) PFL1270w orthologue {Plasmodium vivax [TaxId: 5855]} | Back information, alignment and structure |
|---|
| >d1rkqa_ c.108.1.10 (A:) Hypothetical protein YidA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2b82a1 c.108.1.12 (A:4-212) Class B acid phosphatase, AphA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fuea1 c.108.1.10 (A:13-256) Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rlma_ c.108.1.10 (A:) Sugar phosphatase SupH (YbiV) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2amya1 c.108.1.10 (A:4-246) Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2amya1 c.108.1.10 (A:4-246) Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fuea1 c.108.1.10 (A:13-256) Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c4na1 c.108.1.14 (A:1-250) NagD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2b30a1 c.108.1.10 (A:18-300) PFL1270w orthologue {Plasmodium vivax [TaxId: 5855]} | Back information, alignment and structure |
|---|
| >d2rbka1 c.108.1.10 (A:2-261) Sugar-phosphate phosphatase BT4131 {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d1vjra_ c.108.1.14 (A:) Hypothetical protein TM1742 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1yj5a1 c.108.1.9 (A:144-338) 5' polynucleotide kinase-3' phosphatase, middle domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1s2oa1 c.108.1.10 (A:1-244) Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 6803 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d1nf2a_ c.108.1.10 (A:) Hypothetical protein TM0651 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1u02a_ c.108.1.15 (A:) Trehalose-6-phosphate phosphatase related protein {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|