Citrus Sinensis ID: 010952


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------
MLPRDISQQIFNELVYSRCLTEVSLEAFRDCALQYPGVNDKWMDVIASQGSSLLSVDLSGSDVTDSGLIHLKDCSNLQSLDFNFCIQISDGGLEHLRGLSNLTSLSFRRNNAITAQGMKAFAGLINLVKLDLERCTRIHGGLVNLKGLMKLESLNIKWCNCITDSDMKPLSGLTNLKSLQISCSKVTDSGIAYLKGLQKLTLLNLEGCPVTAACLDSLSALGSLFYLNLNRCQLSDDGCEKFSKIGSLKVLNLGFNEITDECLVHLKGLTNLESLNLDSCGIGDEGLVNLTGLCNLKCLELSDTQVGSSGLRHLSGLTNLESINLSFTGISDGSLRKLAGLSSLKSLNLDARQITDTGLAALTSLTGLTHLDLFGARITDSGAAYLRNFKNLRSLEICGGGLTDAGVKHIKDLSSLTLLNLSQNCNLTDKTLELISGLTGLVSLNVSNSRITSAGLRHLKPLKNLRSLTLESCKVTANDIKRLQSRDLPNLVSFRPE
cccHHHHHHHHHHHHcccccccccccccccccccccccccccHHHHHHccccccEEEcccccccccccccccccccccEEEccccccccccccccccccccccEEEcccccccccccHHHHcccccccEEEcccccccccccccccccccccEEEccccccccccccccccccccccEEEEEccccccccHHHccccccccEEEccccccccccHHHHcccccccEEEccccccccccHHHHHccccccEEEccccccccccHHHHcccccccEEEccccccccccHHHHcccccccEEEccccccccccHHHccccccccEEEccccccccccHHHccccccccEEEccccccccccHHHHcccccccEEEccccccccccHHHHHccccccEEEccccccccccHHHccccccccEEccccccccccHHHHHHHccccccEEEccccccccHHHHHccccccccEEEcccccccHHHHHcccccccccccccccc
ccEEEcccccccccccHHHccccccHEEEHccccccccccccccHHHccccccEEEEEccccccccccHHHcccccccEEEEcccccccccccHHHcccccccEEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEEcccccccccccHHHcccccccEEEEccccccccccHHHcccccccEEEEccccccccccHHHccccccEEEEEccccccccccHHHcccccccEEEEccccccccccHHHcccccccEEEEccccccccccHHHccccccEEEEEccccccccccHHHcccccccEEEEccccccccccHHHcccccccEEEEccccccccccHHHcccccccEEEEccccccccccHHHcccccccEEEcccccccccccHHHccccccEEEEccccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccHHHHHcccc
MLPRDISQQIFNELVYSRCLTEVSLEAFRDCAlqypgvndkWMDVIASQGSSLlsvdlsgsdvtdsglihlkdcsnlqsldfnFCIQisdgglehlrglsnltslsfRRNNAITAQGMKAFAGLINLVKLDLERCTRIHGGLVNLKGLMKLESLNIkwcncitdsdmkplsgltnlkslQISCSKVTDSGIAYLKGLQKLTllnlegcpvtAACLDSLSALGSLFYLnlnrcqlsddgcekfskigslkvlnlgfneITDECLVHLkgltnleslnldscgigdeglvnltglcnlkclelsdtqvgssglrhlsgltnlesinlsftgisdgslrklaglsslkslnldarQITDTGLAALtsltglthldlfgaritDSGAAYLRNFKNLRSLEIcgggltdagvkhikdlssltllnlsqncnltdkTLELISGLTGlvslnvsnsritsaglrhlkplknlrsltlESCKVTANDIkrlqsrdlpnlvsfrpe
mlprdisqqIFNELVYSRCLTEVSLEAFRDCALQYPGVNDKWMDVIASQGSSLLSVDLSGSDVTDSGLIHLKDCSNLQSLDFNFCIQISDGGLEHLRGLSNLTSLSFRRNNAITAQGMKAFAGLINLVKLDLERCTRIHGGlvnlkglmkLESLNIKWCNCITDSDMKPLSGLTNLKSLQISCSKVTDSGIAYLKGLQKLTLLNLEGCPVTAACLDSLSALGSLFYLNLNRCQLSDDGCEKFSKIGSLKVLNLGFNEITDECLVHLKGLTNLESLNLDSCGIGDEGLVNLTGLCNLKCLELSDTQVGSSGLRHLSGLTNLESINLSFTGISDGSLRKLAGLSSLKSLNLDARQITDTGLAALTSLTGLTHLDLFGARITDSGAAYLRNFKNLRSLEICGGGLTDAGVKHIKDLSSLTLLNLSQNCNLTDKTLELISGLTGLVSLNVSNSritsaglrhlkplknlrslTLESCKVtandikrlqsrdlpnlvsfrpe
MLPRDISQQIFNELVYSRCLTEVSLEAFRDCALQYPGVNDKWMDVIASQgssllsvdlsgsdvtdsglIHLKDCSNLQSLDFNFCIQISDGGLEHLRGLSNLTSLSFRRNNAITAQGMKAFAGLINLVKLDLERCTRIHGGLVNLKGLMKLESLNIKWCNCITDSDMKPLSGLTNLKSLQISCSKVTDSGIAYlkglqkltllnlEGCPVTAACLDSLSALGSLFYLNLNRCQLSDDGCEKFSKIGSLKVLNLGFNEITDECLVHLKGLTNLESLNLDSCGIGDEGLVNLTGLCNLKCLELSDTQVGSSGLRHLSGLTNLESINLSFTGISDGSLRKLAGLSSLKSLNLDARQItdtglaaltsltglthlDLFGARITDSGAAYLRNFKNLRSLEICGGGLTDAGVKHIKDlssltllnlsqncnlTDKTLELISGLTGLVSLNVSNSRITSAGLRHLKPLKNLRSLTLESCKVTANDIKRLQSRDLPNLVSFRPE
********QIFNELVYSRCLTEVSLEAFRDCALQYPGVNDKWMDVIASQGSSLLSVDLSGSDVTDSGLIHLKDCSNLQSLDFNFCIQISDGGLEHLRGLSNLTSLSFRRNNAITAQGMKAFAGLINLVKLDLERCTRIHGGLVNLKGLMKLESLNIKWCNCITDSDMKPLSGLTNLKSLQISCSKVTDSGIAYLKGLQKLTLLNLEGCPVTAACLDSLSALGSLFYLNLNRCQLSDDGCEKFSKIGSLKVLNLGFNEITDECLVHLKGLTNLESLNLDSCGIGDEGLVNLTGLCNLKCLELSDTQVGSSGLRHLSGLTNLESINLSFTGISDGSLRKLAGLSSLKSLNLDARQITDTGLAALTSLTGLTHLDLFGARITDSGAAYLRNFKNLRSLEICGGGLTDAGVKHIKDLSSLTLLNLSQNCNLTDKTLELISGLTGLVSLNVSNSRITSAGLRHLKPLKNLRSLTLESCKVTANDI*****************
MLPRDISQQIFNELVYSRCLTEVSLEAFRDCALQYPGVNDKWMDVIASQGSSLLSVDLSGSDVTDSGLIHLKDCSNLQSLDFNFCIQISDGGLEHLRGLSNLTSLSFRRNNAITAQGMKAFAGLINLVKLDLERCTRIHGGLVNLKGLMKLESLNIKWCNCITDSDMKPLSGLTNLKSLQISCSKVTDSGIAYLKGLQKLTLLNLEGCPVTAACLDSLSALGSLFYLNLNRCQLSDDGCEKFSKIGSLKVLNLGFNEITDECLVHLKGLTNLESLNLDSCGIGDEGLVNLTGLCNLKCLELSDTQVGSSGLRHLSGLTNLESINLSFTGISDGSLRKLAGLSSLKSLNLDARQITDTGLAALTSLTGLTHLDLFGARITDSGAAYLRNFKNLRSLEICGGGLTDAGVKHIKDLSSLTLLNLSQNCNLTDKTLELISGLTGLVSLNVSNSRITSAGLRHLKPLKNLRSLTLESCKVTANDIKRLQSRDLPNLVSFRP*
MLPRDISQQIFNELVYSRCLTEVSLEAFRDCALQYPGVNDKWMDVIASQGSSLLSVDLSGSDVTDSGLIHLKDCSNLQSLDFNFCIQISDGGLEHLRGLSNLTSLSFRRNNAITAQGMKAFAGLINLVKLDLERCTRIHGGLVNLKGLMKLESLNIKWCNCITDSDMKPLSGLTNLKSLQISCSKVTDSGIAYLKGLQKLTLLNLEGCPVTAACLDSLSALGSLFYLNLNRCQLSDDGCEKFSKIGSLKVLNLGFNEITDECLVHLKGLTNLESLNLDSCGIGDEGLVNLTGLCNLKCLELSDTQVGSSGLRHLSGLTNLESINLSFTGISDGSLRKLAGLSSLKSLNLDARQITDTGLAALTSLTGLTHLDLFGARITDSGAAYLRNFKNLRSLEICGGGLTDAGVKHIKDLSSLTLLNLSQNCNLTDKTLELISGLTGLVSLNVSNSRITSAGLRHLKPLKNLRSLTLESCKVTANDIKRLQSRDLPNLVSFRPE
MLPRDISQQIFNELVYSRCLTEVSLEAFRDCALQYPGVNDKWMDVIASQGSSLLSVDLSGSDVTDSGLIHLKDCSNLQSLDFNFCIQISDGGLEHLRGLSNLTSLSFRRNNAITAQGMKAFAGLINLVKLDLERCTRIHGGLVNLKGLMKLESLNIKWCNCITDSDMKPLSGLTNLKSLQISCSKVTDSGIAYLKGLQKLTLLNLEGCPVTAACLDSLSALGSLFYLNLNRCQLSDDGCEKFSKIGSLKVLNLGFNEITDECLVHLKGLTNLESLNLDSCGIGDEGLVNLTGLCNLKCLELSDTQVGSSGLRHLSGLTNLESINLSFTGISDGSLRKLAGLSSLKSLNLDARQITDTGLAALTSLTGLTHLDLFGARITDSGAAYLRNFKNLRSLEICGGGLTDAGVKHIKDLSSLTLLNLSQNCNLTDKTLELISGLTGLVSLNVSNSRITSAGLRHLKPLKNLRSLTLESCKVTANDIKRLQSRDLPNLVSFR**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLPRDISQQIFNELVYSRCLTEVSLEAFRDCALQYPGVNDKWMDVIASQGSSLLSVDLSGSDVTDSGLIHLKDCSNLQSLDFNFCIQISDGGLEHLRGLSNLTSLSFRRNNAITAQGMKAFAGLINLVKLDLERCTRIHGGLVNLKGLMKLESLNIKWCNCITDSDMKPLSGLTNLKSLQISCSKVTDSGIAYLKGLQKLTLLNLEGCPVTAACLDSLSALGSLFYLNLNRCQLSDDGCEKFSKIGSLKVLNLGFNEITDECLVHLKGLTNLESLNLDSCGIGDEGLVNLTGLCNLKCLELSDTQVGSSGLRHLSGLTNLESINLSFTGISDGSLRKLAGLSSLKSLNLDARQITDTGLAALTSLTGLTHLDLFGARITDSGAAYLRNFKNLRSLEICGGGLTDAGVKHIKDLSSLTLLNLSQNCNLTDKTLELISGLTGLVSLNVSNSRITSAGLRHLKPLKNLRSLTLESCKVTANDIKRLQSRDLPNLVSFRPE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query497 2.2.26 [Sep-21-2011]
Q8BID8400 F-box/LRR-repeat protein yes no 0.583 0.725 0.328 6e-18
Q17R01400 F-box/LRR-repeat protein yes no 0.583 0.725 0.328 6e-18
Q8N1E6418 F-box/LRR-repeat protein yes no 0.609 0.724 0.322 6e-18
Q723K6 800 Internalin-A OS=Listeria yes no 0.670 0.416 0.315 9e-15
G2K3G6 800 Internalin-A OS=Listeria yes no 0.670 0.416 0.312 1e-14
P0DJM0 800 Internalin-A OS=Listeria yes no 0.665 0.413 0.312 9e-14
Q8NEE6735 F-box/LRR-repeat protein no no 0.752 0.508 0.246 9e-11
P23799630 Putative adenylate cyclas N/A no 0.788 0.622 0.287 1e-10
P26337630 Putative adenylate cyclas N/A no 0.792 0.625 0.291 2e-10
Q9C5D2610 F-box/LRR-repeat protein no no 0.845 0.688 0.284 2e-10
>sp|Q8BID8|FXL14_MOUSE F-box/LRR-repeat protein 14 OS=Mus musculus GN=Fbxl14 PE=2 SV=1 Back     alignment and function desciption
 Score = 92.8 bits (229), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 111/338 (32%), Positives = 180/338 (53%), Gaps = 48/338 (14%)

Query: 170 LSGLTNLKSLQIS-CSKVTDSGIAYLKGLQKLTLLNLEGCPVTAACLDSLSALGSLFYLN 228
           + G+ N++SL +S C  +TD+G+ +                        +  +GSL  LN
Sbjct: 86  IQGMANIESLNLSGCYNLTDNGLGH----------------------AFVQEIGSLRALN 123

Query: 229 LNRC-QLSDDGCEKFSK-IGSLKVLNLG-FNEITDECLVHLK-GLTNLESLNLDSC-GIG 283
           L+ C Q++D    + ++ +  L+VL LG  + IT+  L+ +  GL  L+SLNL SC  + 
Sbjct: 124 LSLCKQITDSSLGRIAQYLKGLEVLELGGCSNITNTGLLLIAWGLQRLKSLNLRSCRHLS 183

Query: 284 DEGLVNLTGLCN--------LKCLELSDTQ-VGSSGLRHLS-GLTNLESINLSFTG-ISD 332
           D G+ +L G+          L+ L L D Q +    L+H+S GLT L  +NLSF G ISD
Sbjct: 184 DVGIGHLAGMTRSAAEGCLGLEQLTLQDCQKLTDLSLKHISRGLTGLRLLNLSFCGGISD 243

Query: 333 GSLRKLAGLSSLKSLNLDA-RQITDTGLA--ALTSLTGLTHLDL-FGARITDSGAAYL-R 387
             L  L+ + SL+SLNL +   I+DTG+   A+ SL  L+ LD+ F  ++ D   AY+ +
Sbjct: 244 AGLLHLSHMGSLRSLNLRSCDNISDTGIMHLAMGSLR-LSGLDVSFCDKVGDQSLAYIAQ 302

Query: 388 NFKNLRSLEICGGGLTDAGV-KHIKDLSSLTLLNLSQNCNLTDKTLELIS-GLTGLVSLN 445
               L+SL +C   ++D G+ + ++ +  L  LN+ Q   +TDK LELI+  L+ L  ++
Sbjct: 303 GLDGLKSLSLCSCHISDDGINRMVRQMHGLRTLNIGQCVRITDKGLELIAEHLSQLTGID 362

Query: 446 VSN-SRITSAGLRHLKPLKNLRSLTLESCKVTANDIKR 482
           +   +RIT  GL  +  L  L+ L L   ++T ++  R
Sbjct: 363 LYGCTRITKRGLERITQLPCLKVLNLGLWQMTDSEKVR 400




Substrate-recognition component of some (SKP1-CUL1-F-box protein)-type E3 ubiquitin-protein ligase complexes. The SCF(FBXL14) complex acts by mediating ubiquitination and subsequent degradation of SNAI1.
Mus musculus (taxid: 10090)
>sp|Q17R01|FXL14_BOVIN F-box/LRR-repeat protein 14 OS=Bos taurus GN=FBXL14 PE=2 SV=1 Back     alignment and function description
>sp|Q8N1E6|FXL14_HUMAN F-box/LRR-repeat protein 14 OS=Homo sapiens GN=FBXL14 PE=1 SV=1 Back     alignment and function description
>sp|Q723K6|INLA_LISMF Internalin-A OS=Listeria monocytogenes serotype 4b (strain F2365) GN=inlA PE=3 SV=1 Back     alignment and function description
>sp|G2K3G6|INLA_LISM4 Internalin-A OS=Listeria monocytogenes serotype 1/2a (strain 10403S) GN=inlA PE=3 SV=1 Back     alignment and function description
>sp|P0DJM0|INLA_LISMO Internalin-A OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=inlA PE=1 SV=1 Back     alignment and function description
>sp|Q8NEE6|FXL13_HUMAN F-box/LRR-repeat protein 13 OS=Homo sapiens GN=FBXL13 PE=2 SV=3 Back     alignment and function description
>sp|P23799|ESAG8_TRYBB Putative adenylate cyclase regulatory protein OS=Trypanosoma brucei brucei GN=ESAG8 PE=2 SV=1 Back     alignment and function description
>sp|P26337|ESA8C_TRYEQ Putative adenylate cyclase regulatory protein OS=Trypanosoma equiperdum GN=ESAG8C PE=2 SV=1 Back     alignment and function description
>sp|Q9C5D2|FBL4_ARATH F-box/LRR-repeat protein 4 OS=Arabidopsis thaliana GN=FBL4 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query497
225463572578 PREDICTED: F-box/LRR-repeat protein 14 [ 1.0 0.859 0.797 0.0
449436168578 PREDICTED: F-box/LRR-repeat protein 14-l 1.0 0.859 0.777 0.0
359484681578 PREDICTED: insulin-like growth factor-bi 1.0 0.859 0.753 0.0
356519276577 PREDICTED: F-box/LRR-repeat protein 14-l 0.997 0.859 0.788 0.0
224120462576 predicted protein [Populus trichocarpa] 0.997 0.861 0.735 0.0
357458869585 F-box/LRR-repeat protein [Medicago trunc 1.0 0.849 0.741 0.0
182407840580 F-box-containing protein 1 [Malus x dome 1.0 0.856 0.741 0.0
388500850577 unknown [Medicago truncatula] 1.0 0.861 0.743 0.0
357468127573 F-box/LRR-repeat protein [Medicago trunc 0.987 0.856 0.740 0.0
297844484578 leucine-rich repeat family protein [Arab 0.997 0.858 0.767 0.0
>gi|225463572|ref|XP_002270172.1| PREDICTED: F-box/LRR-repeat protein 14 [Vitis vinifera] gi|297743556|emb|CBI36423.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  749 bits (1933), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/503 (79%), Positives = 454/503 (90%), Gaps = 6/503 (1%)

Query: 1   MLPRDISQQIFNELVYSRCLTEVSLEAFRDCALQ------YPGVNDKWMDVIASQGSSLL 54
           MLPRDISQQIFNELV+S+CLT+VSL+AF+DCALQ      YPGV+D WMDVI+SQG SLL
Sbjct: 76  MLPRDISQQIFNELVFSQCLTDVSLKAFQDCALQDIYLGEYPGVSDSWMDVISSQGVSLL 135

Query: 55  SVDLSGSDVTDSGLIHLKDCSNLQSLDFNFCIQISDGGLEHLRGLSNLTSLSFRRNNAIT 114
           SVDLSGS++T+SGLIHLKDC+NLQ+L+ N+C QISD GL+H+ GLSNLT+LSFRRNNAIT
Sbjct: 136 SVDLSGSEITNSGLIHLKDCTNLQALNLNYCDQISDHGLKHISGLSNLTTLSFRRNNAIT 195

Query: 115 AQGMKAFAGLINLVKLDLERCTRIHGGLVNLKGLMKLESLNIKWCNCITDSDMKPLSGLT 174
           AQGM AF+ L+NLVKLDLERC  IHGGL++LKGL KLESLNI  C+CITD+D+KPLSGLT
Sbjct: 196 AQGMSAFSSLVNLVKLDLERCPGIHGGLIHLKGLTKLESLNINMCHCITDADLKPLSGLT 255

Query: 175 NLKSLQISCSKVTDSGIAYLKGLQKLTLLNLEGCPVTAACLDSLSALGSLFYLNLNRCQL 234
           NLK L+IS SKVTD G+AYLKGL KL LLN+EGCPVTAACL+SLS L SL  LNLNR  L
Sbjct: 256 NLKGLEISRSKVTDDGVAYLKGLHKLALLNMEGCPVTAACLESLSDLPSLLSLNLNRSML 315

Query: 235 SDDGCEKFSKIGSLKVLNLGFNEITDECLVHLKGLTNLESLNLDSCGIGDEGLVNLTGLC 294
           SDDGCE F++  +L+VLNLGFN++TD CLVHLKGLTNLESLNLDSC I DEGL NLTGL 
Sbjct: 316 SDDGCENFARQENLRVLNLGFNDLTDACLVHLKGLTNLESLNLDSCRICDEGLANLTGLR 375

Query: 295 NLKCLELSDTQVGSSGLRHLSGLTNLESINLSFTGISDGSLRKLAGLSSLKSLNLDARQI 354
           +LKCLELSDT+VGS+GLRHLSGL NLESINLSFT ++D  LRKL+ LSSLKSLNLDARQI
Sbjct: 376 HLKCLELSDTEVGSNGLRHLSGLANLESINLSFTAVTDSGLRKLSALSSLKSLNLDARQI 435

Query: 355 TDTGLAALTSLTGLTHLDLFGARITDSGAAYLRNFKNLRSLEICGGGLTDAGVKHIKDLS 414
           TD GLAALTSLTGLTHLDLFGARITDSG +YLRNFKNL+SLEICGGGLTDAGVK+IKDL+
Sbjct: 436 TDAGLAALTSLTGLTHLDLFGARITDSGTSYLRNFKNLQSLEICGGGLTDAGVKNIKDLT 495

Query: 415 SLTLLNLSQNCNLTDKTLELISGLTGLVSLNVSNSRITSAGLRHLKPLKNLRSLTLESCK 474
            LT+LNLSQNCNLTDK+LELISGLT LVSL+VSNSRIT+AGL+HLK LKNL+SLTL+SCK
Sbjct: 496 CLTVLNLSQNCNLTDKSLELISGLTALVSLSVSNSRITNAGLQHLKQLKNLKSLTLDSCK 555

Query: 475 VTANDIKRLQSRDLPNLVSFRPE 497
           VT NDIK+LQS+DLPNLVSFRPE
Sbjct: 556 VTVNDIKKLQSKDLPNLVSFRPE 578




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|449436168|ref|XP_004135866.1| PREDICTED: F-box/LRR-repeat protein 14-like [Cucumis sativus] gi|449509305|ref|XP_004163550.1| PREDICTED: F-box/LRR-repeat protein 14-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|359484681|ref|XP_002262830.2| PREDICTED: insulin-like growth factor-binding protein complex acid labile subunit-like [Vitis vinifera] gi|296084545|emb|CBI25566.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356519276|ref|XP_003528299.1| PREDICTED: F-box/LRR-repeat protein 14-like isoform 1 [Glycine max] Back     alignment and taxonomy information
>gi|224120462|ref|XP_002331054.1| predicted protein [Populus trichocarpa] gi|222872984|gb|EEF10115.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357458869|ref|XP_003599715.1| F-box/LRR-repeat protein [Medicago truncatula] gi|355488763|gb|AES69966.1| F-box/LRR-repeat protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|182407840|gb|ACB87911.1| F-box-containing protein 1 [Malus x domestica] Back     alignment and taxonomy information
>gi|388500850|gb|AFK38491.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|357468127|ref|XP_003604348.1| F-box/LRR-repeat protein [Medicago truncatula] gi|355505403|gb|AES86545.1| F-box/LRR-repeat protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|297844484|ref|XP_002890123.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. lyrata] gi|297335965|gb|EFH66382.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query497
TAIR|locus:2036199585 AT1G15740 [Arabidopsis thalian 0.997 0.847 0.662 1.2e-170
TAIR|locus:2138131597 AT4G23840 "AT4G23840" [Arabido 0.784 0.653 0.268 2.1e-19
UNIPROTKB|F1NMM1345 FBXL14 "Uncharacterized protei 0.579 0.834 0.308 5e-17
FB|FBgn0020257538 ppa "partner of paired" [Droso 0.509 0.470 0.308 2e-16
TAIR|locus:2143320642 AT5G27920 "AT5G27920" [Arabido 0.782 0.605 0.294 2.2e-16
ZFIN|ZDB-GENE-030131-3556400 fbxl14b "F-box and leucine-ric 0.474 0.59 0.314 5.1e-16
DICTYBASE|DDB_G0291424902 DDB_G0291424 "Transcription fa 0.591 0.325 0.274 5.2e-16
ZFIN|ZDB-GENE-030131-5920411 fbxl14a "F-box and leucine-ric 0.521 0.630 0.297 1.3e-15
UNIPROTKB|Q17R01400 FBXL14 "F-box/LRR-repeat prote 0.434 0.54 0.294 3.6e-14
MGI|MGI:2141676400 Fbxl14 "F-box and leucine-rich 0.434 0.54 0.294 3.6e-14
TAIR|locus:2036199 AT1G15740 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1659 (589.1 bits), Expect = 1.2e-170, P = 1.2e-170
 Identities = 333/503 (66%), Positives = 384/503 (76%)

Query:     2 LPRDISQQIFNELVYSRCLTEVSLEAFRDCALQ------YPGVNDKWMDVIASQXXXXXX 55
             LPRDISQQIF+ELVYS+ LT  SLEAFRDCA+Q      YPGVND WMDVI+SQ      
Sbjct:    83 LPRDISQQIFDELVYSQRLTLKSLEAFRDCAIQDLYLGEYPGVNDDWMDVISSQSTSLLS 142

Query:    56 XXXXXXXXXXXXXIHLKDCSNLQSLDFNFCIQISDGGLEHLRGLSNLTSLSFRRNNAITA 115
                          + LK C+NL+SL+FNFC QIS+ GL HL GLSNLTSLSFRRN AITA
Sbjct:   143 VDFSGSDITDSGLVSLKGCTNLESLNFNFCDQISNRGLVHLSGLSNLTSLSFRRNAAITA 202

Query:   116 QGMKAFAGLINLVKLDLERCTRIHGGLVNLKGLMKLESLNIKWCNCITDSDMKPLSGLTN 175
             QGM+A + L+NL KLDLE+C  I GGLV+L+ L KLESLNIKWCNCITD+DM+PLS LTN
Sbjct:   203 QGMRALSNLVNLKKLDLEKCPGIDGGLVHLRALTKLESLNIKWCNCITDADMEPLSVLTN 262

Query:   176 LKSLQISCSKVTDSGIAYXXXXXXXXXXXXEGCP-VTAACLDSLSALGSLFYLNLNRCQL 234
             L+SLQI CSK+TD GI+Y            EGC  VTAACLD+L+AL  L YLNLNRC  
Sbjct:   263 LRSLQICCSKITDIGISYLKGLNKLNLLNLEGCRHVTAACLDTLTALAGLMYLNLNRCNF 322

Query:   235 SDDGCEKFSKIGSLKVLNLGFNEITDECLVHLKGLTNLESLNLDSCGIGDEGLVNLTGLC 294
             SD GCEKFS + +LK+LNLG N IT+ CLVHLKGLT LESLNLDSC IGDEGLV+L+G+ 
Sbjct:   323 SDSGCEKFSDLINLKILNLGMNNITNSCLVHLKGLTKLESLNLDSCRIGDEGLVHLSGML 382

Query:   295 NLKCLELSDTQVGSSGLRHLSGLTNLESINLSFTGISDGSLRKLAGLSSLKSLNLDARQI 354
              LK LELSDT+VGS+GLRHLSGL+NLESINLSFT ++D  LRKL+GL+SL++LNLDAR +
Sbjct:   383 ELKSLELSDTEVGSNGLRHLSGLSNLESINLSFTVVTDSGLRKLSGLTSLRTLNLDARHV 442

Query:   355 XXXXXXXXXXXXXXXXXDLFGARITDSGAAYLRNFKNLRSLEICGGGLTDAGVKHIKDXX 414
                              DLFGARITDSG  +LRN K L+SLEICGGGLTD GVK+IKD  
Sbjct:   443 TDAGLSALTSLTGLTHLDLFGARITDSGTNHLRNLKKLQSLEICGGGLTDTGVKNIKDLS 502

Query:   415 XXXXXXXXXXXXXTDKTLELISGLTGLVSLNVSNSRITSAGLRHLKPLKNLRSLTLESCK 474
                          TDKTLELISGLTGLVSLNVSNSR++S+GLRHLKPLKNLRSLTLESCK
Sbjct:   503 SLTLLNLSQNSNLTDKTLELISGLTGLVSLNVSNSRVSSSGLRHLKPLKNLRSLTLESCK 562

Query:   475 VTANDIKRLQSRDLPNLVSFRPE 497
             ++ANDI++LQ+ DLPNLV+FRPE
Sbjct:   563 LSANDIRKLQATDLPNLVNFRPE 585




GO:0005886 "plasma membrane" evidence=ISM
TAIR|locus:2138131 AT4G23840 "AT4G23840" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|F1NMM1 FBXL14 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
FB|FBgn0020257 ppa "partner of paired" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
TAIR|locus:2143320 AT5G27920 "AT5G27920" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-3556 fbxl14b "F-box and leucine-rich repeat protein 14b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0291424 DDB_G0291424 "Transcription factor SKN7" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-5920 fbxl14a "F-box and leucine-rich repeat protein 14a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q17R01 FBXL14 "F-box/LRR-repeat protein 14" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:2141676 Fbxl14 "F-box and leucine-rich repeat protein 14" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00003249001
SubName- Full=Chromosome undetermined scaffold_141, whole genome shotgun sequence; (578 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00037306001
SubName- Full=Chromosome undetermined scaffold_87, whole genome shotgun sequence; (446 aa)
       0.412

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query497
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 1e-09
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-07
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-06
cd09293226 cd09293, AMN1, Antagonist of mitotic exit network 5e-06
cd09293226 cd09293, AMN1, Antagonist of mitotic exit network 8e-06
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 9e-06
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 9e-06
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 6e-05
cd09293226 cd09293, AMN1, Antagonist of mitotic exit network 3e-04
cd09293226 cd09293, AMN1, Antagonist of mitotic exit network 6e-04
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 8e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.003
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
 Score = 58.9 bits (143), Expect = 1e-09
 Identities = 68/252 (26%), Positives = 100/252 (39%), Gaps = 46/252 (18%)

Query: 200 LTLLNLEGCP-VTAACLDSLSALGSLFYLNLNRCQLSDDGC---EKFSKIGSLKVLNLGF 255
           L+L      P    + L  L+    L  L+L+   L  DGC   E   +  SL+ L L  
Sbjct: 58  LSLNETGRIPRGLQSLLQGLTKGCGLQELDLSDNALGPDGCGVLESLLRSSSLQELKLNN 117

Query: 256 NEITDECLVHL-KGLT----NLESLNLDSCGIGDEGLVNLTGL----CNLKCLELSDTQV 306
           N + D  L  L KGL      LE L L    +       L        +LK L L++  +
Sbjct: 118 NGLGDRGLRLLAKGLKDLPPALEKLVLGRNRLEGASCEALAKALRANRDLKELNLANNGI 177

Query: 307 GSSGLRHLSGLTNLESINLSFTGISDGSLRKLAGLSSLKSLNLDARQITDTGLAALT--- 363
           G +G+R L                       L    +L+ L+L+   +TD G +AL    
Sbjct: 178 GDAGIRAL--------------------AEGLKANCNLEVLDLNNNGLTDEGASALAETL 217

Query: 364 -SLTGLTHLDLFGARITDSGAAYLRN-----FKNLRSLEICGGGLTDAGVKH----IKDL 413
            SL  L  L+L    +TD+GAA L +       +L +L +    +TD G K     + + 
Sbjct: 218 ASLKSLEVLNLGDNNLTDAGAAALASALLSPNISLLTLSLSCNDITDDGAKDLAEVLAEK 277

Query: 414 SSLTLLNLSQNC 425
            SL  L+L  N 
Sbjct: 278 ESLLELDLRGNK 289


LRRs are 20-29 residue sequence motifs present in many proteins that participate in protein-protein interactions and have different functions and cellular locations. LRRs correspond to structural units consisting of a beta strand (LxxLxLxxN/CxL conserved pattern) and an alpha helix. This alignment contains 12 strands corresponding to 11 full repeats, consistent with the extent observed in the subfamily acting as Ran GTPase Activating Proteins (RanGAP1). Length = 319

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|187754 cd09293, AMN1, Antagonist of mitotic exit network protein 1 Back     alignment and domain information
>gnl|CDD|187754 cd09293, AMN1, Antagonist of mitotic exit network protein 1 Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|187754 cd09293, AMN1, Antagonist of mitotic exit network protein 1 Back     alignment and domain information
>gnl|CDD|187754 cd09293, AMN1, Antagonist of mitotic exit network protein 1 Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 497
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.93
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.93
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.93
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.93
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.91
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.91
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.87
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.85
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.84
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.81
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.76
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.72
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.63
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.6
KOG4341483 consensus F-box protein containing LRR [General fu 99.58
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.53
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.52
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.48
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.45
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 99.45
KOG4341483 consensus F-box protein containing LRR [General fu 99.42
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 99.4
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.33
KOG0617264 consensus Ras suppressor protein (contains leucine 99.28
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.26
KOG0617264 consensus Ras suppressor protein (contains leucine 99.23
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.09
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.07
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.01
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.99
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.97
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.96
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.9
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.89
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.64
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.63
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.59
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.57
KOG2982 418 consensus Uncharacterized conserved protein [Funct 98.57
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.56
PLN03150623 hypothetical protein; Provisional 98.55
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.5
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.49
PLN03150623 hypothetical protein; Provisional 98.44
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.34
KOG1947482 consensus Leucine rich repeat proteins, some prote 98.3
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.29
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.26
KOG1947482 consensus Leucine rich repeat proteins, some prote 98.25
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 98.23
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.11
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 97.99
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.9
KOG3864221 consensus Uncharacterized conserved protein [Funct 97.73
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.73
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.63
KOG2123 388 consensus Uncharacterized conserved protein [Funct 97.5
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.49
KOG2123 388 consensus Uncharacterized conserved protein [Funct 97.48
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.42
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.41
KOG3864221 consensus Uncharacterized conserved protein [Funct 97.21
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.15
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.12
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.07
PRK15386 426 type III secretion protein GogB; Provisional 97.05
KOG4308478 consensus LRR-containing protein [Function unknown 96.94
PRK15386 426 type III secretion protein GogB; Provisional 96.82
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.65
KOG4308 478 consensus LRR-containing protein [Function unknown 96.62
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 94.71
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 94.26
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 93.44
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 93.21
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 92.05
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 90.62
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 90.62
PF1293747 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 87.38
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 82.12
smart0037026 LRR Leucine-rich repeats, outliers. 82.12
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=9.2e-44  Score=378.17  Aligned_cols=437  Identities=22%  Similarity=0.229  Sum_probs=239.9

Q ss_pred             cCCceeEEEeeCCCCChHHHHHhcCCCCcCEEEccCccccChhHHHHhhCCCCCCEEEcCCCCCCChHHHHHHhCCCCCC
Q 010952           49 QGSSLLSVDLSGSDVTDSGLIHLKDCSNLQSLDFNFCIQISDGGLEHLRGLSNLTSLSFRRNNAITAQGMKAFAGLINLV  128 (497)
Q Consensus        49 ~~~~l~~L~l~~~~~~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~l~~l~~L~  128 (497)
                      .+++|++|+++++.+.+..+.  +.+++|++|++++| .+....+..++.+++|++|++++|. +....|..++++++|+
T Consensus       116 ~l~~L~~L~Ls~n~l~~~~p~--~~l~~L~~L~Ls~n-~~~~~~p~~~~~l~~L~~L~L~~n~-l~~~~p~~~~~l~~L~  191 (968)
T PLN00113        116 TSSSLRYLNLSNNNFTGSIPR--GSIPNLETLDLSNN-MLSGEIPNDIGSFSSLKVLDLGGNV-LVGKIPNSLTNLTSLE  191 (968)
T ss_pred             cCCCCCEEECcCCccccccCc--cccCCCCEEECcCC-cccccCChHHhcCCCCCEEECccCc-ccccCChhhhhCcCCC
Confidence            566777777777666543332  34566666666665 4444455566666666666666665 3444555666666666


Q ss_pred             EEeccCccccccccccccCCCCCCEEeccCCCCCCccccccccCCCCCCEEEeeccccCchhHHhhhcCCCCcEEEccCC
Q 010952          129 KLDLERCTRIHGGLVNLKGLMKLESLNIKWCNCITDSDMKPLSGLTNLKSLQISCSKVTDSGIAYLKGLQKLTLLNLEGC  208 (497)
Q Consensus       129 ~L~l~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~l~~l~~L~~L~l~~~  208 (497)
                      +|++++|......+..+.++++|++|++++|. +....+..+..+++|++|++++|.+....+..+.++++|++|++++|
T Consensus       192 ~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~-l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n  270 (968)
T PLN00113        192 FLTLASNQLVGQIPRELGQMKSLKWIYLGYNN-LSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQN  270 (968)
T ss_pred             eeeccCCCCcCcCChHHcCcCCccEEECcCCc-cCCcCChhHhcCCCCCEEECcCceeccccChhHhCCCCCCEEECcCC
Confidence            66666654443445555666666666666533 33334455556666666666666555555555566666666666666


Q ss_pred             CCChHHHHHhhCCCCCcEEEcCCCCCChhHhHhhhcCCCCCEEEccCCCCChhHHHHhhCCCCcCEEeCCCCCCCHhHHH
Q 010952          209 PVTAACLDSLSALGSLFYLNLNRCQLSDDGCEKFSKIGSLKVLNLGFNEITDECLVHLKGLTNLESLNLDSCGIGDEGLV  288 (497)
Q Consensus       209 ~~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~l~~~~~L~~L~l~~~~l~~~~~~  288 (497)
                      .+.+..+..+..+++|+.|++++|.+....+..+..+++|+.|++++|.+....+..+..+++|+.|++++|.+....+.
T Consensus       271 ~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~L~~n~l~~~~p~  350 (968)
T PLN00113        271 KLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEIPK  350 (968)
T ss_pred             eeeccCchhHhhccCcCEEECcCCeeccCCChhHcCCCCCcEEECCCCccCCcCChhHhcCCCCCEEECcCCCCcCcCCh
Confidence            55554555555556666666666555554555555555555555555555544444455555555555555554444444


Q ss_pred             HHhCCCCCCEeeccCcccch------------------------HHHHhhcCCCCCCEEeccCCCCChHHHHHhcCCCCC
Q 010952          289 NLTGLCNLKCLELSDTQVGS------------------------SGLRHLSGLTNLESINLSFTGISDGSLRKLAGLSSL  344 (497)
Q Consensus       289 ~l~~~~~L~~L~l~~~~~~~------------------------~~~~~l~~~~~L~~L~l~~~~~~~~~~~~l~~~~~L  344 (497)
                      .+..+++|+.|++++|.+..                        ..+..+..+++|+.|++++|.+....+..+.++++|
T Consensus       351 ~l~~~~~L~~L~Ls~n~l~~~~p~~~~~~~~L~~L~l~~n~l~~~~p~~~~~~~~L~~L~L~~n~l~~~~p~~~~~l~~L  430 (968)
T PLN00113        351 NLGKHNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGELPSEFTKLPLV  430 (968)
T ss_pred             HHhCCCCCcEEECCCCeeEeeCChhHhCcCCCCEEECcCCEecccCCHHHhCCCCCCEEECcCCEeeeECChhHhcCCCC
Confidence            44445555555555444433                        333334444555555555554443344444455555


Q ss_pred             cEEEcCCCCCCHhHHHHhcCCCCCcEEEecCCCcChHHHHHhhccCCCCeeeecCCCCChhhHHhhhhcCCCCeecccCC
Q 010952          345 KSLNLDARQITDTGLAALTSLTGLTHLDLFGARITDSGAAYLRNFKNLRSLEICGGGLTDAGVKHIKDLSSLTLLNLSQN  424 (497)
Q Consensus       345 ~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~l~~~~~L~~L~l~~~~l~~~~~~~~~~l~~L~~L~l~~~  424 (497)
                      +.|++++|.++...+..+..+++|+.|++++|.+.+..|..+ ..++|+.|++++|++.+..+..+..+++|+.|++++|
T Consensus       431 ~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~n~~~~~~p~~~-~~~~L~~L~ls~n~l~~~~~~~~~~l~~L~~L~Ls~N  509 (968)
T PLN00113        431 YFLDISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLPDSF-GSKRLENLDLSRNQFSGAVPRKLGSLSELMQLKLSEN  509 (968)
T ss_pred             CEEECcCCcccCccChhhccCCCCcEEECcCceeeeecCccc-ccccceEEECcCCccCCccChhhhhhhccCEEECcCC
Confidence            555555554444333333344455555555554443333222 2345555555555555555555555666666666666


Q ss_pred             CCCChhHHHHhhcCCCCcEEEeeCCccChhHHHhhcCCcccceeecccCCCCHHHHHHHhhcCCCCCccC
Q 010952          425 CNLTDKTLELISGLTGLVSLNVSNSRITSAGLRHLKPLKNLRSLTLESCKVTANDIKRLQSRDLPNLVSF  494 (497)
Q Consensus       425 ~~l~~~~~~~l~~~~~L~~L~l~~~~l~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~l~~~~~p~L~~l  494 (497)
                       .+....|..+.++++|+.|++++|.+++..+..+..+++|+.|++++|.++......+.  .+++|+.+
T Consensus       510 -~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~--~l~~L~~l  576 (968)
T PLN00113        510 -KLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNLG--NVESLVQV  576 (968)
T ss_pred             -cceeeCChHHcCccCCCEEECCCCcccccCChhHhCcccCCEEECCCCcccccCChhHh--cCcccCEE
Confidence             55555555566666666666666666665556666666666666666666554444443  34444443



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information
>PF12937 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 2OVQ_B 1FS1_A 1FS2_C 1FQV_I 1LDK_E 2AST_B 2ASS_B Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query497
2omy_A461 Crystal Structure Of Inla S192n/hec1 Complex Length 4e-11
2omv_A461 Crystal Structure Of Inla S192n Y369s/hec1 Complex 5e-11
1o6s_A466 Internalin (Listeria Monocytogenes) E-Cadherin (Hum 2e-10
2omz_A466 Crystal Structure Of Inla Y369a/hec1 Complex Length 2e-10
2omx_A462 Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX 2e-10
2omt_A462 Crystal Structure Of Inla G194s+sHEC1 COMPLEX Lengt 3e-10
2omu_A462 Crystal Structure Of Inla G194s+s Y369s/hec1 Comple 3e-10
4fmz_A347 Crystal Structure Of An Internalin (Inlf) From List 5e-08
1ziw_A680 Human Toll-Like Receptor 3 Extracellular Domain Str 2e-04
2a0z_A705 The Molecular Structure Of Toll-like Receptor 3 Lig 2e-04
3ulu_A694 Structure Of Quaternary Complex Of Human Tlr3ecd Wi 2e-04
4aw4_A311 Engineered Variant Of Listeria Monocytogenes Inlb I 6e-04
3cig_A697 Crystal Structure Of Mouse Tlr3 Ectodomain Length = 8e-04
2id5_A477 Crystal Structure Of The Lingo-1 Ectodomain Length 9e-04
>pdb|2OMY|A Chain A, Crystal Structure Of Inla S192n/hec1 Complex Length = 461 Back     alignment and structure

Iteration: 1

Score = 66.2 bits (160), Expect = 4e-11, Method: Compositional matrix adjust. Identities = 86/264 (32%), Positives = 129/264 (48%), Gaps = 31/264 (11%) Query: 87 QISDGGLEHLRGLSNLTSLSFRRNNAITAQGMKAFAGLINLVKLDLERCTRIHGGLVNLK 146 QI+D + L L+NLT L+ NN IT + L NL +L+L T + L Sbjct: 96 QIAD--ITPLANLTNLTGLTLF-NNQIT--DIDPLKNLTNLNRLELSSNTI--SDISALS 148 Query: 147 GLMKLESLNIKWCNCITDSDMKPLSGLTNLKSLQISCSKVTDSGIAYXXXXXXXXXXXXE 206 GL L+ LN + N +TD +KPL+ LT L+ L IS +KV+D + E Sbjct: 149 GLTSLQQLN--FGNQVTD--LKPLANLTTLERLDISSNKVSDISV-------LAKLTNLE 197 Query: 207 GCPVTAACLDSLSALG---SLFYLNLNRCQLSDDGCEKFSKIGSLKVLNLGFNEITDECL 263 T + ++ LG +L L+LN QL D G + + +L L+L N+I++ L Sbjct: 198 SLIATNNQISDITPLGILTNLDELSLNGNQLKDIGT--LASLTNLTDLDLANNQISN--L 253 Query: 264 VHLKGLTNLESLNLDSCGIGDEGLVNLTGLCNLKCLELSDTQVGSSGLRHLSGLTNLESI 323 L GLT L L L + I + + L GL L LEL++ Q+ + +S L NL + Sbjct: 254 APLSGLTKLTELKLGANQISN--ISPLAGLTALTNLELNENQL--EDISPISNLKNLTYL 309 Query: 324 NLSFTGISDGSLRKLAGLSSLKSL 347 L F ISD + ++ L+ L+ L Sbjct: 310 TLYFNNISD--ISPVSSLTKLQRL 331
>pdb|2OMV|A Chain A, Crystal Structure Of Inla S192n Y369s/hec1 Complex Length = 461 Back     alignment and structure
>pdb|1O6S|A Chain A, Internalin (Listeria Monocytogenes) E-Cadherin (Human) Recognition Complex Length = 466 Back     alignment and structure
>pdb|2OMZ|A Chain A, Crystal Structure Of Inla Y369a/hec1 Complex Length = 466 Back     alignment and structure
>pdb|2OMX|A Chain A, Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMT|A Chain A, Crystal Structure Of Inla G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMU|A Chain A, Crystal Structure Of Inla G194s+s Y369s/hec1 Complex Length = 462 Back     alignment and structure
>pdb|4FMZ|A Chain A, Crystal Structure Of An Internalin (Inlf) From Listeria Monocytogenes Str. 4b F2365 At 1.91 A Resolution Length = 347 Back     alignment and structure
>pdb|1ZIW|A Chain A, Human Toll-Like Receptor 3 Extracellular Domain Structure Length = 680 Back     alignment and structure
>pdb|2A0Z|A Chain A, The Molecular Structure Of Toll-like Receptor 3 Ligand Binding Domain Length = 705 Back     alignment and structure
>pdb|3ULU|A Chain A, Structure Of Quaternary Complex Of Human Tlr3ecd With Three Fabs (Form1) Length = 694 Back     alignment and structure
>pdb|4AW4|A Chain A, Engineered Variant Of Listeria Monocytogenes Inlb Internalin Domain With An Additional Leucine Rich Repeat Inserted Length = 311 Back     alignment and structure
>pdb|3CIG|A Chain A, Crystal Structure Of Mouse Tlr3 Ectodomain Length = 697 Back     alignment and structure
>pdb|2ID5|A Chain A, Crystal Structure Of The Lingo-1 Ectodomain Length = 477 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query497
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 3e-52
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 5e-32
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 3e-13
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 3e-51
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 1e-35
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 3e-30
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-27
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 3e-25
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-47
1o6v_A466 Internalin A; bacterial infection, extracellular r 7e-42
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-41
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-41
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-40
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-38
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-37
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-36
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-36
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-35
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 6e-36
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-32
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-24
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-24
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 6e-17
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-33
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 8e-27
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-25
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-32
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-31
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 5e-31
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-29
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-24
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-17
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-32
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 9e-30
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-23
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-07
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-31
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-29
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-27
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-25
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-16
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-15
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-14
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-10
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-30
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-30
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-23
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-21
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-20
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-28
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-27
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-26
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-17
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-13
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-11
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-11
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-28
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-23
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-20
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-15
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-11
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 2e-27
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 1e-26
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 2e-26
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 7e-26
2ast_B 336 S-phase kinase-associated protein 2; SCF-substrate 1e-05
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 5e-27
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 6e-24
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 7e-16
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 3e-08
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 1e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 7e-27
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-25
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-23
4ezg_A197 Putative uncharacterized protein; internalin-A, le 7e-19
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-14
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-10
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-26
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-24
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-24
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-22
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-20
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-11
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-25
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-22
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-18
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-16
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-25
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-24
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-19
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-12
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 7e-24
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 1e-22
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 1e-16
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 9e-11
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-22
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 4e-18
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-22
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-21
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 9e-16
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-09
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-22
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 8e-14
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 1e-10
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-21
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 5e-21
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 7e-16
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-21
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-20
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 9e-17
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-11
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-21
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 7e-16
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 3e-13
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 3e-06
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-21
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-20
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-17
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-21
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-19
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-18
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-15
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-07
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-20
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-19
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-17
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-15
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 5e-14
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-12
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-10
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-20
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-19
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-19
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-18
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-14
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-06
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 5e-20
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-17
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-16
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-15
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 5e-14
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 2e-12
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 9e-20
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-19
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-18
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-13
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-10
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 3e-19
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 7e-16
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 4e-15
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 9e-15
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 2e-13
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 8e-13
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 8e-13
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 8e-18
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-16
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-13
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 9e-18
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-13
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-12
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-08
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-05
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 7e-04
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-17
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-17
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-15
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-13
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-12
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-09
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-17
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 9e-16
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 6e-12
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-11
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-04
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 7e-17
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-16
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-15
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 4e-08
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-16
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-15
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-15
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-13
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-11
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-16
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-14
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 8e-14
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-13
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-13
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 1e-15
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-11
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-11
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-10
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-12
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-10
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 8e-04
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-12
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 9e-12
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-07
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-12
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-10
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-06
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-05
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-05
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-11
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-10
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 7e-08
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-06
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 8e-06
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-11
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-11
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 5e-11
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 8e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 4e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 5e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 8e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-10
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-06
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 5e-10
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 5e-10
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-08
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-09
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 4e-09
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 6e-08
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 7e-08
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 5e-07
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 1e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-08
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-08
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 9e-08
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-07
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-08
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-06
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-06
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 7e-06
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-05
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-08
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-07
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-07
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-08
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-04
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-07
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 8e-05
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-07
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-06
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-06
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-07
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-07
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-07
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 6e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 9e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-05
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-04
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 1e-04
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 3e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-04
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 6e-04
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-04
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-04
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
 Score =  185 bits (472), Expect = 3e-52
 Identities = 103/504 (20%), Positives = 182/504 (36%), Gaps = 82/504 (16%)

Query: 24  SLEAFRDCALQYPGVNDKWMDVIASQGSSLLSVDLSGSDVTDSGLIHL-KDCSNLQSLDF 82
               F      + G    W++ ++S  + L  + L    VTD  L  + K   N + L  
Sbjct: 78  HFADFNLVPDGWGGYVYPWIEAMSSSYTWLEEIRLKRMVVTDDCLELIAKSFKNFKVLVL 137

Query: 83  NFCIQISDGGLEHLRGLSNLTSLSFRRNNAITAQGMKAFAGLINLVKLDLERCTRIHGGL 142
           + C   S  GL  +                         A   NL +LDL          
Sbjct: 138 SSCEGFSTDGLAAI------------------------AATCRNLKELDLRESDVDDVSG 173

Query: 143 VNL----KGLMKLESLNIKWCNC-ITDSDMKPL-SGLTNLKSLQISCSKVTDSGIAYLKG 196
             L         L SLNI      ++ S ++ L +   NLKSL+++ +   +     L+ 
Sbjct: 174 HWLSHFPDTYTSLVSLNISCLASEVSFSALERLVTRCPNLKSLKLNRAVPLEKLATLLQR 233

Query: 197 LQKLTLLNLEGCPVTAACLDSLSALGSLFYLNLNRCQLSDDGCEKFSKIGSLKVLNLGFN 256
             +L  L   G        +    + S   + L+ C+              L+ L+ GF 
Sbjct: 234 APQLEELGTGGY-----TAEVRPDVYSGLSVALSGCK-------------ELRCLS-GFW 274

Query: 257 EITDECLVHL-KGLTNLESLNLDSCGIGDEGLVNLTGLC-NLKCLELSDTQVGSSGLRHL 314
           +     L  +    + L +LNL    +    LV L   C  L+ L + D  +  +GL  L
Sbjct: 275 DAVPAYLPAVYSVCSRLTTLNLSYATVQSYDLVKLLCQCPKLQRLWVLD-YIEDAGLEVL 333

Query: 315 -SGLTNLESINLS---------FTGISDGSLRKLA-GLSSLKSLNLDARQITDTGLAAL- 362
            S   +L  + +             +++  L  ++ G   L+S+    RQ+T+  L  + 
Sbjct: 334 ASTCKDLRELRVFPSEPFVMEPNVALTEQGLVSVSMGCPKLESVLYFCRQMTNAALITIA 393

Query: 363 TSLTGLTHLDLFG----------ARITDSGAAYL-RNFKNLRSLEICGGGLTDAGVKHI- 410
            +   +T   L                D G   +  + K+LR L +  G LTD   ++I 
Sbjct: 394 RNRPNMTRFRLCIIEPKAPDYLTLEPLDIGFGAIVEHCKDLRRLSLS-GLLTDKVFEYIG 452

Query: 411 KDLSSLTLLNLSQNCNLTDKTLE-LISGLTGLVSLNVSNSRITSAGLR-HLKPLKNLRSL 468
                + +L+++     +D  +  ++SG   L  L + +       L  +   L+ +RSL
Sbjct: 453 TYAKKMEMLSVA-FAGDSDLGMHHVLSGCDSLRKLEIRDCPFGDKALLANASKLETMRSL 511

Query: 469 TLESCKVTANDIKRLQSRDLPNLV 492
            + SC V+    K L  + +P L 
Sbjct: 512 WMSSCSVSFGACKLLGQK-MPKLN 534


>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Length = 197 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query497
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.98
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.98
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.98
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.97
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.97
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.97
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.97
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.97
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.96
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.96
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.96
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.96
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.96
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.96
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.96
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.94
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.94
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.94
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.94
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.93
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.93
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.93
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.93
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.92
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.91
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.9
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.9
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.89
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.89
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.89
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.89
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.89
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.89
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.89
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.89
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.89
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.89
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.88
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.88
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.88
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.87
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.86
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.86
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.86
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.85
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.85
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.85
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.85
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.84
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.82
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.81
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.81
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.8
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.8
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.8
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.79
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.78
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.78
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.77
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.76
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.75
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.75
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.73
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.72
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.69
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.67
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.67
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.64
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.63
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.63
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.61
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.6
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.59
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.59
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.59
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.58
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.58
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.57
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.56
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.56
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.56
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.56
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.56
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.55
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.54
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.54
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.53
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.53
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.53
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.51
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.49
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.48
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.46
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.44
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.44
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.42
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.39
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.39
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.37
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.37
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.37
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.37
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.37
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.34
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.31
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.3
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 99.26
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.26
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.25
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.25
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.23
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.22
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.2
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 99.11
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 99.07
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.07
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.07
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 99.05
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.03
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.03
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 99.02
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.0
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.95
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.95
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 98.73
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.69
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.69
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 98.63
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 98.23
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 98.2
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.13
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.05
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 94.18
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 93.41
1fs1_A53 SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L 83.45
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=4.9e-46  Score=384.66  Aligned_cols=421  Identities=21%  Similarity=0.201  Sum_probs=192.4

Q ss_pred             hcCCceeEEEeeCCCCChHHHHHhcCCCCcCEEEccCccccChhHHHHhhCCCCCCEEEcCCCCCCChHHHHHHhCCCCC
Q 010952           48 SQGSSLLSVDLSGSDVTDSGLIHLKDCSNLQSLDFNFCIQISDGGLEHLRGLSNLTSLSFRRNNAITAQGMKAFAGLINL  127 (497)
Q Consensus        48 ~~~~~l~~L~l~~~~~~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~l~~l~~L  127 (497)
                      ..+++|++|+++++.+.+..+  +..+++|++|++++| .+....+. ++.+++|++|++++|. +....|..++++++|
T Consensus       175 ~~l~~L~~L~Ls~n~l~~~~~--~~~l~~L~~L~Ls~n-~l~~~~~~-l~~l~~L~~L~Ls~n~-l~~~~~~~l~~l~~L  249 (768)
T 3rgz_A          175 DGCGELKHLAISGNKISGDVD--VSRCVNLEFLDVSSN-NFSTGIPF-LGDCSALQHLDISGNK-LSGDFSRAISTCTEL  249 (768)
T ss_dssp             TCCTTCCEEECCSSEEESCCB--CTTCTTCCEEECCSS-CCCSCCCB-CTTCCSCCEEECCSSC-CCSCHHHHTTTCSSC
T ss_pred             ccCCCCCEEECCCCcccccCC--cccCCcCCEEECcCC-cCCCCCcc-cccCCCCCEEECcCCc-CCCcccHHHhcCCCC
Confidence            446666666666665543221  255666666666665 34332222 5566666666666665 344556666666666


Q ss_pred             CEEeccCccccccccccccCCCCCCEEeccCCC------------------------CCCccccccccCCCCCCEEEeec
Q 010952          128 VKLDLERCTRIHGGLVNLKGLMKLESLNIKWCN------------------------CITDSDMKPLSGLTNLKSLQISC  183 (497)
Q Consensus       128 ~~L~l~~~~~~~~~~~~~~~l~~L~~L~l~~~~------------------------~~~~~~~~~l~~l~~L~~L~l~~  183 (497)
                      ++|++++|......+. . .+++|++|++++|.                        .+.+..+..+..+++|++|++++
T Consensus       250 ~~L~Ls~n~l~~~~~~-~-~l~~L~~L~L~~n~l~~~ip~~~~~~~~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~L~~  327 (768)
T 3rgz_A          250 KLLNISSNQFVGPIPP-L-PLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSS  327 (768)
T ss_dssp             CEEECCSSCCEESCCC-C-CCTTCCEEECCSSEEEESCCCCSCTTCTTCSEEECCSSEEEECCCGGGGGCTTCCEEECCS
T ss_pred             CEEECCCCcccCccCc-c-ccCCCCEEECcCCccCCccCHHHHhhcCcCCEEECcCCcCCCccchHHhcCCCccEEECCC
Confidence            6666666532211111 1 34444444444432                        12222333444444444444444


Q ss_pred             cccCchhHH-hhhcCCCCcEEEccCCCCChHHHHHhhCCC-CCcEE--------------------------EcCCCCCC
Q 010952          184 SKVTDSGIA-YLKGLQKLTLLNLEGCPVTAACLDSLSALG-SLFYL--------------------------NLNRCQLS  235 (497)
Q Consensus       184 ~~~~~~~~~-~l~~l~~L~~L~l~~~~~~~~~~~~l~~l~-~L~~L--------------------------~l~~~~~~  235 (497)
                      |.+.+..+. .+.++++|++|++++|.+.+..+..+..++ +|+.|                          ++++|.+.
T Consensus       328 n~l~~~ip~~~l~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~~L~~L~Ls~N~l~~~~~~~~~~~~~~~L~~L~L~~n~l~  407 (768)
T 3rgz_A          328 NNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFT  407 (768)
T ss_dssp             SEEEEECCHHHHTTCTTCCEEECCSSEEEECCCTTHHHHTTTCSEEECCSSEEEEECCTTTTCSTTCCCCEEECCSSEEE
T ss_pred             CcccCcCCHHHHhcCCCCCEEeCcCCccCccccHHHHhhhcCCcEEEccCCCcCCCcChhhhhcccCCccEEECCCCccc
Confidence            444422222 244444444444444443322222222222 23333                          33333222


Q ss_pred             hhHhHhhhcCCCCCEEEccCCCCChhHHHHhhCCCCcCEEeCCCCCCCHhHHHHHhCCCCCCEeeccCcccchHHHHhhc
Q 010952          236 DDGCEKFSKIGSLKVLNLGFNEITDECLVHLKGLTNLESLNLDSCGIGDEGLVNLTGLCNLKCLELSDTQVGSSGLRHLS  315 (497)
Q Consensus       236 ~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~l~~~~~L~~L~l~~~~l~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~l~  315 (497)
                      +..+..++.+++|+.|++++|.+.+..+..+..+++|+.|++++|.+.+..+..+..+++|++|++++|.+....+..+.
T Consensus       408 ~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~  487 (768)
T 3rgz_A          408 GKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLS  487 (768)
T ss_dssp             EECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGG
T ss_pred             cccCHHHhcCCCCCEEECcCCcccCcccHHHhcCCCCCEEECCCCcccCcCCHHHcCCCCceEEEecCCcccCcCCHHHh
Confidence            22233333444444444444433333333334444444444444444333333344444444444444444433334444


Q ss_pred             CCCCCCEEeccCCCCChHHHHHhcCCCCCcEEEcCCCCCCHhHHHHhcCCCCCcEEEecCCCcChHHHHHh---------
Q 010952          316 GLTNLESINLSFTGISDGSLRKLAGLSSLKSLNLDARQITDTGLAALTSLTGLTHLDLFGARITDSGAAYL---------  386 (497)
Q Consensus       316 ~~~~L~~L~l~~~~~~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~l---------  386 (497)
                      .+++|++|++++|.+....+..+..+++|+.|++++|.++...+..+..+++|+.|++++|.+.+..|..+         
T Consensus       488 ~l~~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~g~ip~~~~~~~~~~~~  567 (768)
T 3rgz_A          488 NCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAA  567 (768)
T ss_dssp             GCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEEECCGGGGGCTTCCEEECCSSEEESBCCGGGGTTTTCBCC
T ss_pred             cCCCCCEEEccCCccCCcCChHHhcCCCCCEEECCCCcccCcCCHHHcCCCCCCEEECCCCccCCcCChHHhcccchhhh
Confidence            44444444444444444344444444445555554444443333444444555555554444332222111         


Q ss_pred             -------------------------------------------------------------hccCCCCeeeecCCCCChh
Q 010952          387 -------------------------------------------------------------RNFKNLRSLEICGGGLTDA  405 (497)
Q Consensus       387 -------------------------------------------------------------~~~~~L~~L~l~~~~l~~~  405 (497)
                                                                                   ..+++|+.|++++|.+++.
T Consensus       568 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~~~~g~~~~~~~~l~~L~~LdLs~N~l~g~  647 (768)
T 3rgz_A          568 NFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGY  647 (768)
T ss_dssp             STTCSCEEEEEECCSCCTTCCSSEEEEECTTCCGGGGGGGGGTCCSCTTSCEEEEECCCSCSSSBCCCEEECCSSCCBSC
T ss_pred             hccccccccccccccccccccccccccccccccchhhhccccccccccccceecccCchhhhccccccEEECcCCccccc
Confidence                                                                         1123444555555555544


Q ss_pred             hHHhhhhcCCCCeecccCCCCCChhHHHHhhcCCCCcEEEeeCCccChhHHHhhcCCcccceeecccCCCC
Q 010952          406 GVKHIKDLSSLTLLNLSQNCNLTDKTLELISGLTGLVSLNVSNSRITSAGLRHLKPLKNLRSLTLESCKVT  476 (497)
Q Consensus       406 ~~~~~~~l~~L~~L~l~~~~~l~~~~~~~l~~~~~L~~L~l~~~~l~~~~~~~l~~~~~L~~L~l~~~~~~  476 (497)
                      .+..++.+++|+.|+|++| .+++.+|..++++++|+.|++++|++++.++..+..+++|+.|++++|+++
T Consensus       648 ip~~l~~l~~L~~L~Ls~N-~l~g~ip~~l~~L~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~ls~N~l~  717 (768)
T 3rgz_A          648 IPKEIGSMPYLFILNLGHN-DISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLS  717 (768)
T ss_dssp             CCGGGGGCTTCCEEECCSS-CCCSCCCGGGGGCTTCCEEECCSSCCEECCCGGGGGCCCCSEEECCSSEEE
T ss_pred             CCHHHhccccCCEEeCcCC-ccCCCCChHHhCCCCCCEEECCCCcccCcCChHHhCCCCCCEEECcCCccc
Confidence            4445555555555555555 455445555555555555555555555555555555555555555555443



>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 497
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 6e-14
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-09
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.001
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.001
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-10
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-08
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-08
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 7e-08
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-07
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-07
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 8e-07
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 9e-07
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.003
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 6e-09
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 9e-09
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 5e-07
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-06
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-06
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 7e-09
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-08
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-07
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-05
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-05
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 6e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 6e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 8e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 3e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 3e-06
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 5e-05
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 2e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.004
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 1e-04
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 0.001
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 2e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.003
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.002
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
 Score = 71.2 bits (173), Expect = 6e-14
 Identities = 82/386 (21%), Positives = 144/386 (37%), Gaps = 36/386 (9%)

Query: 51  SSLLSVDLSGSDVTDSGLIHLKDCSNLQSLDFNFCIQISDGGLEHLRGLSNLTSLSFRRN 110
           +  +   L  ++VTD   +   D   + +L  +    I    ++ +  L+NLT ++F  N
Sbjct: 22  AEKMKTVLGKTNVTD--TVSQTDLDQVTTLQADRL-GIKS--IDGVEYLNNLTQINFSNN 76

Query: 111 NAITAQGMKAFAGLINLVKLDLERCTRIHGGLVNLKGLMKLESLNIKWCNCITDSDMKPL 170
                  +     L  LV + +          +     +   +L       I        
Sbjct: 77  QL---TDITPLKNLTKLVDILMNNNQIADITPLANLTNLTGLTLFNNQITDIDPLKNLTN 133

Query: 171 SGLTNLKSLQISCSKVTDSGIAYL-----------KGLQKLTLLNLEGCPV-TAACLDSL 218
                L S  IS         +             K L  LT L          + +  L
Sbjct: 134 LNRLELSSNTISDISALSGLTSLQQLSFGNQVTDLKPLANLTTLERLDISSNKVSDISVL 193

Query: 219 SALGSLFYLNLNRCQLSDDGCEKFSKIGSLKVLNLGFNEITDECLVHLKGLTNLESLNLD 278
           + L +L  L     Q+S         + +L  L+L  N++ D  +  L  LTNL  L+L 
Sbjct: 194 AKLTNLESLIATNNQIS--DITPLGILTNLDELSLNGNQLKD--IGTLASLTNLTDLDLA 249

Query: 279 SCGIGDEGLVNLTGLCNLKCLELSDTQVGSSGLRHLSGLTNLESINLSFTGISDGSLRKL 338
           +  I    L  L+GL  L  L+L   Q+  S +  L+GLT L ++ L+   + D S    
Sbjct: 250 NNQI--SNLAPLSGLTKLTELKLGANQI--SNISPLAGLTALTNLELNENQLEDISPIS- 304

Query: 339 AGLSSLKSLNLDARQITDTGLAALTSLTGLTHLDLFGARITDSGAAYLRNFKNLRSLEIC 398
             L +L  L L    I+   ++ ++SLT L  L     +++D  +  L N  N+  L   
Sbjct: 305 -NLKNLTYLTLYFNNIS--DISPVSSLTKLQRLFFANNKVSDVSS--LANLTNINWLSAG 359

Query: 399 GGGLTDAGVKHIKDLSSLTLLNLSQN 424
              ++   +  + +L+ +T L L+  
Sbjct: 360 HNQIS--DLTPLANLTRITQLGLNDQ 383


>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query497
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.92
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.9
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.9
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.89
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.85
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.84
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.84
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.82
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.82
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.8
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.79
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.77
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.71
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.7
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.69
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.66
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.65
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.64
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.57
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.57
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.56
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.53
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.49
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.46
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.43
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.4
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.38
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.38
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.32
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.3
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.25
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.22
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.16
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.09
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.88
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.74
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.43
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.34
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 98.24
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.23
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 98.21
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.11
d1fs1a141 Skp2 {Human (Homo sapiens) [TaxId: 9606]} 92.14
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
Probab=99.92  E-value=3.8e-23  Score=194.70  Aligned_cols=191  Identities=30%  Similarity=0.438  Sum_probs=98.2

Q ss_pred             hhcCCCCCEEEccCCCCChhHHHHhhCCCCcCEEeCCCCCCCHhHHHHHhCCCCCCEeeccCcccchHHHHhhcCCCCCC
Q 010952          242 FSKIGSLKVLNLGFNEITDECLVHLKGLTNLESLNLDSCGIGDEGLVNLTGLCNLKCLELSDTQVGSSGLRHLSGLTNLE  321 (497)
Q Consensus       242 l~~l~~L~~L~l~~~~~~~~~~~~l~~~~~L~~L~l~~~~l~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~l~~~~~L~  321 (497)
                      +..+++++.++++++.+....+  ...+++|+.++++++.+....  .+..+++|+.++++++.+...            
T Consensus       193 ~~~l~~~~~l~l~~n~i~~~~~--~~~~~~L~~L~l~~n~l~~~~--~l~~l~~L~~L~l~~n~l~~~------------  256 (384)
T d2omza2         193 LAKLTNLESLIATNNQISDITP--LGILTNLDELSLNGNQLKDIG--TLASLTNLTDLDLANNQISNL------------  256 (384)
T ss_dssp             GGGCTTCSEEECCSSCCCCCGG--GGGCTTCCEEECCSSCCCCCG--GGGGCTTCSEEECCSSCCCCC------------
T ss_pred             cccccccceeeccCCccCCCCc--ccccCCCCEEECCCCCCCCcc--hhhcccccchhccccCccCCC------------
Confidence            3445555555555555443221  233455555555555443321  233444455555544443322            


Q ss_pred             EEeccCCCCChHHHHHhcCCCCCcEEEcCCCCCCHhHHHHhcCCCCCcEEEecCCCcChHHHHHhhccCCCCeeeecCCC
Q 010952          322 SINLSFTGISDGSLRKLAGLSSLKSLNLDARQITDTGLAALTSLTGLTHLDLFGARITDSGAAYLRNFKNLRSLEICGGG  401 (497)
Q Consensus       322 ~L~l~~~~~~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~l~~~~~L~~L~l~~~~  401 (497)
                                  .  .+..+++|+.++++++.+...  ..+..++.++.+.+..|.+.+.  ..+..+++++.|++++|.
T Consensus       257 ------------~--~~~~~~~L~~L~l~~~~l~~~--~~~~~~~~l~~l~~~~n~l~~~--~~~~~~~~l~~L~ls~n~  318 (384)
T d2omza2         257 ------------A--PLSGLTKLTELKLGANQISNI--SPLAGLTALTNLELNENQLEDI--SPISNLKNLTYLTLYFNN  318 (384)
T ss_dssp             ------------G--GGTTCTTCSEEECCSSCCCCC--GGGTTCTTCSEEECCSSCCSCC--GGGGGCTTCSEEECCSSC
T ss_pred             ------------C--cccccccCCEeeccCcccCCC--Cccccccccccccccccccccc--cccchhcccCeEECCCCC
Confidence                        1  133344444444444444432  1234455555555555554432  224455666666666666


Q ss_pred             CChhhHHhhhhcCCCCeecccCCCCCChhHHHHhhcCCCCcEEEeeCCccChhHHHhhcCCcccceeecccC
Q 010952          402 LTDAGVKHIKDLSSLTLLNLSQNCNLTDKTLELISGLTGLVSLNVSNSRITSAGLRHLKPLKNLRSLTLESC  473 (497)
Q Consensus       402 l~~~~~~~~~~l~~L~~L~l~~~~~l~~~~~~~l~~~~~L~~L~l~~~~l~~~~~~~l~~~~~L~~L~l~~~  473 (497)
                      +.+..  .+..+++|++|++++| .+++.  ..++++++|++|++++|++++..  .+..+++|++|++++|
T Consensus       319 l~~l~--~l~~l~~L~~L~L~~n-~l~~l--~~l~~l~~L~~L~l~~N~l~~l~--~l~~l~~L~~L~L~~N  383 (384)
T d2omza2         319 ISDIS--PVSSLTKLQRLFFANN-KVSDV--SSLANLTNINWLSAGHNQISDLT--PLANLTRITQLGLNDQ  383 (384)
T ss_dssp             CSCCG--GGGGCTTCCEEECCSS-CCCCC--GGGGGCTTCCEEECCSSCCCBCG--GGTTCTTCSEEECCCE
T ss_pred             CCCCc--ccccCCCCCEEECCCC-CCCCC--hhHcCCCCCCEEECCCCcCCCCh--hhccCCCCCEeeCCCC
Confidence            65542  2455666666666666 55542  24566667777777766666543  2566677777777665



>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure