Citrus Sinensis ID: 011043
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 495 | ||||||
| 356529781 | 492 | PREDICTED: sucrose nonfermenting 4-like | 0.989 | 0.995 | 0.804 | 0.0 | |
| 356556126 | 491 | PREDICTED: sucrose nonfermenting 4-like | 0.989 | 0.997 | 0.795 | 0.0 | |
| 449450664 | 491 | PREDICTED: sucrose nonfermenting 4-like | 0.989 | 0.997 | 0.796 | 0.0 | |
| 225432326 | 491 | PREDICTED: sucrose nonfermenting 4-like | 0.989 | 0.997 | 0.794 | 0.0 | |
| 224123196 | 464 | predicted protein [Populus trichocarpa] | 0.937 | 1.0 | 0.788 | 0.0 | |
| 225450904 | 488 | PREDICTED: sucrose nonfermenting 4-like | 0.981 | 0.995 | 0.754 | 0.0 | |
| 356563906 | 482 | PREDICTED: sucrose nonfermenting 4-like | 0.965 | 0.991 | 0.747 | 0.0 | |
| 356519984 | 480 | PREDICTED: sucrose nonfermenting 4-like | 0.963 | 0.993 | 0.755 | 0.0 | |
| 359487759 | 482 | PREDICTED: sucrose nonfermenting 4-like | 0.969 | 0.995 | 0.747 | 0.0 | |
| 224107351 | 447 | predicted protein [Populus trichocarpa] | 0.903 | 1.0 | 0.767 | 0.0 |
| >gi|356529781|ref|XP_003533466.1| PREDICTED: sucrose nonfermenting 4-like protein-like [Glycine max] | Back alignment and taxonomy information |
|---|
Score = 837 bits (2162), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 395/491 (80%), Positives = 445/491 (90%), Gaps = 1/491 (0%)
Query: 6 MFNPGMDAAREPAS-VPDTVLIPMRFVWPYGGRSVFLSGSFNRWSELLPMSPVEGCPTVF 64
MF MD+AR+ A V TVLIPMRFVWPYGGRSVFLSGSF RW ELLPMSPVEGCPTVF
Sbjct: 1 MFGQSMDSARDAAGGVAGTVLIPMRFVWPYGGRSVFLSGSFTRWLELLPMSPVEGCPTVF 60
Query: 65 QIIWSIPPGYHQYKFCVDGEWRHDEHQPFISSEYGIVNTVLLATEPNFMHGINQGMPSGS 124
Q+I+++PPGYHQYKF VDGEWRHDEHQP++ EYGIVNTVLLAT+PN+M + + SG+
Sbjct: 61 QVIYNLPPGYHQYKFFVDGEWRHDEHQPYVPGEYGIVNTVLLATDPNYMPVLPPDVASGN 120
Query: 125 NMDVDNEAFQRLVQISDGSLTEAAERISEADLQVSRHRVSVFLSTHTAYELLPESGKVVA 184
+MDVDN+AF+R+ +++DG+L+E RIS+ D+Q+SR R+S FLS+HTAYELLPESGKVVA
Sbjct: 121 SMDVDNDAFRRMARLTDGTLSEVLPRISDTDVQISRQRISAFLSSHTAYELLPESGKVVA 180
Query: 185 LDIDLPVKQAFHILYEQGISMAPLWDFSKARFVGVLSASDFILILRELGNHGSNLTEEEL 244
LD+DLPVKQAFHIL+EQG+ MAPLWDF K +FVGVLSASDFILILRELGNHGSNLTEEEL
Sbjct: 181 LDVDLPVKQAFHILHEQGVFMAPLWDFCKGQFVGVLSASDFILILRELGNHGSNLTEEEL 240
Query: 245 ETHTISAWKEGKAYLNRQIDSHGKAFPRPLVYAGPNDNLKDVARKILHNEVATVPIIHSS 304
ETHTISAWKEGK+YLNRQ + HG AF R ++AGP DNLKD+A KIL EV+TVPIIHSS
Sbjct: 241 ETHTISAWKEGKSYLNRQNNGHGTAFSRCFIHAGPYDNLKDIAMKILQKEVSTVPIIHSS 300
Query: 305 SQDGSFPQLLHIASLSGILKCVCRYFRHCSSSLPILKLPICAIPVGTWVPKIGEPNRRPL 364
S+D SFPQLLH+ASLSGILKC+CRYFRHCSSSLP+L+LPICAIPVGTWVPKIGE NRRPL
Sbjct: 301 SEDASFPQLLHLASLSGILKCICRYFRHCSSSLPVLQLPICAIPVGTWVPKIGESNRRPL 360
Query: 365 AMLRPSASLSAALNLLVQAQVSSIPIVDDNDSLLDIYCRSDITALAKDKAYAHINLSEMT 424
AMLRP+ASL++ALNLLVQAQVSSIPIVDDNDSLLDIYCRSDITALAK++AY HINL EMT
Sbjct: 361 AMLRPTASLASALNLLVQAQVSSIPIVDDNDSLLDIYCRSDITALAKNRAYTHINLDEMT 420
Query: 425 IHQALQLGQDSYSPYELRSQRCQMCLPSDTLHKVMERLANPGVRRLVIVEAGSKRVEGIV 484
+HQALQLGQD+YSPYELRSQRCQMCL SD LHKVMERLANPGVRRLVIVEAGSKRVEGIV
Sbjct: 421 VHQALQLGQDAYSPYELRSQRCQMCLRSDPLHKVMERLANPGVRRLVIVEAGSKRVEGIV 480
Query: 485 SLSDIFKFLLG 495
SLSDIFKF +G
Sbjct: 481 SLSDIFKFFIG 491
|
Source: Glycine max Species: Glycine max Genus: Glycine Family: Fabaceae Order: Fabales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|356556126|ref|XP_003546378.1| PREDICTED: sucrose nonfermenting 4-like protein-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449450664|ref|XP_004143082.1| PREDICTED: sucrose nonfermenting 4-like protein-like [Cucumis sativus] gi|449523153|ref|XP_004168589.1| PREDICTED: sucrose nonfermenting 4-like protein-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|225432326|ref|XP_002274373.1| PREDICTED: sucrose nonfermenting 4-like protein [Vitis vinifera] gi|297736884|emb|CBI26085.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224123196|ref|XP_002330362.1| predicted protein [Populus trichocarpa] gi|222871566|gb|EEF08697.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|225450904|ref|XP_002284480.1| PREDICTED: sucrose nonfermenting 4-like protein-like isoform 1 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356563906|ref|XP_003550198.1| PREDICTED: sucrose nonfermenting 4-like protein-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356519984|ref|XP_003528648.1| PREDICTED: sucrose nonfermenting 4-like protein-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|359487759|ref|XP_003633645.1| PREDICTED: sucrose nonfermenting 4-like protein-like isoform 2 [Vitis vinifera] gi|296088362|emb|CBI36807.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224107351|ref|XP_002314455.1| predicted protein [Populus trichocarpa] gi|222863495|gb|EEF00626.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 495 | ||||||
| TAIR|locus:2036079 | 487 | SNF4 "homolog of yeast sucrose | 0.977 | 0.993 | 0.672 | 1.9e-177 | |
| ZFIN|ZDB-GENE-040426-2188 | 330 | prkag1 "protein kinase, AMP-ac | 0.250 | 0.375 | 0.394 | 1.6e-29 | |
| FB|FBgn0264357 | 1400 | SNF4Agamma "SNF4/AMP-activated | 0.284 | 0.100 | 0.344 | 4.1e-28 | |
| RGD|727782 | 326 | Prkag2 "protein kinase, AMP-ac | 0.250 | 0.380 | 0.357 | 1.5e-27 | |
| UNIPROTKB|Q8N7V9 | 340 | PRKAG1 "cDNA FLJ40287 fis, clo | 0.307 | 0.447 | 0.350 | 2.6e-27 | |
| UNIPROTKB|F1NXL4 | 565 | PRKAG2 "Uncharacterized protei | 0.270 | 0.237 | 0.351 | 1.9e-26 | |
| MGI|MGI:1891343 | 489 | Prkag3 "protein kinase, AMP-ac | 0.276 | 0.280 | 0.337 | 2.4e-26 | |
| RGD|1308698 | 493 | Prkag3 "protein kinase, AMP-ac | 0.258 | 0.259 | 0.350 | 3.3e-26 | |
| UNIPROTKB|F1LLY5 | 528 | Prkag2 "Protein Prkag2" [Rattu | 0.250 | 0.234 | 0.357 | 3.9e-26 | |
| MGI|MGI:1336153 | 566 | Prkag2 "protein kinase, AMP-ac | 0.250 | 0.219 | 0.357 | 5.2e-26 |
| TAIR|locus:2036079 SNF4 "homolog of yeast sucrose nonfermenting 4" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1723 (611.6 bits), Expect = 1.9e-177, P = 1.9e-177
Identities = 331/492 (67%), Positives = 389/492 (79%)
Query: 6 MFNPGMDAAREPASVPDTVLIPMRFVWPYGGRSVFLSGSFNRWSELLPMSPVEGCPTVFQ 65
MF +D++R ++ +L P RFVWPYGGR VFLSGSF RW+E +PMSP+EGCPTVFQ
Sbjct: 1 MFGSTLDSSRGNSAASGQLLTPTRFVWPYGGRRVFLSGSFTRWTEHVPMSPLEGCPTVFQ 60
Query: 66 IIWSIPPGYHQYKFCVDGEWRHDEHQPFISSEYGIVNTVLLATEPNFMH-GINQGMPSGS 124
+I ++ PGYHQYKF VDGEWRHDEHQPF+S G+VNT+ + T P+ + G + S
Sbjct: 61 VICNLTPGYHQYKFFVDGEWRHDEHQPFVSGNGGVVNTIFI-TGPDMVPAGFSPETLGRS 119
Query: 125 NMDVDNEAFQRLVQISDGSLTEAAERISEADLQVSRHRVSVFLSTHTAYELLPESGKVVA 184
NMDVD + F R S EA R+S DL++SRHR+SV LST TAYELLPESGKV+A
Sbjct: 120 NMDVD-DVFLRTADPSQ----EAVPRMSGVDLELSRHRISVLLSTRTAYELLPESGKVIA 174
Query: 185 LDIDLPVKQAFHILYEQGISMAPLWDFSKARFVGVLSASDFILILRELGNHGSNLTEEEL 244
LD++LPVKQAFHILYEQGI +APLWDF K +FVGVL DFILILRELG HGSNLTEEEL
Sbjct: 175 LDVNLPVKQAFHILYEQGIPLAPLWDFGKGQFVGVLGPLDFILILRELGTHGSNLTEEEL 234
Query: 245 ETHTISAWKEGKAYLNRQIDSHGKAFPRPLVYAGPNDNLKDVARKILHNEVATVPIIHSS 304
ETHTI+AWKEGKA+++RQ D G+ +PRPLV GP DNLKDVA KIL N+VA VP+I+SS
Sbjct: 235 ETHTIAAWKEGKAHISRQYDGSGRPYPRPLVQVGPYDNLKDVALKILQNKVAAVPVIYSS 294
Query: 305 SQDGSFPQLLHIASLSGILKCVCRYFRHCSSSLPILKLPICAIPVGTWVPKIGEPNRRPL 364
QDGS+PQLLH+ASLSGILKC+CRYFRH SSSLPIL+ PIC+IP+GTWVP+IGE + +PL
Sbjct: 295 LQDGSYPQLLHLASLSGILKCICRYFRHSSSSLPILQQPICSIPLGTWVPRIGESSSKPL 354
Query: 365 AMLRPXXXXXXXXXXXXXXXXXSIPIVDDNDSLLDIYCRSDITALAKDKAYAHINLSEMT 424
A LRP SIP+VDDNDSL+DIY RSDITALAKDKAYA I+L +MT
Sbjct: 355 ATLRPHASLGSALALLVQAEVSSIPVVDDNDSLIDIYSRSDITALAKDKAYAQIHLDDMT 414
Query: 425 IHQALQLGQDSYSPYEL-RSQRCQMCLPSDTLHKVMERLANPGVRRLVIVEAGSKRVEGI 483
+HQALQLGQD+ PY + QRC MCL SD+L KVMERLANPGVRRLVIVEAGSKRVEGI
Sbjct: 415 VHQALQLGQDASPPYGIFNGQRCHMCLRSDSLVKVMERLANPGVRRLVIVEAGSKRVEGI 474
Query: 484 VSLSDIFKFLLG 495
+SLSD+F+FLLG
Sbjct: 475 ISLSDVFQFLLG 486
|
|
| ZFIN|ZDB-GENE-040426-2188 prkag1 "protein kinase, AMP-activated, gamma 1 non-catalytic subunit" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0264357 SNF4Agamma "SNF4/AMP-activated protein kinase gamma subunit" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| RGD|727782 Prkag2 "protein kinase, AMP-activated, gamma 2 non-catalytic subunit" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8N7V9 PRKAG1 "cDNA FLJ40287 fis, clone TESTI2027909, highly similar to 5'-AMP-ACTIVATED PROTEIN KINASE, GAMMA-1 SUBUNIT" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NXL4 PRKAG2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1891343 Prkag3 "protein kinase, AMP-activated, gamma 3 non-catatlytic subunit" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1308698 Prkag3 "protein kinase, AMP-activated, gamma 3 non-catalytic subunit" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1LLY5 Prkag2 "Protein Prkag2" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1336153 Prkag2 "protein kinase, AMP-activated, gamma 2 non-catalytic subunit" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00019790001 | SubName- Full=Chromosome chr5 scaffold_2, whole genome shotgun sequence; (491 aa) | |||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 495 | |||
| cd04641 | 120 | cd04641, CBS_pair_28, The CBS domain, named after | 2e-36 | |
| cd02859 | 80 | cd02859, E_set_AMPKbeta_like_N, N-terminal Early s | 1e-26 | |
| cd04618 | 98 | cd04618, CBS_pair_5, The CBS domain, named after h | 3e-25 | |
| cd02205 | 113 | cd02205, CBS_pair, The CBS domain, named after hum | 7e-11 | |
| cd04622 | 113 | cd04622, CBS_pair_9, The CBS domain, named after h | 2e-07 | |
| cd04642 | 126 | cd04642, CBS_pair_29, The CBS domain, named after | 4e-07 | |
| cd02688 | 82 | cd02688, E_set, Early set domain associated with t | 8e-07 | |
| cd07184 | 86 | cd07184, E_set_Isoamylase_like_N, N-terminal Early | 2e-06 | |
| cd04612 | 111 | cd04612, CBS_pair_SpoIVFB_EriC_assoc, This cd cont | 2e-06 | |
| COG0517 | 117 | COG0517, COG0517, FOG: CBS domain [General functio | 3e-06 | |
| cd04623 | 113 | cd04623, CBS_pair_10, The CBS domain, named after | 4e-06 | |
| smart00116 | 49 | smart00116, CBS, Domain in cystathionine beta-synt | 5e-06 | |
| cd02205 | 113 | cd02205, CBS_pair, The CBS domain, named after hum | 7e-06 | |
| cd04631 | 125 | cd04631, CBS_pair_18, The CBS domain, named after | 1e-05 | |
| cd02205 | 113 | cd02205, CBS_pair, The CBS domain, named after hum | 2e-05 | |
| cd04588 | 110 | cd04588, CBS_pair_CAP-ED_DUF294_assoc_arch, This c | 2e-05 | |
| cd04800 | 111 | cd04800, CBS_pair_CAP-ED_DUF294_PBI_assoc2, This c | 4e-05 | |
| cd04642 | 126 | cd04642, CBS_pair_29, The CBS domain, named after | 5e-05 | |
| cd04638 | 106 | cd04638, CBS_pair_25, The CBS domain, named after | 5e-05 | |
| pfam00571 | 57 | pfam00571, CBS, CBS domain | 6e-05 | |
| cd04803 | 122 | cd04803, CBS_pair_15, The CBS domain, named after | 1e-04 | |
| pfam00571 | 57 | pfam00571, CBS, CBS domain | 2e-04 | |
| pfam00571 | 57 | pfam00571, CBS, CBS domain | 2e-04 | |
| cd04627 | 123 | cd04627, CBS_pair_14, The CBS domain, named after | 3e-04 | |
| cd04630 | 114 | cd04630, CBS_pair_17, The CBS domain, named after | 4e-04 | |
| smart00116 | 49 | smart00116, CBS, Domain in cystathionine beta-synt | 6e-04 | |
| cd04632 | 128 | cd04632, CBS_pair_19, The CBS domain, named after | 6e-04 | |
| cd04612 | 111 | cd04612, CBS_pair_SpoIVFB_EriC_assoc, This cd cont | 8e-04 | |
| cd04611 | 111 | cd04611, CBS_pair_PAS_GGDEF_DUF1_assoc, This cd co | 0.001 | |
| COG2524 | 294 | COG2524, COG2524, Predicted transcriptional regula | 0.001 | |
| cd04631 | 125 | cd04631, CBS_pair_18, The CBS domain, named after | 0.002 | |
| cd04605 | 110 | cd04605, CBS_pair_MET2_assoc, This cd contains two | 0.002 | |
| cd04631 | 125 | cd04631, CBS_pair_18, The CBS domain, named after | 0.003 | |
| cd04595 | 110 | cd04595, CBS_pair_DHH_polyA_Pol_assoc, This cd con | 0.004 |
| >gnl|CDD|240012 cd04641, CBS_pair_28, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
Score = 130 bits (329), Expect = 2e-36
Identities = 48/131 (36%), Positives = 76/131 (58%), Gaps = 11/131 (8%)
Query: 362 RPLAMLRPSASLSAALNLLVQAQVSSIPIVDDNDSLLDIYCRSDITALAKDKAYAHINLS 421
+ +A RP L L++LV+ +VS++PIVD+N ++D+Y R D+ LAK+ AY N
Sbjct: 1 KNIATARPDTPLIDVLDMLVERRVSALPIVDENGKVVDVYSRFDVINLAKEGAY---NNL 57
Query: 422 EMTIHQALQLGQDSYSPYELRSQRCQMCLPSDTLHKVMERLANPGVRRLVIVEAGSKRVE 481
++T+ +AL+ + + C P D L + + + V RLV+V+ KRVE
Sbjct: 58 DLTVGEALERRSQDFE-------GVRTCSPDDCLRTIFDLIVKARVHRLVVVDEN-KRVE 109
Query: 482 GIVSLSDIFKF 492
GI+SLSDI +F
Sbjct: 110 GIISLSDILQF 120
|
CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria. The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic generalized epilepsy, hypercalciuric nephrolithiasis, and classic Bartter syndrome (CLC chloride channel family members), Wolff-Parkinson-White syndrome (gamma 2 subunit of AMP-activated protein kinase), retinitis pigmentosa (IMP dehydrogenase-1), and homocystinuria (cystathionine beta-synthase). Length = 120 |
| >gnl|CDD|199889 cd02859, E_set_AMPKbeta_like_N, N-terminal Early set domain, a glycogen binding domain, associated with the catalytic domain of AMP-activated protein kinase beta subunit | Back alignment and domain information |
|---|
| >gnl|CDD|239990 cd04618, CBS_pair_5, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239067 cd02205, CBS_pair, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239994 cd04622, CBS_pair_9, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240013 cd04642, CBS_pair_29, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|199878 cd02688, E_set, Early set domain associated with the catalytic domain of sugar utilizing enzymes at either the N or C terminus | Back alignment and domain information |
|---|
| >gnl|CDD|199892 cd07184, E_set_Isoamylase_like_N, N-terminal Early set domain associated with the catalytic domain of isoamylase-like (also called glycogen 6-glucanohydrolase) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239985 cd04612, CBS_pair_SpoIVFB_EriC_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC | Back alignment and domain information |
|---|
| >gnl|CDD|223591 COG0517, COG0517, FOG: CBS domain [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|239995 cd04623, CBS_pair_10, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|214522 smart00116, CBS, Domain in cystathionine beta-synthase and other proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239067 cd02205, CBS_pair, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240002 cd04631, CBS_pair_18, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239067 cd02205, CBS_pair, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239961 cd04588, CBS_pair_CAP-ED_DUF294_assoc_arch, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the archaeal CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain | Back alignment and domain information |
|---|
| >gnl|CDD|240113 cd04800, CBS_pair_CAP-ED_DUF294_PBI_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain | Back alignment and domain information |
|---|
| >gnl|CDD|240013 cd04642, CBS_pair_29, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240009 cd04638, CBS_pair_25, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|201313 pfam00571, CBS, CBS domain | Back alignment and domain information |
|---|
| >gnl|CDD|240116 cd04803, CBS_pair_15, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|201313 pfam00571, CBS, CBS domain | Back alignment and domain information |
|---|
| >gnl|CDD|201313 pfam00571, CBS, CBS domain | Back alignment and domain information |
|---|
| >gnl|CDD|239999 cd04627, CBS_pair_14, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240001 cd04630, CBS_pair_17, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|214522 smart00116, CBS, Domain in cystathionine beta-synthase and other proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240003 cd04632, CBS_pair_19, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239985 cd04612, CBS_pair_SpoIVFB_EriC_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC | Back alignment and domain information |
|---|
| >gnl|CDD|239984 cd04611, CBS_pair_PAS_GGDEF_DUF1_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with a PAS domain, a GGDEF (DiGuanylate-Cyclase (DGC) domain, and a DUF1 domain downstream | Back alignment and domain information |
|---|
| >gnl|CDD|225321 COG2524, COG2524, Predicted transcriptional regulator, contains C-terminal CBS domains [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|240002 cd04631, CBS_pair_18, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239978 cd04605, CBS_pair_MET2_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain | Back alignment and domain information |
|---|
| >gnl|CDD|240002 cd04631, CBS_pair_18, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239968 cd04595, CBS_pair_DHH_polyA_Pol_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with an upstream DHH domain which performs a phosphoesterase function and a downstream polyA polymerase domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 495 | |||
| KOG1764 | 381 | consensus 5'-AMP-activated protein kinase, gamma s | 100.0 | |
| cd02859 | 79 | AMPKbeta_GBD_like AMP-activated protein kinase (AM | 99.92 | |
| cd02861 | 82 | E_set_proteins_like E or "early" set-like proteins | 99.76 | |
| COG2524 | 294 | Predicted transcriptional regulator, contains C-te | 99.75 | |
| KOG1616 | 289 | consensus Protein involved in Snf1 protein kinase | 99.69 | |
| COG2524 | 294 | Predicted transcriptional regulator, contains C-te | 99.62 | |
| cd04641 | 120 | CBS_pair_28 The CBS domain, named after human CBS, | 99.6 | |
| COG3448 | 382 | CBS-domain-containing membrane protein [Signal tra | 99.6 | |
| COG3448 | 382 | CBS-domain-containing membrane protein [Signal tra | 99.6 | |
| COG3620 | 187 | Predicted transcriptional regulator with C-termina | 99.56 | |
| cd04618 | 98 | CBS_pair_5 The CBS domain, named after human CBS, | 99.54 | |
| cd04603 | 111 | CBS_pair_KefB_assoc This cd contains two tandem re | 99.53 | |
| cd04619 | 114 | CBS_pair_6 The CBS domain, named after human CBS, | 99.52 | |
| cd04617 | 118 | CBS_pair_4 The CBS domain, named after human CBS, | 99.51 | |
| cd04618 | 98 | CBS_pair_5 The CBS domain, named after human CBS, | 99.5 | |
| PRK10892 | 326 | D-arabinose 5-phosphate isomerase; Provisional | 99.49 | |
| TIGR00400 | 449 | mgtE Mg2+ transporter (mgtE). This family of proka | 99.48 | |
| cd04608 | 124 | CBS_pair_PALP_assoc This cd contains two tandem re | 99.48 | |
| cd04593 | 115 | CBS_pair_EriC_assoc_bac_arch This cd contains two | 99.48 | |
| cd04630 | 114 | CBS_pair_17 The CBS domain, named after human CBS, | 99.48 | |
| KOG1764 | 381 | consensus 5'-AMP-activated protein kinase, gamma s | 99.47 | |
| cd04600 | 124 | CBS_pair_HPP_assoc This cd contains two tandem rep | 99.47 | |
| COG3620 | 187 | Predicted transcriptional regulator with C-termina | 99.45 | |
| cd04614 | 96 | CBS_pair_1 The CBS domain, named after human CBS, | 99.45 | |
| cd04801 | 114 | CBS_pair_M50_like This cd contains two tandem repe | 99.45 | |
| cd04623 | 113 | CBS_pair_10 The CBS domain, named after human CBS, | 99.45 | |
| cd04605 | 110 | CBS_pair_MET2_assoc This cd contains two tandem re | 99.44 | |
| cd04641 | 120 | CBS_pair_28 The CBS domain, named after human CBS, | 99.43 | |
| cd04639 | 111 | CBS_pair_26 The CBS domain, named after human CBS, | 99.43 | |
| PRK11543 | 321 | gutQ D-arabinose 5-phosphate isomerase; Provisiona | 99.43 | |
| cd04627 | 123 | CBS_pair_14 The CBS domain, named after human CBS, | 99.43 | |
| cd04803 | 122 | CBS_pair_15 The CBS domain, named after human CBS, | 99.43 | |
| cd04607 | 113 | CBS_pair_NTP_transferase_assoc This cd contains tw | 99.43 | |
| PRK14869 | 546 | putative manganese-dependent inorganic pyrophospha | 99.43 | |
| cd04631 | 125 | CBS_pair_18 The CBS domain, named after human CBS, | 99.43 | |
| cd04615 | 113 | CBS_pair_2 The CBS domain, named after human CBS, | 99.42 | |
| cd04642 | 126 | CBS_pair_29 The CBS domain, named after human CBS, | 99.42 | |
| PRK15094 | 292 | magnesium/cobalt efflux protein CorC; Provisional | 99.42 | |
| cd04632 | 128 | CBS_pair_19 The CBS domain, named after human CBS, | 99.42 | |
| cd04621 | 135 | CBS_pair_8 The CBS domain, named after human CBS, | 99.41 | |
| cd04624 | 112 | CBS_pair_11 The CBS domain, named after human CBS, | 99.41 | |
| cd04626 | 111 | CBS_pair_13 The CBS domain, named after human CBS, | 99.41 | |
| COG2905 | 610 | Predicted signal-transduction protein containing c | 99.41 | |
| cd04596 | 108 | CBS_pair_DRTGG_assoc This cd contains two tandem r | 99.41 | |
| cd04643 | 116 | CBS_pair_30 The CBS domain, named after human CBS, | 99.41 | |
| cd04629 | 114 | CBS_pair_16 The CBS domain, named after human CBS, | 99.4 | |
| PRK14869 | 546 | putative manganese-dependent inorganic pyrophospha | 99.4 | |
| cd04613 | 114 | CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two | 99.4 | |
| cd04583 | 109 | CBS_pair_ABC_OpuCA_assoc2 This cd contains two tan | 99.4 | |
| cd04635 | 122 | CBS_pair_22 The CBS domain, named after human CBS, | 99.4 | |
| cd04595 | 110 | CBS_pair_DHH_polyA_Pol_assoc This cd contains two | 99.4 | |
| cd04588 | 110 | CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains | 99.4 | |
| cd04586 | 135 | CBS_pair_BON_assoc This cd contains two tandem rep | 99.4 | |
| cd04589 | 111 | CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains | 99.4 | |
| cd04636 | 132 | CBS_pair_23 The CBS domain, named after human CBS, | 99.4 | |
| cd04590 | 111 | CBS_pair_CorC_HlyC_assoc This cd contains two tand | 99.39 | |
| cd04604 | 114 | CBS_pair_KpsF_GutQ_assoc This cd contains two tand | 99.39 | |
| cd04582 | 106 | CBS_pair_ABC_OpuCA_assoc This cd contains two tand | 99.38 | |
| PRK07807 | 479 | inosine 5-monophosphate dehydrogenase; Validated | 99.38 | |
| cd04627 | 123 | CBS_pair_14 The CBS domain, named after human CBS, | 99.38 | |
| cd04800 | 111 | CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains | 99.38 | |
| cd04640 | 126 | CBS_pair_27 The CBS domain, named after human CBS, | 99.38 | |
| PRK05567 | 486 | inosine 5'-monophosphate dehydrogenase; Reviewed | 99.38 | |
| cd04603 | 111 | CBS_pair_KefB_assoc This cd contains two tandem re | 99.37 | |
| cd04620 | 115 | CBS_pair_7 The CBS domain, named after human CBS, | 99.37 | |
| cd04625 | 112 | CBS_pair_12 The CBS domain, named after human CBS, | 99.37 | |
| cd04612 | 111 | CBS_pair_SpoIVFB_EriC_assoc This cd contains two t | 99.36 | |
| cd04619 | 114 | CBS_pair_6 The CBS domain, named after human CBS, | 99.36 | |
| cd04611 | 111 | CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two | 99.36 | |
| cd04587 | 113 | CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains | 99.36 | |
| TIGR03520 | 408 | GldE gliding motility-associated protein GldE. Mem | 99.36 | |
| cd04633 | 121 | CBS_pair_20 The CBS domain, named after human CBS, | 99.35 | |
| cd04602 | 114 | CBS_pair_IMPDH_2 This cd contains two tandem repea | 99.35 | |
| PRK01862 | 574 | putative voltage-gated ClC-type chloride channel C | 99.34 | |
| cd04585 | 122 | CBS_pair_ACT_assoc2 This cd contains two tandem re | 99.34 | |
| cd04617 | 118 | CBS_pair_4 The CBS domain, named after human CBS, | 99.34 | |
| cd04622 | 113 | CBS_pair_9 The CBS domain, named after human CBS, | 99.34 | |
| cd04601 | 110 | CBS_pair_IMPDH This cd contains two tandem repeats | 99.33 | |
| cd04606 | 109 | CBS_pair_Mg_transporter This cd contains two tande | 99.33 | |
| cd04600 | 124 | CBS_pair_HPP_assoc This cd contains two tandem rep | 99.32 | |
| cd04630 | 114 | CBS_pair_17 The CBS domain, named after human CBS, | 99.31 | |
| cd04609 | 110 | CBS_pair_PALP_assoc2 This cd contains two tandem r | 99.31 | |
| cd04637 | 122 | CBS_pair_24 The CBS domain, named after human CBS, | 99.31 | |
| cd02858 | 85 | Esterase_N_term Esterase N-terminal domain. Estera | 99.31 | |
| cd04802 | 112 | CBS_pair_3 The CBS domain, named after human CBS, | 99.31 | |
| cd04584 | 121 | CBS_pair_ACT_assoc This cd contains two tandem rep | 99.31 | |
| PRK07807 | 479 | inosine 5-monophosphate dehydrogenase; Validated | 99.31 | |
| cd04607 | 113 | CBS_pair_NTP_transferase_assoc This cd contains tw | 99.3 | |
| cd04605 | 110 | CBS_pair_MET2_assoc This cd contains two tandem re | 99.3 | |
| cd04599 | 105 | CBS_pair_GGDEF_assoc2 This cd contains two tandem | 99.3 | |
| cd04642 | 126 | CBS_pair_29 The CBS domain, named after human CBS, | 99.29 | |
| cd04624 | 112 | CBS_pair_11 The CBS domain, named after human CBS, | 99.29 | |
| cd02205 | 113 | CBS_pair The CBS domain, named after human CBS, is | 99.29 | |
| cd04623 | 113 | CBS_pair_10 The CBS domain, named after human CBS, | 99.29 | |
| cd04614 | 96 | CBS_pair_1 The CBS domain, named after human CBS, | 99.28 | |
| PLN02274 | 505 | inosine-5'-monophosphate dehydrogenase | 99.28 | |
| cd04594 | 104 | CBS_pair_EriC_assoc_archaea This cd contains two t | 99.28 | |
| TIGR01302 | 450 | IMP_dehydrog inosine-5'-monophosphate dehydrogenas | 99.28 | |
| PRK07107 | 502 | inosine 5-monophosphate dehydrogenase; Validated | 99.28 | |
| cd04610 | 107 | CBS_pair_ParBc_assoc This cd contains two tandem r | 99.27 | |
| cd04608 | 124 | CBS_pair_PALP_assoc This cd contains two tandem re | 99.27 | |
| cd04639 | 111 | CBS_pair_26 The CBS domain, named after human CBS, | 99.27 | |
| PRK11543 | 321 | gutQ D-arabinose 5-phosphate isomerase; Provisiona | 99.27 | |
| COG0517 | 117 | FOG: CBS domain [General function prediction only] | 99.27 | |
| cd04591 | 105 | CBS_pair_EriC_assoc_euk_bac This cd contains two t | 99.26 | |
| cd04643 | 116 | CBS_pair_30 The CBS domain, named after human CBS, | 99.26 | |
| PRK05567 | 486 | inosine 5'-monophosphate dehydrogenase; Reviewed | 99.26 | |
| cd04593 | 115 | CBS_pair_EriC_assoc_bac_arch This cd contains two | 99.25 | |
| cd04582 | 106 | CBS_pair_ABC_OpuCA_assoc This cd contains two tand | 99.25 | |
| PRK10892 | 326 | D-arabinose 5-phosphate isomerase; Provisional | 99.25 | |
| cd04803 | 122 | CBS_pair_15 The CBS domain, named after human CBS, | 99.25 | |
| cd04629 | 114 | CBS_pair_16 The CBS domain, named after human CBS, | 99.24 | |
| cd04631 | 125 | CBS_pair_18 The CBS domain, named after human CBS, | 99.24 | |
| TIGR01303 | 475 | IMP_DH_rel_1 IMP dehydrogenase family protein. Thi | 99.24 | |
| cd04801 | 114 | CBS_pair_M50_like This cd contains two tandem repe | 99.24 | |
| cd04626 | 111 | CBS_pair_13 The CBS domain, named after human CBS, | 99.24 | |
| cd04588 | 110 | CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains | 99.24 | |
| cd04634 | 143 | CBS_pair_21 The CBS domain, named after human CBS, | 99.23 | |
| cd04590 | 111 | CBS_pair_CorC_HlyC_assoc This cd contains two tand | 99.23 | |
| PRK15094 | 292 | magnesium/cobalt efflux protein CorC; Provisional | 99.23 | |
| cd04615 | 113 | CBS_pair_2 The CBS domain, named after human CBS, | 99.23 | |
| cd04583 | 109 | CBS_pair_ABC_OpuCA_assoc2 This cd contains two tan | 99.23 | |
| TIGR00393 | 268 | kpsF KpsF/GutQ family protein. This model describe | 99.23 | |
| TIGR01303 | 475 | IMP_DH_rel_1 IMP dehydrogenase family protein. Thi | 99.22 | |
| cd04620 | 115 | CBS_pair_7 The CBS domain, named after human CBS, | 99.22 | |
| cd04586 | 135 | CBS_pair_BON_assoc This cd contains two tandem rep | 99.22 | |
| cd04611 | 111 | CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two | 99.22 | |
| COG2239 | 451 | MgtE Mg/Co/Ni transporter MgtE (contains CBS domai | 99.22 | |
| cd04596 | 108 | CBS_pair_DRTGG_assoc This cd contains two tandem r | 99.22 | |
| cd04598 | 119 | CBS_pair_GGDEF_assoc This cd contains two tandem r | 99.22 | |
| cd04595 | 110 | CBS_pair_DHH_polyA_Pol_assoc This cd contains two | 99.22 | |
| cd04604 | 114 | CBS_pair_KpsF_GutQ_assoc This cd contains two tand | 99.21 | |
| cd04585 | 122 | CBS_pair_ACT_assoc2 This cd contains two tandem re | 99.21 | |
| cd04636 | 132 | CBS_pair_23 The CBS domain, named after human CBS, | 99.21 | |
| cd04638 | 106 | CBS_pair_25 The CBS domain, named after human CBS, | 99.21 | |
| PTZ00314 | 495 | inosine-5'-monophosphate dehydrogenase; Provisiona | 99.21 | |
| TIGR00400 | 449 | mgtE Mg2+ transporter (mgtE). This family of proka | 99.21 | |
| cd04621 | 135 | CBS_pair_8 The CBS domain, named after human CBS, | 99.21 | |
| cd04587 | 113 | CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains | 99.21 | |
| COG4109 | 432 | Predicted transcriptional regulator containing CBS | 99.2 | |
| COG0517 | 117 | FOG: CBS domain [General function prediction only] | 99.2 | |
| cd04800 | 111 | CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains | 99.2 | |
| cd04633 | 121 | CBS_pair_20 The CBS domain, named after human CBS, | 99.19 | |
| cd04613 | 114 | CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two | 99.19 | |
| cd04612 | 111 | CBS_pair_SpoIVFB_EriC_assoc This cd contains two t | 99.19 | |
| cd04625 | 112 | CBS_pair_12 The CBS domain, named after human CBS, | 99.18 | |
| cd04637 | 122 | CBS_pair_24 The CBS domain, named after human CBS, | 99.18 | |
| cd04622 | 113 | CBS_pair_9 The CBS domain, named after human CBS, | 99.17 | |
| cd04632 | 128 | CBS_pair_19 The CBS domain, named after human CBS, | 99.17 | |
| cd04602 | 114 | CBS_pair_IMPDH_2 This cd contains two tandem repea | 99.17 | |
| COG2905 | 610 | Predicted signal-transduction protein containing c | 99.16 | |
| TIGR03520 | 408 | GldE gliding motility-associated protein GldE. Mem | 99.16 | |
| cd04635 | 122 | CBS_pair_22 The CBS domain, named after human CBS, | 99.16 | |
| cd04589 | 111 | CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains | 99.16 | |
| TIGR01137 | 454 | cysta_beta cystathionine beta-synthase. Members of | 99.16 | |
| cd04640 | 126 | CBS_pair_27 The CBS domain, named after human CBS, | 99.15 | |
| cd04802 | 112 | CBS_pair_3 The CBS domain, named after human CBS, | 99.14 | |
| cd04609 | 110 | CBS_pair_PALP_assoc2 This cd contains two tandem r | 99.13 | |
| PLN02274 | 505 | inosine-5'-monophosphate dehydrogenase | 99.12 | |
| PRK07107 | 502 | inosine 5-monophosphate dehydrogenase; Validated | 99.1 | |
| cd02205 | 113 | CBS_pair The CBS domain, named after human CBS, is | 99.1 | |
| PRK11573 | 413 | hypothetical protein; Provisional | 99.1 | |
| cd04601 | 110 | CBS_pair_IMPDH This cd contains two tandem repeats | 99.1 | |
| cd04592 | 133 | CBS_pair_EriC_assoc_euk This cd contains two tande | 99.1 | |
| cd04599 | 105 | CBS_pair_GGDEF_assoc2 This cd contains two tandem | 99.09 | |
| cd04610 | 107 | CBS_pair_ParBc_assoc This cd contains two tandem r | 99.08 | |
| cd04606 | 109 | CBS_pair_Mg_transporter This cd contains two tande | 99.08 | |
| cd04584 | 121 | CBS_pair_ACT_assoc This cd contains two tandem rep | 99.08 | |
| PRK01862 | 574 | putative voltage-gated ClC-type chloride channel C | 99.07 | |
| cd04594 | 104 | CBS_pair_EriC_assoc_archaea This cd contains two t | 99.07 | |
| TIGR00393 | 268 | kpsF KpsF/GutQ family protein. This model describe | 99.07 | |
| PTZ00314 | 495 | inosine-5'-monophosphate dehydrogenase; Provisiona | 99.07 | |
| cd04634 | 143 | CBS_pair_21 The CBS domain, named after human CBS, | 99.06 | |
| cd04591 | 105 | CBS_pair_EriC_assoc_euk_bac This cd contains two t | 99.04 | |
| TIGR01302 | 450 | IMP_dehydrog inosine-5'-monophosphate dehydrogenas | 99.04 | |
| cd04598 | 119 | CBS_pair_GGDEF_assoc This cd contains two tandem r | 99.0 | |
| COG4109 | 432 | Predicted transcriptional regulator containing CBS | 98.98 | |
| PRK11573 | 413 | hypothetical protein; Provisional | 98.94 | |
| COG1253 | 429 | TlyC Hemolysins and related proteins containing CB | 98.9 | |
| cd04638 | 106 | CBS_pair_25 The CBS domain, named after human CBS, | 98.89 | |
| TIGR01137 | 454 | cysta_beta cystathionine beta-synthase. Members of | 98.89 | |
| PF00571 | 57 | CBS: CBS domain CBS domain web page. Mutations in | 98.86 | |
| COG2239 | 451 | MgtE Mg/Co/Ni transporter MgtE (contains CBS domai | 98.85 | |
| cd04592 | 133 | CBS_pair_EriC_assoc_euk This cd contains two tande | 98.82 | |
| cd02688 | 83 | E_set E or "early" set of sugar utilizing enzymes | 98.79 | |
| PF00571 | 57 | CBS: CBS domain CBS domain web page. Mutations in | 98.78 | |
| TIGR01186 | 363 | proV glycine betaine/L-proline transport ATP bindi | 98.78 | |
| cd02854 | 99 | Glycogen_branching_enzyme_like_N_term Glycogen bra | 98.74 | |
| COG1253 | 429 | TlyC Hemolysins and related proteins containing CB | 98.6 | |
| COG4535 | 293 | CorC Putative Mg2+ and Co2+ transporter CorC [Inor | 98.6 | |
| PRK10070 | 400 | glycine betaine transporter ATP-binding subunit; P | 98.58 | |
| COG4536 | 423 | CorB Putative Mg2+ and Co2+ transporter CorB [Inor | 98.52 | |
| PF02922 | 85 | CBM_48: Carbohydrate-binding module 48 (Isoamylase | 98.49 | |
| KOG0474 | 762 | consensus Cl- channel CLC-7 and related proteins ( | 98.4 | |
| KOG2550 | 503 | consensus IMP dehydrogenase/GMP reductase [Nucleot | 98.34 | |
| KOG2550 | 503 | consensus IMP dehydrogenase/GMP reductase [Nucleot | 98.33 | |
| COG4536 | 423 | CorB Putative Mg2+ and Co2+ transporter CorB [Inor | 98.33 | |
| TIGR01186 | 363 | proV glycine betaine/L-proline transport ATP bindi | 98.3 | |
| COG4535 | 293 | CorC Putative Mg2+ and Co2+ transporter CorC [Inor | 98.18 | |
| PRK10070 | 400 | glycine betaine transporter ATP-binding subunit; P | 98.16 | |
| KOG0474 | 762 | consensus Cl- channel CLC-7 and related proteins ( | 97.88 | |
| cd02860 | 100 | Pullulanase_N_term Pullulanase domain N-terminus. | 97.87 | |
| cd04597 | 113 | CBS_pair_DRTGG_assoc2 This cd contains two tandem | 97.84 | |
| cd02855 | 106 | Glycogen_branching_enzyme_N_term Glycogen branchin | 97.79 | |
| COG0296 | 628 | GlgB 1,4-alpha-glucan branching enzyme [Carbohydra | 97.72 | |
| cd04597 | 113 | CBS_pair_DRTGG_assoc2 This cd contains two tandem | 97.69 | |
| PF00686 | 96 | CBM_20: Starch binding domain; InterPro: IPR002044 | 97.67 | |
| smart00116 | 49 | CBS Domain in cystathionine beta-synthase and othe | 97.65 | |
| cd02856 | 103 | Glycogen_debranching_enzyme_N_term Glycogen_debran | 97.58 | |
| PLN02447 | 758 | 1,4-alpha-glucan-branching enzyme | 97.57 | |
| smart00116 | 49 | CBS Domain in cystathionine beta-synthase and othe | 97.54 | |
| cd05808 | 95 | CBM20_alpha_amylase Alpha-amylase, C-terminal CBM2 | 97.54 | |
| PRK12568 | 730 | glycogen branching enzyme; Provisional | 97.5 | |
| cd05814 | 120 | CBM20_Prei4 Prei4, N-terminal CBM20 (carbohydrate- | 97.48 | |
| PRK12313 | 633 | glycogen branching enzyme; Provisional | 97.35 | |
| KOG0475 | 696 | consensus Cl- channel CLC-3 and related proteins ( | 97.31 | |
| PRK14706 | 639 | glycogen branching enzyme; Provisional | 97.3 | |
| cd05818 | 92 | CBM20_water_dikinase Phosphoglucan water dikinase | 97.29 | |
| cd05809 | 99 | CBM20_beta_amylase Beta-amylase, C-terminal CBM20 | 97.24 | |
| TIGR03415 | 382 | ABC_choXWV_ATP choline ABC transporter, ATP-bindin | 97.22 | |
| PRK14705 | 1224 | glycogen branching enzyme; Provisional | 97.21 | |
| cd05820 | 103 | CBM20_novamyl Novamyl (also known as acarviose tra | 97.17 | |
| cd02852 | 119 | Isoamylase_N_term Isoamylase N-terminus domain. Is | 97.17 | |
| COG4175 | 386 | ProV ABC-type proline/glycine betaine transport sy | 97.16 | |
| cd02853 | 85 | MTHase_N_term Maltooligosyl trehalose synthase (MT | 97.06 | |
| cd05811 | 106 | CBM20_glucoamylase Glucoamylase (glucan1,4-alpha-g | 96.96 | |
| cd05813 | 95 | CBM20_genethonin_1 Genethonin-1, C-terminal CBM20 | 96.94 | |
| PRK05402 | 726 | glycogen branching enzyme; Provisional | 96.85 | |
| KOG0475 | 696 | consensus Cl- channel CLC-3 and related proteins ( | 96.82 | |
| cd05807 | 101 | CBM20_CGTase CGTase, C-terminal CBM20 (carbohydrat | 96.69 | |
| TIGR02402 | 542 | trehalose_TreZ malto-oligosyltrehalose trehalohydr | 96.58 | |
| cd05810 | 97 | CBM20_alpha_MTH Glucan 1,4-alpha-maltotetraohydrol | 96.48 | |
| PRK05402 | 726 | glycogen branching enzyme; Provisional | 96.46 | |
| TIGR01515 | 613 | branching_enzym alpha-1,4-glucan:alpha-1,4-glucan | 96.42 | |
| cd05467 | 96 | CBM20 The family 20 carbohydrate-binding module (C | 96.38 | |
| cd05816 | 99 | CBM20_DPE2_repeat2 Disproportionating enzyme 2 (DP | 96.3 | |
| cd05817 | 100 | CBM20_DSP Dual-specificity phosphatase (DSP), N-te | 96.13 | |
| cd05806 | 112 | CBM20_laforin Laforin protein tyrosine phosphatase | 95.55 | |
| TIGR02104 | 605 | pulA_typeI pullulanase, type I. Pullulan is an unu | 95.49 | |
| KOG0476 | 931 | consensus Cl- channel CLC-2 and related proteins ( | 95.15 | |
| PF03423 | 87 | CBM_25: Carbohydrate binding domain (family 25); I | 94.94 | |
| cd05815 | 101 | CBM20_DPE2_repeat1 Disproportionating enzyme 2 (DP | 94.83 | |
| PLN02960 | 897 | alpha-amylase | 94.39 | |
| COG4175 | 386 | ProV ABC-type proline/glycine betaine transport sy | 94.01 | |
| TIGR02100 | 688 | glgX_debranch glycogen debranching enzyme GlgX. Th | 93.52 | |
| TIGR03415 | 382 | ABC_choXWV_ATP choline ABC transporter, ATP-bindin | 93.23 | |
| PRK03705 | 658 | glycogen debranching enzyme; Provisional | 93.11 | |
| COG1125 | 309 | OpuBA ABC-type proline/glycine betaine transport s | 93.06 | |
| TIGR02102 | 1111 | pullulan_Gpos pullulanase, extracellular, Gram-pos | 92.88 | |
| PLN02316 | 1036 | synthase/transferase | 92.62 | |
| COG1125 | 309 | OpuBA ABC-type proline/glycine betaine transport s | 92.37 | |
| PLN02950 | 909 | 4-alpha-glucanotransferase | 92.29 | |
| PF11806 | 122 | DUF3327: Domain of unknown function (DUF3327); Int | 92.15 | |
| PLN02316 | 1036 | synthase/transferase | 92.0 | |
| TIGR02103 | 898 | pullul_strch alpha-1,6-glucosidases, pullulanase-t | 91.74 | |
| PLN02950 | 909 | 4-alpha-glucanotransferase | 91.43 | |
| PRK14510 | 1221 | putative bifunctional 4-alpha-glucanotransferase/g | 86.23 | |
| cd02857 | 116 | CD_pullulan_degrading_enzymes_N_term CD and pullul | 83.62 | |
| PLN02877 | 970 | alpha-amylase/limit dextrinase | 83.23 | |
| PRK10439 | 411 | enterobactin/ferric enterobactin esterase; Provisi | 82.82 | |
| PLN03244 | 872 | alpha-amylase; Provisional | 82.62 | |
| KOG0470 | 757 | consensus 1,4-alpha-glucan branching enzyme/starch | 82.37 |
| >KOG1764 consensus 5'-AMP-activated protein kinase, gamma subunit [Energy production and conversion] | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.7e-33 Score=282.13 Aligned_cols=303 Identities=31% Similarity=0.558 Sum_probs=256.8
Q ss_pred HHHHHHHHhhhccccccCCCCcceEEecCCCCHHHHHHHHHHcCCcEeeeeeCCCCeEEEEeehHHHHHHHHHHhcCCCC
Q 011043 159 SRHRVSVFLSTHTAYELLPESGKVVALDIDLPVKQAFHILYEQGISMAPLWDFSKARFVGVLSASDFILILRELGNHGSN 238 (495)
Q Consensus 159 ~~~~i~~~l~~~~~~d~~p~s~~vi~l~~~~~v~~A~~~l~e~~i~~~Pv~d~~~~~~vGilt~~Dii~~l~~~~~~~~~ 238 (495)
+...+..|++.++||+++|.+++++++|..+++++||.+|..++.+++|+||...++++|+++..||+.++...++.+..
T Consensus 55 ~~~~~~~~~~~~~~~~~~p~~~~l~~~d~~~~v~~a~~~l~~~~~~~~p~~~~~~~~~~g~~~~~d~i~~~~~~~~~~~~ 134 (381)
T KOG1764|consen 55 AVDTLSKFMKSHTCYDLLPTSSKLVVFDTKLSVKKAFNALVQNGVRAAPLWDSKKQQFVGMLTITDFITVLLRYYKSKSS 134 (381)
T ss_pred hhHHHHHHHhccCcccccCCcceeEEeeCCCcHHHHHHHHHhhceeeeccccCccceeEEEEEHHHHHHHHHHhhccCCc
Confidence 56789999999999999999999999999999999999999999999999999999999999999999999888764222
Q ss_pred C-ChhhHhhhhHHHHHHHHhhhccccCCCCcccCCCceeeCCCCcHHHHHHHHHhCCCceeeEEecCCCCCCCCeEEEEE
Q 011043 239 L-TEEELETHTISAWKEGKAYLNRQIDSHGKAFPRPLVYAGPNDNLKDVARKILHNEVATVPIIHSSSQDGSFPQLLHIA 317 (495)
Q Consensus 239 l-~~~~l~~~~i~~~~~~~~~~~~~~~~~g~~~~~~~i~v~~~~sl~~a~~~m~~~~i~~lpVv~~d~~~g~~~~lvGil 317 (495)
. ..+.++...+..|++.... .+....++++.+.|..++.++...+.+++++++||++ .+.+ .+++++
T Consensus 135 ~~~~~~~~~~~~~~~~~~~~~-------~~~~~~~~~~~i~p~~s~l~~~~~l~~~~~~rvpv~d--~~~~---~v~~il 202 (381)
T KOG1764|consen 135 LDNIEVLEDSQLSKRREVECL-------LKETLKPPFVSISPESSLLDAVLLLIKSRIHRVPVID--PETG---EVLYIL 202 (381)
T ss_pred HHHHhhhhhhhccccchhhhh-------hccccCCCceeecCcHHHHHHHHHHHhCCccceeeec--cccc---ceeeeh
Confidence 1 2233444444445443111 1222345559999999999999999999999999994 5667 899999
Q ss_pred ehhhHHHHHHhhhccCCCCCcccccccccccCcccccccCCCCCCCceeecCCCCHHHHHHHHHHCCCCEEEEEcCCCcE
Q 011043 318 SLSGILKCVCRYFRHCSSSLPILKLPICAIPVGTWVPKIGEPNRRPLAMLRPSASLSAALNLLVQAQVSSIPIVDDNDSL 397 (495)
Q Consensus 318 s~~dIl~~l~~~~~~~~~~~~~l~~~v~~l~i~~~~~~v~~~m~~~~~~v~~~~sl~~a~~~m~~~~~~~lpVvd~~g~l 397 (495)
|++.|++++..+.+... ...++..+++++.+|+|. .+..+..++++.+|+++|.+.+++++||||..|+.
T Consensus 203 t~~rIl~~l~~~~~~~~-~~~~l~~s~~dl~ig~~~---------~i~~i~~~~~v~~al~~m~~~~is~lpvV~~~g~~ 272 (381)
T KOG1764|consen 203 TQRRILKFLWLNGRLLP-LPSLLSKSLSDLGIGTWS---------NIASISEDTPVIEALKIMSERRISALPVVDENGKK 272 (381)
T ss_pred hHHHHHHHHHHhhcccc-cHHHhhCCHHHhCcchhh---------hheeecCCCcHHHHHHHHHhcCcCcceEEcCCCce
Confidence 99999999988876654 456889999999999996 58899999999999999999999999999999999
Q ss_pred EEEEeHHHHHHHHhhcccccCcccccC-HHHHHHcCCCCCCCccccCCcceEecCCCCHHHHHHHHHcCCCcEEEEEeCC
Q 011043 398 LDIYCRSDITALAKDKAYAHINLSEMT-IHQALQLGQDSYSPYELRSQRCQMCLPSDTLHKVMERLANPGVRRLVIVEAG 476 (495)
Q Consensus 398 vGivs~~Dl~~~~~~~~~~~l~~~~~~-v~~~l~~~~~~~~~~~~m~~~~~~v~~~~tL~~a~~~m~~~~~~~l~VVd~~ 476 (495)
+|+++..|+..+.....|..++ .+ +.+.+..+. .....+++|.++++|.+++++|..+++||+||||+
T Consensus 273 v~~~s~~Dv~~l~~~~~~~~~~---~~~l~~~~~~~~-------~~~~~vvtc~~~ssL~~vi~~lv~~~vHRl~VVd~- 341 (381)
T KOG1764|consen 273 VGNYSRFDVIHLAREGTYNNLD---LSCLSEALSHRP-------IRFEGVVTCRPTSTLAEVIDKLVAHRVHRLWVVDE- 341 (381)
T ss_pred ecceehhhhhhhhhcCccCccc---hhHHHHHhhhcc-------cccCccEEEeecchHHHHHHHHHhcCceEEEEEcC-
Confidence 9999999999999888776664 34 666665433 12345899999999999999999999999999994
Q ss_pred CCeEEEEEehHHHHHHhh
Q 011043 477 SKRVEGIVSLSDIFKFLL 494 (495)
Q Consensus 477 ~~~lvGiIs~~DIl~~l~ 494 (495)
+|+++|+||++||+.++.
T Consensus 342 ~~~l~GvvSLsDil~~l~ 359 (381)
T KOG1764|consen 342 DGVLVGVISLSDILSYLV 359 (381)
T ss_pred CCcEEEEeeHHHHHHHHH
Confidence 799999999999999875
|
|
| >cd02859 AMPKbeta_GBD_like AMP-activated protein kinase (AMPK) beta subunit glycogen binding domain (GBD) | Back alignment and domain information |
|---|
| >cd02861 E_set_proteins_like E or "early" set-like proteins | Back alignment and domain information |
|---|
| >COG2524 Predicted transcriptional regulator, contains C-terminal CBS domains [Transcription] | Back alignment and domain information |
|---|
| >KOG1616 consensus Protein involved in Snf1 protein kinase complex assembly [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >COG2524 Predicted transcriptional regulator, contains C-terminal CBS domains [Transcription] | Back alignment and domain information |
|---|
| >cd04641 CBS_pair_28 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >COG3448 CBS-domain-containing membrane protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG3448 CBS-domain-containing membrane protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG3620 Predicted transcriptional regulator with C-terminal CBS domains [Transcription] | Back alignment and domain information |
|---|
| >cd04618 CBS_pair_5 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04603 CBS_pair_KefB_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the KefB (Kef-type K+ transport systems) domain which is involved in inorganic ion transport and metabolism | Back alignment and domain information |
|---|
| >cd04619 CBS_pair_6 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04617 CBS_pair_4 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04618 CBS_pair_5 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PRK10892 D-arabinose 5-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >TIGR00400 mgtE Mg2+ transporter (mgtE) | Back alignment and domain information |
|---|
| >cd04608 CBS_pair_PALP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream | Back alignment and domain information |
|---|
| >cd04593 CBS_pair_EriC_assoc_bac_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in bacteria and archaea | Back alignment and domain information |
|---|
| >cd04630 CBS_pair_17 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >KOG1764 consensus 5'-AMP-activated protein kinase, gamma subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >cd04600 CBS_pair_HPP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain | Back alignment and domain information |
|---|
| >COG3620 Predicted transcriptional regulator with C-terminal CBS domains [Transcription] | Back alignment and domain information |
|---|
| >cd04614 CBS_pair_1 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04801 CBS_pair_M50_like This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the metalloprotease peptidase M50 | Back alignment and domain information |
|---|
| >cd04623 CBS_pair_10 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04605 CBS_pair_MET2_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain | Back alignment and domain information |
|---|
| >cd04641 CBS_pair_28 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04639 CBS_pair_26 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PRK11543 gutQ D-arabinose 5-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >cd04627 CBS_pair_14 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04803 CBS_pair_15 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04607 CBS_pair_NTP_transferase_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain associated with the NTP (Nucleotidyl transferase) domain downstream | Back alignment and domain information |
|---|
| >PRK14869 putative manganese-dependent inorganic pyrophosphatase; Provisional | Back alignment and domain information |
|---|
| >cd04631 CBS_pair_18 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04615 CBS_pair_2 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04642 CBS_pair_29 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PRK15094 magnesium/cobalt efflux protein CorC; Provisional | Back alignment and domain information |
|---|
| >cd04632 CBS_pair_19 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04621 CBS_pair_8 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04624 CBS_pair_11 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04626 CBS_pair_13 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >COG2905 Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd04596 CBS_pair_DRTGG_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream | Back alignment and domain information |
|---|
| >cd04643 CBS_pair_30 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04629 CBS_pair_16 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PRK14869 putative manganese-dependent inorganic pyrophosphatase; Provisional | Back alignment and domain information |
|---|
| >cd04613 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC | Back alignment and domain information |
|---|
| >cd04583 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA | Back alignment and domain information |
|---|
| >cd04635 CBS_pair_22 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04595 CBS_pair_DHH_polyA_Pol_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with an upstream DHH domain which performs a phosphoesterase function and a downstream polyA polymerase domain | Back alignment and domain information |
|---|
| >cd04588 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the archaeal CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain | Back alignment and domain information |
|---|
| >cd04586 CBS_pair_BON_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the BON (bacterial OsmY and nodulation domain) domain | Back alignment and domain information |
|---|
| >cd04589 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the bacterial CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain | Back alignment and domain information |
|---|
| >cd04636 CBS_pair_23 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04590 CBS_pair_CorC_HlyC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain | Back alignment and domain information |
|---|
| >cd04604 CBS_pair_KpsF_GutQ_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein | Back alignment and domain information |
|---|
| >cd04582 CBS_pair_ABC_OpuCA_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA | Back alignment and domain information |
|---|
| >PRK07807 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >cd04627 CBS_pair_14 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04800 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain | Back alignment and domain information |
|---|
| >cd04640 CBS_pair_27 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >cd04603 CBS_pair_KefB_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the KefB (Kef-type K+ transport systems) domain which is involved in inorganic ion transport and metabolism | Back alignment and domain information |
|---|
| >cd04620 CBS_pair_7 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04625 CBS_pair_12 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04612 CBS_pair_SpoIVFB_EriC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC | Back alignment and domain information |
|---|
| >cd04619 CBS_pair_6 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04611 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with a PAS domain, a GGDEF (DiGuanylate-Cyclase (DGC) domain, and a DUF1 domain downstream | Back alignment and domain information |
|---|
| >cd04587 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain | Back alignment and domain information |
|---|
| >TIGR03520 GldE gliding motility-associated protein GldE | Back alignment and domain information |
|---|
| >cd04633 CBS_pair_20 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04602 CBS_pair_IMPDH_2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein | Back alignment and domain information |
|---|
| >PRK01862 putative voltage-gated ClC-type chloride channel ClcB; Provisional | Back alignment and domain information |
|---|
| >cd04585 CBS_pair_ACT_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria | Back alignment and domain information |
|---|
| >cd04617 CBS_pair_4 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04622 CBS_pair_9 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04601 CBS_pair_IMPDH This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein | Back alignment and domain information |
|---|
| >cd04606 CBS_pair_Mg_transporter This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain in the magnesium transporter, MgtE | Back alignment and domain information |
|---|
| >cd04600 CBS_pair_HPP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain | Back alignment and domain information |
|---|
| >cd04630 CBS_pair_17 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04609 CBS_pair_PALP_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream | Back alignment and domain information |
|---|
| >cd04637 CBS_pair_24 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd02858 Esterase_N_term Esterase N-terminal domain | Back alignment and domain information |
|---|
| >cd04802 CBS_pair_3 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04584 CBS_pair_ACT_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria | Back alignment and domain information |
|---|
| >PRK07807 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >cd04607 CBS_pair_NTP_transferase_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain associated with the NTP (Nucleotidyl transferase) domain downstream | Back alignment and domain information |
|---|
| >cd04605 CBS_pair_MET2_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain | Back alignment and domain information |
|---|
| >cd04599 CBS_pair_GGDEF_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain | Back alignment and domain information |
|---|
| >cd04642 CBS_pair_29 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04624 CBS_pair_11 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd02205 CBS_pair The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04623 CBS_pair_10 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04614 CBS_pair_1 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PLN02274 inosine-5'-monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >cd04594 CBS_pair_EriC_assoc_archaea This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the EriC CIC-type chloride channels in archaea | Back alignment and domain information |
|---|
| >TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >PRK07107 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >cd04610 CBS_pair_ParBc_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a ParBc (ParB-like nuclease) domain downstream | Back alignment and domain information |
|---|
| >cd04608 CBS_pair_PALP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream | Back alignment and domain information |
|---|
| >cd04639 CBS_pair_26 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PRK11543 gutQ D-arabinose 5-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >COG0517 FOG: CBS domain [General function prediction only] | Back alignment and domain information |
|---|
| >cd04591 CBS_pair_EriC_assoc_euk_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes and bacteria | Back alignment and domain information |
|---|
| >cd04643 CBS_pair_30 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >cd04593 CBS_pair_EriC_assoc_bac_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in bacteria and archaea | Back alignment and domain information |
|---|
| >cd04582 CBS_pair_ABC_OpuCA_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA | Back alignment and domain information |
|---|
| >PRK10892 D-arabinose 5-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >cd04803 CBS_pair_15 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04629 CBS_pair_16 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04631 CBS_pair_18 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein | Back alignment and domain information |
|---|
| >cd04801 CBS_pair_M50_like This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the metalloprotease peptidase M50 | Back alignment and domain information |
|---|
| >cd04626 CBS_pair_13 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04588 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the archaeal CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain | Back alignment and domain information |
|---|
| >cd04634 CBS_pair_21 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04590 CBS_pair_CorC_HlyC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain | Back alignment and domain information |
|---|
| >PRK15094 magnesium/cobalt efflux protein CorC; Provisional | Back alignment and domain information |
|---|
| >cd04615 CBS_pair_2 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04583 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA | Back alignment and domain information |
|---|
| >TIGR00393 kpsF KpsF/GutQ family protein | Back alignment and domain information |
|---|
| >TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein | Back alignment and domain information |
|---|
| >cd04620 CBS_pair_7 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04586 CBS_pair_BON_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the BON (bacterial OsmY and nodulation domain) domain | Back alignment and domain information |
|---|
| >cd04611 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with a PAS domain, a GGDEF (DiGuanylate-Cyclase (DGC) domain, and a DUF1 domain downstream | Back alignment and domain information |
|---|
| >COG2239 MgtE Mg/Co/Ni transporter MgtE (contains CBS domain) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd04596 CBS_pair_DRTGG_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream | Back alignment and domain information |
|---|
| >cd04598 CBS_pair_GGDEF_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain | Back alignment and domain information |
|---|
| >cd04595 CBS_pair_DHH_polyA_Pol_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with an upstream DHH domain which performs a phosphoesterase function and a downstream polyA polymerase domain | Back alignment and domain information |
|---|
| >cd04604 CBS_pair_KpsF_GutQ_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein | Back alignment and domain information |
|---|
| >cd04585 CBS_pair_ACT_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria | Back alignment and domain information |
|---|
| >cd04636 CBS_pair_23 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04638 CBS_pair_25 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR00400 mgtE Mg2+ transporter (mgtE) | Back alignment and domain information |
|---|
| >cd04621 CBS_pair_8 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04587 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain | Back alignment and domain information |
|---|
| >COG4109 Predicted transcriptional regulator containing CBS domains [Transcription] | Back alignment and domain information |
|---|
| >COG0517 FOG: CBS domain [General function prediction only] | Back alignment and domain information |
|---|
| >cd04800 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain | Back alignment and domain information |
|---|
| >cd04633 CBS_pair_20 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04613 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC | Back alignment and domain information |
|---|
| >cd04612 CBS_pair_SpoIVFB_EriC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC | Back alignment and domain information |
|---|
| >cd04625 CBS_pair_12 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04637 CBS_pair_24 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04622 CBS_pair_9 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04632 CBS_pair_19 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04602 CBS_pair_IMPDH_2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein | Back alignment and domain information |
|---|
| >COG2905 Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR03520 GldE gliding motility-associated protein GldE | Back alignment and domain information |
|---|
| >cd04635 CBS_pair_22 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04589 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the bacterial CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain | Back alignment and domain information |
|---|
| >TIGR01137 cysta_beta cystathionine beta-synthase | Back alignment and domain information |
|---|
| >cd04640 CBS_pair_27 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04802 CBS_pair_3 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04609 CBS_pair_PALP_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream | Back alignment and domain information |
|---|
| >PLN02274 inosine-5'-monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >PRK07107 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >cd02205 CBS_pair The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PRK11573 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd04601 CBS_pair_IMPDH This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein | Back alignment and domain information |
|---|
| >cd04592 CBS_pair_EriC_assoc_euk This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes | Back alignment and domain information |
|---|
| >cd04599 CBS_pair_GGDEF_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain | Back alignment and domain information |
|---|
| >cd04610 CBS_pair_ParBc_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a ParBc (ParB-like nuclease) domain downstream | Back alignment and domain information |
|---|
| >cd04606 CBS_pair_Mg_transporter This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain in the magnesium transporter, MgtE | Back alignment and domain information |
|---|
| >cd04584 CBS_pair_ACT_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria | Back alignment and domain information |
|---|
| >PRK01862 putative voltage-gated ClC-type chloride channel ClcB; Provisional | Back alignment and domain information |
|---|
| >cd04594 CBS_pair_EriC_assoc_archaea This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the EriC CIC-type chloride channels in archaea | Back alignment and domain information |
|---|
| >TIGR00393 kpsF KpsF/GutQ family protein | Back alignment and domain information |
|---|
| >PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd04634 CBS_pair_21 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04591 CBS_pair_EriC_assoc_euk_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes and bacteria | Back alignment and domain information |
|---|
| >TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >cd04598 CBS_pair_GGDEF_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain | Back alignment and domain information |
|---|
| >COG4109 Predicted transcriptional regulator containing CBS domains [Transcription] | Back alignment and domain information |
|---|
| >PRK11573 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG1253 TlyC Hemolysins and related proteins containing CBS domains [General function prediction only] | Back alignment and domain information |
|---|
| >cd04638 CBS_pair_25 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >TIGR01137 cysta_beta cystathionine beta-synthase | Back alignment and domain information |
|---|
| >PF00571 CBS: CBS domain CBS domain web page | Back alignment and domain information |
|---|
| >COG2239 MgtE Mg/Co/Ni transporter MgtE (contains CBS domain) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd04592 CBS_pair_EriC_assoc_euk This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes | Back alignment and domain information |
|---|
| >cd02688 E_set E or "early" set of sugar utilizing enzymes which may be related to the immunoglobulin and/or fibronectin type III superfamilies | Back alignment and domain information |
|---|
| >PF00571 CBS: CBS domain CBS domain web page | Back alignment and domain information |
|---|
| >TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit | Back alignment and domain information |
|---|
| >cd02854 Glycogen_branching_enzyme_like_N_term Glycogen branching enzyme-like N-terminus domain | Back alignment and domain information |
|---|
| >COG1253 TlyC Hemolysins and related proteins containing CBS domains [General function prediction only] | Back alignment and domain information |
|---|
| >COG4535 CorC Putative Mg2+ and Co2+ transporter CorC [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10070 glycine betaine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG4536 CorB Putative Mg2+ and Co2+ transporter CorB [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF02922 CBM_48: Carbohydrate-binding module 48 (Isoamylase N-terminal domain); InterPro: IPR004193 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >KOG0474 consensus Cl- channel CLC-7 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG2550 consensus IMP dehydrogenase/GMP reductase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >KOG2550 consensus IMP dehydrogenase/GMP reductase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >COG4536 CorB Putative Mg2+ and Co2+ transporter CorB [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit | Back alignment and domain information |
|---|
| >COG4535 CorC Putative Mg2+ and Co2+ transporter CorC [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10070 glycine betaine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >KOG0474 consensus Cl- channel CLC-7 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd02860 Pullulanase_N_term Pullulanase domain N-terminus | Back alignment and domain information |
|---|
| >cd04597 CBS_pair_DRTGG_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream | Back alignment and domain information |
|---|
| >cd02855 Glycogen_branching_enzyme_N_term Glycogen branching enzyme N-terminus domain | Back alignment and domain information |
|---|
| >COG0296 GlgB 1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >cd04597 CBS_pair_DRTGG_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream | Back alignment and domain information |
|---|
| >PF00686 CBM_20: Starch binding domain; InterPro: IPR002044 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >smart00116 CBS Domain in cystathionine beta-synthase and other proteins | Back alignment and domain information |
|---|
| >cd02856 Glycogen_debranching_enzyme_N_term Glycogen_debranching_enzyme N-terminal domain | Back alignment and domain information |
|---|
| >PLN02447 1,4-alpha-glucan-branching enzyme | Back alignment and domain information |
|---|
| >smart00116 CBS Domain in cystathionine beta-synthase and other proteins | Back alignment and domain information |
|---|
| >cd05808 CBM20_alpha_amylase Alpha-amylase, C-terminal CBM20 (carbohydrate-binding module, family 20) domain | Back alignment and domain information |
|---|
| >PRK12568 glycogen branching enzyme; Provisional | Back alignment and domain information |
|---|
| >cd05814 CBM20_Prei4 Prei4, N-terminal CBM20 (carbohydrate-binding module, family 20) domain | Back alignment and domain information |
|---|
| >PRK12313 glycogen branching enzyme; Provisional | Back alignment and domain information |
|---|
| >KOG0475 consensus Cl- channel CLC-3 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14706 glycogen branching enzyme; Provisional | Back alignment and domain information |
|---|
| >cd05818 CBM20_water_dikinase Phosphoglucan water dikinase (also known as alpha-glucan water dikinase), N-terminal CBM20 (carbohydrate-binding module, family 20) domain | Back alignment and domain information |
|---|
| >cd05809 CBM20_beta_amylase Beta-amylase, C-terminal CBM20 (carbohydrate-binding module, family 20) domain | Back alignment and domain information |
|---|
| >TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK14705 glycogen branching enzyme; Provisional | Back alignment and domain information |
|---|
| >cd05820 CBM20_novamyl Novamyl (also known as acarviose transferase, ATase, maltogenic alpha-amylase, glucan 1,4-alpha-maltohydrolase, and AcbD), C-terminal CBM20 (carbohydrate-binding module, family 20) domain | Back alignment and domain information |
|---|
| >cd02852 Isoamylase_N_term Isoamylase N-terminus domain | Back alignment and domain information |
|---|
| >COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd02853 MTHase_N_term Maltooligosyl trehalose synthase (MTSase) N-terminus domain | Back alignment and domain information |
|---|
| >cd05811 CBM20_glucoamylase Glucoamylase (glucan1,4-alpha-glucosidase), C-terminal CBM20 (carbohydrate-binding module, family 20) domain | Back alignment and domain information |
|---|
| >cd05813 CBM20_genethonin_1 Genethonin-1, C-terminal CBM20 (carbohydrate-binding module, family 20) domain | Back alignment and domain information |
|---|
| >PRK05402 glycogen branching enzyme; Provisional | Back alignment and domain information |
|---|
| >KOG0475 consensus Cl- channel CLC-3 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd05807 CBM20_CGTase CGTase, C-terminal CBM20 (carbohydrate-binding module, family 20) domain | Back alignment and domain information |
|---|
| >TIGR02402 trehalose_TreZ malto-oligosyltrehalose trehalohydrolase | Back alignment and domain information |
|---|
| >cd05810 CBM20_alpha_MTH Glucan 1,4-alpha-maltotetraohydrolase (alpha-MTH), C-terminal CBM20 (carbohydrate-binding module, family 20) domain | Back alignment and domain information |
|---|
| >PRK05402 glycogen branching enzyme; Provisional | Back alignment and domain information |
|---|
| >TIGR01515 branching_enzym alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase | Back alignment and domain information |
|---|
| >cd05467 CBM20 The family 20 carbohydrate-binding module (CBM20), also known as the starch-binding domain, is found in a large number of starch degrading enzymes including alpha-amylase, beta-amylase, glucoamylase, and CGTase (cyclodextrin glucanotransferase) | Back alignment and domain information |
|---|
| >cd05816 CBM20_DPE2_repeat2 Disproportionating enzyme 2 (DPE2), N-terminal CBM20 (carbohydrate-binding module, family 20) domain, repeat 2 | Back alignment and domain information |
|---|
| >cd05817 CBM20_DSP Dual-specificity phosphatase (DSP), N-terminal CBM20 (carbohydrate-binding module, family 20) domain | Back alignment and domain information |
|---|
| >cd05806 CBM20_laforin Laforin protein tyrosine phosphatase, N-terminal CBM20 (carbohydrate-binding module, family 20) domain | Back alignment and domain information |
|---|
| >TIGR02104 pulA_typeI pullulanase, type I | Back alignment and domain information |
|---|
| >KOG0476 consensus Cl- channel CLC-2 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF03423 CBM_25: Carbohydrate binding domain (family 25); InterPro: IPR005085 A carbohydrate-binding module (CBM) is defined as a contiguous amino acid sequence within a carbohydrate-active enzyme with a discreet fold having carbohydrate-binding activity | Back alignment and domain information |
|---|
| >cd05815 CBM20_DPE2_repeat1 Disproportionating enzyme 2 (DPE2), N-terminal CBM20 (carbohydrate-binding module, family 20) domain, repeat 1 | Back alignment and domain information |
|---|
| >PLN02960 alpha-amylase | Back alignment and domain information |
|---|
| >COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02100 glgX_debranch glycogen debranching enzyme GlgX | Back alignment and domain information |
|---|
| >TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK03705 glycogen debranching enzyme; Provisional | Back alignment and domain information |
|---|
| >COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02102 pullulan_Gpos pullulanase, extracellular, Gram-positive | Back alignment and domain information |
|---|
| >PLN02316 synthase/transferase | Back alignment and domain information |
|---|
| >COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02950 4-alpha-glucanotransferase | Back alignment and domain information |
|---|
| >PF11806 DUF3327: Domain of unknown function (DUF3327); InterPro: IPR021764 This entry represents the N-terminal domain of enterochelin esterase | Back alignment and domain information |
|---|
| >PLN02316 synthase/transferase | Back alignment and domain information |
|---|
| >TIGR02103 pullul_strch alpha-1,6-glucosidases, pullulanase-type | Back alignment and domain information |
|---|
| >PLN02950 4-alpha-glucanotransferase | Back alignment and domain information |
|---|
| >PRK14510 putative bifunctional 4-alpha-glucanotransferase/glycogen debranching enzyme; Provisional | Back alignment and domain information |
|---|
| >cd02857 CD_pullulan_degrading_enzymes_N_term CD and pullulan-degrading enzymes N-terminus domain | Back alignment and domain information |
|---|
| >PLN02877 alpha-amylase/limit dextrinase | Back alignment and domain information |
|---|
| >PRK10439 enterobactin/ferric enterobactin esterase; Provisional | Back alignment and domain information |
|---|
| >PLN03244 alpha-amylase; Provisional | Back alignment and domain information |
|---|
| >KOG0470 consensus 1,4-alpha-glucan branching enzyme/starch branching enzyme II [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 495 | ||||
| 2v8q_E | 330 | Crystal Structure Of The Regulatory Fragment Of Mam | 6e-31 | ||
| 3t4n_C | 323 | Structure Of The Regulatory Fragment Of Saccharomyc | 7e-21 | ||
| 2qlv_C | 315 | Crystal Structure Of The Heterotrimer Core Of The S | 2e-20 | ||
| 2oox_G | 333 | Crystal Structure Of The Adenylate Sensor From Amp- | 4e-20 | ||
| 2qr1_G | 334 | Crystal Structure Of The Adenylate Sensor From Amp- | 4e-20 | ||
| 1z0m_A | 96 | The Glycogen-Binding Domain Of The Amp-Activated Pr | 5e-16 | ||
| 1z0n_A | 96 | The Glycogen-Binding Domain Of The Amp-Activated Pr | 9e-16 | ||
| 2f15_A | 96 | Glycogen-Binding Domain Of The Amp-Activated Protei | 5e-14 | ||
| 2uv5_A | 152 | Crystal Structure Of A Cbs Domain Pair From The Reg | 4e-08 | ||
| 2uv6_A | 152 | Crystal Structure Of A Cbs Domain Pair From The Reg | 2e-07 | ||
| 2uv7_A | 152 | Crystal Structure Of A Cbs Domain Pair From The Reg | 3e-07 | ||
| 2qlv_B | 252 | Crystal Structure Of The Heterotrimer Core Of The S | 3e-07 | ||
| 2nyc_A | 144 | Crystal Structure Of The Bateman2 Domain Of Yeast S | 1e-06 | ||
| 2nye_A | 144 | Crystal Structure Of The Bateman2 Domain Of Yeast S | 1e-05 | ||
| 3nme_A | 294 | Structure Of A Plant Phosphatase Length = 294 | 5e-05 |
| >pdb|2V8Q|E Chain E, Crystal Structure Of The Regulatory Fragment Of Mammalian Ampk In Complexes With Amp Length = 330 | Back alignment and structure |
|
| >pdb|3T4N|C Chain C, Structure Of The Regulatory Fragment Of Saccharomyces Cerevisiae Ampk In Complex With Adp Length = 323 | Back alignment and structure |
| >pdb|2QLV|C Chain C, Crystal Structure Of The Heterotrimer Core Of The S. Cerevisiae Ampk Homolog Snf1 Length = 315 | Back alignment and structure |
| >pdb|2OOX|G Chain G, Crystal Structure Of The Adenylate Sensor From Amp-activated Protein Kinase Complexed With Amp Length = 333 | Back alignment and structure |
| >pdb|2QR1|G Chain G, Crystal Structure Of The Adenylate Sensor From Amp-Activated Protein Kinase In Complex With Adp Length = 334 | Back alignment and structure |
| >pdb|1Z0M|A Chain A, The Glycogen-Binding Domain Of The Amp-Activated Protein Kinase Beta1 Subunit Length = 96 | Back alignment and structure |
| >pdb|1Z0N|A Chain A, The Glycogen-Binding Domain Of The Amp-Activated Protein Kinase Length = 96 | Back alignment and structure |
| >pdb|2F15|A Chain A, Glycogen-Binding Domain Of The Amp-Activated Protein Kinase Beta2 Subunit Length = 96 | Back alignment and structure |
| >pdb|2QLV|B Chain B, Crystal Structure Of The Heterotrimer Core Of The S. Cerevisiae Ampk Homolog Snf1 Length = 252 | Back alignment and structure |
| >pdb|2NYC|A Chain A, Crystal Structure Of The Bateman2 Domain Of Yeast Snf4 Length = 144 | Back alignment and structure |
| >pdb|2NYE|A Chain A, Crystal Structure Of The Bateman2 Domain Of Yeast Snf4 Length = 144 | Back alignment and structure |
| >pdb|3NME|A Chain A, Structure Of A Plant Phosphatase Length = 294 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 495 | |||
| 2qrd_G | 334 | Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, | 7e-80 | |
| 3t4n_C | 323 | Nuclear protein SNF4; CBS domain, nucleotide bindi | 3e-71 | |
| 2v8q_E | 330 | 5'-AMP-activated protein kinase subunit gamma-1; p | 8e-71 | |
| 2uv4_A | 152 | 5'-AMP-activated protein kinase subunit gamma-1; t | 7e-36 | |
| 2uv4_A | 152 | 5'-AMP-activated protein kinase subunit gamma-1; t | 6e-06 | |
| 2uv4_A | 152 | 5'-AMP-activated protein kinase subunit gamma-1; t | 1e-05 | |
| 2nyc_A | 144 | Nuclear protein SNF4; bateman2 domain, AMP kinase, | 4e-33 | |
| 2nyc_A | 144 | Nuclear protein SNF4; bateman2 domain, AMP kinase, | 6e-05 | |
| 3kh5_A | 280 | Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a | 6e-30 | |
| 3kh5_A | 280 | Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a | 7e-09 | |
| 2qlv_B | 252 | Protein SIP2, protein SPM2; heterotrimer, ATP-bind | 2e-28 | |
| 1z0n_A | 96 | 5'-AMP-activated protein kinase, beta-1 subunit; b | 6e-27 | |
| 3nme_A | 294 | Ptpkis1 protein, SEX4 glucan phosphatase; dual spe | 2e-25 | |
| 3ddj_A | 296 | CBS domain-containing protein; structural genomics | 5e-22 | |
| 3ddj_A | 296 | CBS domain-containing protein; structural genomics | 7e-06 | |
| 1y5h_A | 133 | Hypothetical protein RV2626C; CBS domain, unknown | 5e-14 | |
| 1pvm_A | 184 | Conserved hypothetical protein TA0289; structural | 5e-12 | |
| 3fv6_A | 159 | YQZB protein; CBS domain dimer, metabolism regulat | 1e-11 | |
| 2yzi_A | 138 | Hypothetical protein PH0107; sheet/helix/sheet/she | 2e-11 | |
| 3sl7_A | 180 | CBS domain-containing protein CBSX2; CBS-PAIR prot | 4e-11 | |
| 3sl7_A | 180 | CBS domain-containing protein CBSX2; CBS-PAIR prot | 2e-06 | |
| 3fhm_A | 165 | Uncharacterized protein ATU1752; CBS domain, proka | 5e-10 | |
| 2pfi_A | 164 | Chloride channel protein CLC-Ka; cystathionine bet | 6e-10 | |
| 2rih_A | 141 | Conserved protein with 2 CBS domains; bateman doma | 8e-10 | |
| 1pbj_A | 125 | Hypothetical protein; structural genomics, domain, | 1e-09 | |
| 2ef7_A | 133 | Hypothetical protein ST2348; CBS-domain, structura | 2e-09 | |
| 4fry_A | 157 | Putative signal-transduction protein with CBS DOM; | 2e-09 | |
| 2rc3_A | 135 | CBS domain; in SITU proteolysis, BR, structural ge | 2e-09 | |
| 1o50_A | 157 | CBS domain-containing predicted protein TM0935; CB | 4e-09 | |
| 1o50_A | 157 | CBS domain-containing predicted protein TM0935; CB | 7e-04 | |
| 4aee_A | 696 | Alpha amylase, catalytic region; hydrolase, hypert | 8e-09 | |
| 2o16_A | 160 | Acetoin utilization protein ACUB, putative; struct | 1e-08 | |
| 3gby_A | 128 | Uncharacterized protein CT1051; CBS domain, struct | 1e-08 | |
| 3gby_A | 128 | Uncharacterized protein CT1051; CBS domain, struct | 8e-05 | |
| 2p9m_A | 138 | Hypothetical protein MJ0922; structural genomics, | 2e-08 | |
| 3kpb_A | 122 | Uncharacterized protein MJ0100; CBS domain, S-aden | 5e-08 | |
| 2yzq_A | 282 | Putative uncharacterized protein PH1780; sheet/hel | 5e-07 | |
| 2yzq_A | 282 | Putative uncharacterized protein PH1780; sheet/hel | 7e-06 | |
| 2yzq_A | 282 | Putative uncharacterized protein PH1780; sheet/hel | 1e-05 | |
| 2yzq_A | 282 | Putative uncharacterized protein PH1780; sheet/hel | 8e-05 | |
| 1vr9_A | 213 | CBS domain protein/ACT domain protein; structural | 5e-07 | |
| 3lqn_A | 150 | CBS domain protein; csgid, structural genomics, un | 1e-06 | |
| 3lqn_A | 150 | CBS domain protein; csgid, structural genomics, un | 8e-06 | |
| 2j9l_A | 185 | Chloride channel protein 5; ION channel, ION trans | 1e-06 | |
| 3ctu_A | 156 | CBS domain protein; structural genomics, PSI-2, pr | 2e-06 | |
| 3ctu_A | 156 | CBS domain protein; structural genomics, PSI-2, pr | 4e-05 | |
| 1yav_A | 159 | Hypothetical protein BSU14130; cystathionine beta | 1e-05 | |
| 1yav_A | 159 | Hypothetical protein BSU14130; cystathionine beta | 9e-05 | |
| 2emq_A | 157 | Hypothetical conserved protein; CBS domains, NPPSF | 2e-05 | |
| 2emq_A | 157 | Hypothetical conserved protein; CBS domains, NPPSF | 2e-05 |
| >2qrd_G Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} PDB: 2qrc_G* 2qr1_G* 2qre_G* 2oox_G* 2ooy_G* Length = 334 | Back alignment and structure |
|---|
Score = 251 bits (642), Expect = 7e-80
Identities = 74/343 (21%), Positives = 159/343 (46%), Gaps = 34/343 (9%)
Query: 153 EADLQVSRHRVSVFLSTHTAYELLPESGKVVALDIDLPVKQAFHILYEQGISMAPLWDFS 212
+ + + + F+ + T+Y++LP S +++ D+ L VK + +L I APLWD
Sbjct: 5 QETQKGALKEIQAFIRSRTSYDVLPTSFRLIVFDVTLFVKTSLSLLTLNNIVSAPLWDSE 64
Query: 213 KARFVGVLSASDFILILRELGNHGSNLTE-EELETHTISAWKEGKAYLNRQIDSHGKAFP 271
+F G+L+ +DF+ +++ S E++ + +E ++ A P
Sbjct: 65 ANKFAGLLTMADFVNVIKYYYQSSSFPEAIAEIDKFRLLGLRE--------VERKIGAIP 116
Query: 272 RPLVYAGPNDNLKDVARKILHNEVATVPIIHSSSQDGSFPQLLHIASLSGILKCVCRYFR 331
+Y P +L D + + +P+I + GS ++ + + ILK + +
Sbjct: 117 PETIYVHPMHSLMDACLAMSKSRARRIPLIDVDGETGS-EMIVSVLTQYRILKFISMNCK 175
Query: 332 HCSSSLPILKLPICAIPVGTWVPKIGEPNRRPLAMLRPSASLSAALNLLVQAQVSSIPIV 391
+L++P+ + +GTW LA + + +L + +S++PIV
Sbjct: 176 E----TAMLRVPLNQMTIGTW---------SNLATASMETKVYDVIKMLAEKNISAVPIV 222
Query: 392 DDNDSLLDIYCRSDITALAKDKAYAHINLSEMTIHQALQLGQDSYSPYELRSQRCQMCLP 451
+ +LL++Y D+ L +D Y++++L ++ +AL ++ C
Sbjct: 223 NSEGTLLNVYESVDVMHLIQDGDYSNLDL---SVGEALLKRPANFDG-------VHTCRA 272
Query: 452 SDTLHKVMERLANPGVRRLVIVEAGSKRVEGIVSLSDIFKFLL 494
+D L + + + + V RL +V+ + ++EGI+SL+DI +++
Sbjct: 273 TDRLDGIFDAIKHSRVHRLFVVDE-NLKLEGILSLADILNYII 314
|
| >3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C Length = 323 | Back alignment and structure |
|---|
| >2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* Length = 330 | Back alignment and structure |
|---|
| >2nyc_A Nuclear protein SNF4; bateman2 domain, AMP kinase, protein binding; 1.90A {Saccharomyces cerevisiae} SCOP: d.37.1.1 PDB: 2nye_A Length = 144 | Back alignment and structure |
|---|
| >2nyc_A Nuclear protein SNF4; bateman2 domain, AMP kinase, protein binding; 1.90A {Saccharomyces cerevisiae} SCOP: d.37.1.1 PDB: 2nye_A Length = 144 | Back alignment and structure |
|---|
| >3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* Length = 280 | Back alignment and structure |
|---|
| >3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* Length = 280 | Back alignment and structure |
|---|
| >2qlv_B Protein SIP2, protein SPM2; heterotrimer, ATP-binding, carbohydrate metabolism, kinase, membrane, nucleotide-binding, nucleus; 2.60A {Saccharomyces cerevisiae} SCOP: b.1.18.21 d.353.1.1 Length = 252 | Back alignment and structure |
|---|
| >1z0n_A 5'-AMP-activated protein kinase, beta-1 subunit; beta sandwich, sugar binding protein; HET: BCD; 1.49A {Rattus norvegicus} SCOP: b.1.18.21 PDB: 1z0m_A* 2f15_A Length = 96 | Back alignment and structure |
|---|
| >3nme_A Ptpkis1 protein, SEX4 glucan phosphatase; dual specificity phosphatase, carbohydrate BIND hydrolase; 2.40A {Arabidopsis thaliana} Length = 294 | Back alignment and structure |
|---|
| >3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 Length = 296 | Back alignment and structure |
|---|
| >3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 Length = 296 | Back alignment and structure |
|---|
| >1y5h_A Hypothetical protein RV2626C; CBS domain, unknown function; 1.50A {Mycobacterium tuberculosis} SCOP: d.37.1.1 PDB: 1xkf_A Length = 133 | Back alignment and structure |
|---|
| >1pvm_A Conserved hypothetical protein TA0289; structural genomics, CBS domain, PSI, protein structure initiative; 1.50A {Thermoplasma acidophilum dsm 1728} SCOP: d.37.1.1 g.41.13.1 PDB: 2qh1_A Length = 184 | Back alignment and structure |
|---|
| >3fv6_A YQZB protein; CBS domain dimer, metabolism regulator, central glycolytic G regulator, transcription; 1.95A {Bacillus subtilis} PDB: 3fwr_A* 3fws_A* Length = 159 | Back alignment and structure |
|---|
| >2yzi_A Hypothetical protein PH0107; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; 2.25A {Pyrococcus horikoshii} SCOP: d.37.1.1 Length = 138 | Back alignment and structure |
|---|
| >3sl7_A CBS domain-containing protein CBSX2; CBS-PAIR protein, redox regulator, plant CBS domain, thiored chloroplast, membrane protein; 1.91A {Arabidopsis thaliana} Length = 180 | Back alignment and structure |
|---|
| >3sl7_A CBS domain-containing protein CBSX2; CBS-PAIR protein, redox regulator, plant CBS domain, thiored chloroplast, membrane protein; 1.91A {Arabidopsis thaliana} Length = 180 | Back alignment and structure |
|---|
| >3fhm_A Uncharacterized protein ATU1752; CBS domain, prokaryotic, bound nucleotide, AMP, NADH, struct genomics, PSI-2; HET: AMP NAI; 2.70A {Agrobacterium tumefaciens str} Length = 165 | Back alignment and structure |
|---|
| >2pfi_A Chloride channel protein CLC-Ka; cystathionine beta synthetase (CBS) domains containing protein, transport protein; 1.60A {Homo sapiens} Length = 164 | Back alignment and structure |
|---|
| >2rih_A Conserved protein with 2 CBS domains; bateman domain, AMP binding protein, ligand-BIND protein; 2.10A {Pyrobaculum aerophilum} SCOP: d.37.1.1 PDB: 2rif_A Length = 141 | Back alignment and structure |
|---|
| >1pbj_A Hypothetical protein; structural genomics, domain, PSI, protein structure initiative; 1.40A {Methanothermobacter thermautotrophicusdelta H} SCOP: d.37.1.1 Length = 125 | Back alignment and structure |
|---|
| >2ef7_A Hypothetical protein ST2348; CBS-domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.10A {Sulfolobus tokodaii} SCOP: d.37.1.1 Length = 133 | Back alignment and structure |
|---|
| >4fry_A Putative signal-transduction protein with CBS DOM; CBS domain,ssgcid, structural genomics, niaid; HET: NAD AMP; 2.10A {Burkholderia ambifaria} Length = 157 | Back alignment and structure |
|---|
| >2rc3_A CBS domain; in SITU proteolysis, BR, structural genomics, PSI-2, protein structure initiative; HET: NAD; 1.60A {Nitrosomonas europaea atcc 19718} SCOP: d.37.1.1 Length = 135 | Back alignment and structure |
|---|
| >1o50_A CBS domain-containing predicted protein TM0935; CBS-domain PAIR fold, structural genomics, joint center for structural genomics, JCSG; 1.87A {Thermotoga maritima} SCOP: d.37.1.1 Length = 157 | Back alignment and structure |
|---|
| >1o50_A CBS domain-containing predicted protein TM0935; CBS-domain PAIR fold, structural genomics, joint center for structural genomics, JCSG; 1.87A {Thermotoga maritima} SCOP: d.37.1.1 Length = 157 | Back alignment and structure |
|---|
| >4aee_A Alpha amylase, catalytic region; hydrolase, hyperthermostable, cyclodextrin hydrolase, GH13; 2.28A {Staphylothermus marinus} Length = 696 | Back alignment and structure |
|---|
| >2o16_A Acetoin utilization protein ACUB, putative; structural genomics, unknown function, PSI-2, protein struct initiative; 1.90A {Vibrio cholerae} SCOP: d.37.1.1 Length = 160 | Back alignment and structure |
|---|
| >3gby_A Uncharacterized protein CT1051; CBS domain, structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Chlorobium tepidum tls} Length = 128 | Back alignment and structure |
|---|
| >3gby_A Uncharacterized protein CT1051; CBS domain, structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Chlorobium tepidum tls} Length = 128 | Back alignment and structure |
|---|
| >2p9m_A Hypothetical protein MJ0922; structural genomics, collaboratory for structural genomics, secsg; 2.59A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} Length = 138 | Back alignment and structure |
|---|
| >3kpb_A Uncharacterized protein MJ0100; CBS domain, S-adenosylmethionine, conformational change, unknown function; HET: SAM; 1.60A {Methanocaldococcus jannaschii} PDB: 3kpd_A* 3kpc_A* Length = 122 | Back alignment and structure |
|---|
| >2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 Length = 282 | Back alignment and structure |
|---|
| >2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 Length = 282 | Back alignment and structure |
|---|
| >2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 Length = 282 | Back alignment and structure |
|---|
| >2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 Length = 282 | Back alignment and structure |
|---|
| >1vr9_A CBS domain protein/ACT domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.70A {Thermotoga maritima} SCOP: d.37.1.1 Length = 213 | Back alignment and structure |
|---|
| >3lqn_A CBS domain protein; csgid, structural genomics, unknown function, center for structural genomics of infectious diseases; 1.80A {Bacillus anthracis} Length = 150 | Back alignment and structure |
|---|
| >3lqn_A CBS domain protein; csgid, structural genomics, unknown function, center for structural genomics of infectious diseases; 1.80A {Bacillus anthracis} Length = 150 | Back alignment and structure |
|---|
| >2j9l_A Chloride channel protein 5; ION channel, ION transport, voltage-gated; HET: ATP; 2.30A {Homo sapiens} SCOP: d.37.1.1 PDB: 2ja3_A* Length = 185 | Back alignment and structure |
|---|
| >1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 Length = 159 | Back alignment and structure |
|---|
| >1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 Length = 159 | Back alignment and structure |
|---|
| >2emq_A Hypothetical conserved protein; CBS domains, NPPSFA, national project on protein structural functional analyses; 2.50A {Geobacillus kaustophilus} Length = 157 | Back alignment and structure |
|---|
| >2emq_A Hypothetical conserved protein; CBS domains, NPPSFA, national project on protein structural functional analyses; 2.50A {Geobacillus kaustophilus} Length = 157 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 495 | |||
| 3t4n_C | 323 | Nuclear protein SNF4; CBS domain, nucleotide bindi | 100.0 | |
| 2qrd_G | 334 | Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, | 100.0 | |
| 2v8q_E | 330 | 5'-AMP-activated protein kinase subunit gamma-1; p | 100.0 | |
| 3kh5_A | 280 | Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a | 100.0 | |
| 3ddj_A | 296 | CBS domain-containing protein; structural genomics | 99.97 | |
| 2yzq_A | 282 | Putative uncharacterized protein PH1780; sheet/hel | 99.96 | |
| 1z0n_A | 96 | 5'-AMP-activated protein kinase, beta-1 subunit; b | 99.91 | |
| 2qlv_B | 252 | Protein SIP2, protein SPM2; heterotrimer, ATP-bind | 99.9 | |
| 3kh5_A | 280 | Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a | 99.89 | |
| 3ddj_A | 296 | CBS domain-containing protein; structural genomics | 99.88 | |
| 3nme_A | 294 | Ptpkis1 protein, SEX4 glucan phosphatase; dual spe | 99.85 | |
| 2v8q_E | 330 | 5'-AMP-activated protein kinase subunit gamma-1; p | 99.85 | |
| 3t4n_C | 323 | Nuclear protein SNF4; CBS domain, nucleotide bindi | 99.83 | |
| 2yzq_A | 282 | Putative uncharacterized protein PH1780; sheet/hel | 99.82 | |
| 2qrd_G | 334 | Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, | 99.81 | |
| 4esy_A | 170 | CBS domain containing membrane protein; structural | 99.78 | |
| 3lv9_A | 148 | Putative transporter; CBS domain, PSI, MCSG, struc | 99.74 | |
| 3i8n_A | 130 | Uncharacterized protein VP2912; APC64273.1, vibrio | 99.74 | |
| 3k6e_A | 156 | CBS domain protein; streptococcus pneumoniae TIGR4 | 99.73 | |
| 3nqr_A | 127 | Magnesium and cobalt efflux protein CORC; structur | 99.73 | |
| 3lhh_A | 172 | CBS domain protein; structural genomics, PSI-2, pr | 99.72 | |
| 3hf7_A | 130 | Uncharacterized CBS-domain protein; CSB-domain PAI | 99.72 | |
| 3kpb_A | 122 | Uncharacterized protein MJ0100; CBS domain, S-aden | 99.72 | |
| 3jtf_A | 129 | Magnesium and cobalt efflux protein; CBS domain, C | 99.71 | |
| 1pbj_A | 125 | Hypothetical protein; structural genomics, domain, | 99.7 | |
| 3lfr_A | 136 | Putative metal ION transporter; CBS, AMP, PSI, MCS | 99.69 | |
| 2nyc_A | 144 | Nuclear protein SNF4; bateman2 domain, AMP kinase, | 99.69 | |
| 2rih_A | 141 | Conserved protein with 2 CBS domains; bateman doma | 99.69 | |
| 3oco_A | 153 | Hemolysin-like protein containing CBS domains; str | 99.69 | |
| 3k2v_A | 149 | Putative D-arabinose 5-phosphate isomerase; KPSF-l | 99.69 | |
| 2uv4_A | 152 | 5'-AMP-activated protein kinase subunit gamma-1; t | 99.69 | |
| 4esy_A | 170 | CBS domain containing membrane protein; structural | 99.68 | |
| 1y5h_A | 133 | Hypothetical protein RV2626C; CBS domain, unknown | 99.68 | |
| 2o16_A | 160 | Acetoin utilization protein ACUB, putative; struct | 99.68 | |
| 4gqw_A | 152 | CBS domain-containing protein CBSX1, chloroplasti; | 99.68 | |
| 2p9m_A | 138 | Hypothetical protein MJ0922; structural genomics, | 99.68 | |
| 3ocm_A | 173 | Putative membrane protein; structural genomics, PS | 99.68 | |
| 3gby_A | 128 | Uncharacterized protein CT1051; CBS domain, struct | 99.68 | |
| 3fv6_A | 159 | YQZB protein; CBS domain dimer, metabolism regulat | 99.67 | |
| 2yzi_A | 138 | Hypothetical protein PH0107; sheet/helix/sheet/she | 99.67 | |
| 2ef7_A | 133 | Hypothetical protein ST2348; CBS-domain, structura | 99.67 | |
| 2pfi_A | 164 | Chloride channel protein CLC-Ka; cystathionine bet | 99.66 | |
| 3ctu_A | 156 | CBS domain protein; structural genomics, PSI-2, pr | 99.66 | |
| 3fhm_A | 165 | Uncharacterized protein ATU1752; CBS domain, proka | 99.66 | |
| 3l2b_A | 245 | Probable manganase-dependent inorganic pyrophospha | 99.66 | |
| 1o50_A | 157 | CBS domain-containing predicted protein TM0935; CB | 99.65 | |
| 3kxr_A | 205 | Magnesium transporter, putative; cystathionine bet | 99.65 | |
| 3lqn_A | 150 | CBS domain protein; csgid, structural genomics, un | 99.65 | |
| 3sl7_A | 180 | CBS domain-containing protein CBSX2; CBS-PAIR prot | 99.64 | |
| 1vr9_A | 213 | CBS domain protein/ACT domain protein; structural | 99.64 | |
| 2emq_A | 157 | Hypothetical conserved protein; CBS domains, NPPSF | 99.64 | |
| 2rc3_A | 135 | CBS domain; in SITU proteolysis, BR, structural ge | 99.64 | |
| 1pvm_A | 184 | Conserved hypothetical protein TA0289; structural | 99.64 | |
| 3lhh_A | 172 | CBS domain protein; structural genomics, PSI-2, pr | 99.63 | |
| 3kpb_A | 122 | Uncharacterized protein MJ0100; CBS domain, S-aden | 99.63 | |
| 1yav_A | 159 | Hypothetical protein BSU14130; cystathionine beta | 99.63 | |
| 2d4z_A | 250 | Chloride channel protein; CLC chloride channel cyt | 99.63 | |
| 3lv9_A | 148 | Putative transporter; CBS domain, PSI, MCSG, struc | 99.63 | |
| 4fry_A | 157 | Putative signal-transduction protein with CBS DOM; | 99.63 | |
| 3k6e_A | 156 | CBS domain protein; streptococcus pneumoniae TIGR4 | 99.62 | |
| 3oi8_A | 156 | Uncharacterized protein; structural genomics, PSI- | 99.62 | |
| 3kxr_A | 205 | Magnesium transporter, putative; cystathionine bet | 99.62 | |
| 3gby_A | 128 | Uncharacterized protein CT1051; CBS domain, struct | 99.61 | |
| 2ef7_A | 133 | Hypothetical protein ST2348; CBS-domain, structura | 99.6 | |
| 3i8n_A | 130 | Uncharacterized protein VP2912; APC64273.1, vibrio | 99.6 | |
| 1vr9_A | 213 | CBS domain protein/ACT domain protein; structural | 99.6 | |
| 1pbj_A | 125 | Hypothetical protein; structural genomics, domain, | 99.59 | |
| 3jtf_A | 129 | Magnesium and cobalt efflux protein; CBS domain, C | 99.59 | |
| 2j9l_A | 185 | Chloride channel protein 5; ION channel, ION trans | 99.59 | |
| 3lfr_A | 136 | Putative metal ION transporter; CBS, AMP, PSI, MCS | 99.58 | |
| 2p9m_A | 138 | Hypothetical protein MJ0922; structural genomics, | 99.57 | |
| 3nqr_A | 127 | Magnesium and cobalt efflux protein CORC; structur | 99.57 | |
| 2o16_A | 160 | Acetoin utilization protein ACUB, putative; struct | 99.57 | |
| 3l2b_A | 245 | Probable manganase-dependent inorganic pyrophospha | 99.57 | |
| 3oco_A | 153 | Hemolysin-like protein containing CBS domains; str | 99.57 | |
| 2yzi_A | 138 | Hypothetical protein PH0107; sheet/helix/sheet/she | 99.57 | |
| 3oi8_A | 156 | Uncharacterized protein; structural genomics, PSI- | 99.56 | |
| 3fhm_A | 165 | Uncharacterized protein ATU1752; CBS domain, proka | 99.56 | |
| 3fv6_A | 159 | YQZB protein; CBS domain dimer, metabolism regulat | 99.56 | |
| 3hf7_A | 130 | Uncharacterized CBS-domain protein; CSB-domain PAI | 99.56 | |
| 3lqn_A | 150 | CBS domain protein; csgid, structural genomics, un | 99.56 | |
| 2rih_A | 141 | Conserved protein with 2 CBS domains; bateman doma | 99.56 | |
| 2rc3_A | 135 | CBS domain; in SITU proteolysis, BR, structural ge | 99.55 | |
| 3k2v_A | 149 | Putative D-arabinose 5-phosphate isomerase; KPSF-l | 99.55 | |
| 4gqw_A | 152 | CBS domain-containing protein CBSX1, chloroplasti; | 99.54 | |
| 2nyc_A | 144 | Nuclear protein SNF4; bateman2 domain, AMP kinase, | 99.54 | |
| 1o50_A | 157 | CBS domain-containing predicted protein TM0935; CB | 99.54 | |
| 1pvm_A | 184 | Conserved hypothetical protein TA0289; structural | 99.54 | |
| 3ocm_A | 173 | Putative membrane protein; structural genomics, PS | 99.54 | |
| 2uv4_A | 152 | 5'-AMP-activated protein kinase subunit gamma-1; t | 99.54 | |
| 2yvy_A | 278 | MGTE, Mg2+ transporter MGTE; membrane protein, tra | 99.53 | |
| 3ctu_A | 156 | CBS domain protein; structural genomics, PSI-2, pr | 99.53 | |
| 2emq_A | 157 | Hypothetical conserved protein; CBS domains, NPPSF | 99.52 | |
| 2oux_A | 286 | Magnesium transporter; 10001B, structural genomics | 99.52 | |
| 1y5h_A | 133 | Hypothetical protein RV2626C; CBS domain, unknown | 99.52 | |
| 2yvy_A | 278 | MGTE, Mg2+ transporter MGTE; membrane protein, tra | 99.52 | |
| 4fry_A | 157 | Putative signal-transduction protein with CBS DOM; | 99.52 | |
| 2d4z_A | 250 | Chloride channel protein; CLC chloride channel cyt | 99.51 | |
| 4aee_A | 696 | Alpha amylase, catalytic region; hydrolase, hypert | 99.5 | |
| 3sl7_A | 180 | CBS domain-containing protein CBSX2; CBS-PAIR prot | 99.5 | |
| 2pfi_A | 164 | Chloride channel protein CLC-Ka; cystathionine bet | 99.5 | |
| 2oux_A | 286 | Magnesium transporter; 10001B, structural genomics | 99.49 | |
| 1yav_A | 159 | Hypothetical protein BSU14130; cystathionine beta | 99.49 | |
| 2j9l_A | 185 | Chloride channel protein 5; ION channel, ION trans | 99.48 | |
| 2zy9_A | 473 | Mg2+ transporter MGTE; membrane protien, metal tra | 99.48 | |
| 3pc3_A | 527 | CG1753, isoform A; CBS, synthase, PLP, heme, amino | 99.45 | |
| 2zy9_A | 473 | Mg2+ transporter MGTE; membrane protien, metal tra | 99.39 | |
| 3org_A | 632 | CMCLC; transporter, transport protein; 3.50A {Cyan | 99.37 | |
| 3usb_A | 511 | Inosine-5'-monophosphate dehydrogenase; structural | 99.36 | |
| 3pc3_A | 527 | CG1753, isoform A; CBS, synthase, PLP, heme, amino | 99.31 | |
| 3usb_A | 511 | Inosine-5'-monophosphate dehydrogenase; structural | 99.29 | |
| 1zfj_A | 491 | Inosine monophosphate dehydrogenase; IMPDH, CBS do | 99.28 | |
| 4fxs_A | 496 | Inosine-5'-monophosphate dehydrogenase; structural | 99.25 | |
| 1vrd_A | 494 | Inosine-5'-monophosphate dehydrogenase; TM1347, st | 99.23 | |
| 1me8_A | 503 | Inosine-5'-monophosphate dehydrogenase; alpha beta | 99.23 | |
| 4avf_A | 490 | Inosine-5'-monophosphate dehydrogenase; oxidoreduc | 99.21 | |
| 3org_A | 632 | CMCLC; transporter, transport protein; 3.50A {Cyan | 99.17 | |
| 1me8_A | 503 | Inosine-5'-monophosphate dehydrogenase; alpha beta | 99.15 | |
| 1zfj_A | 491 | Inosine monophosphate dehydrogenase; IMPDH, CBS do | 99.14 | |
| 4af0_A | 556 | Inosine-5'-monophosphate dehydrogenase; oxidoreduc | 99.1 | |
| 4fxs_A | 496 | Inosine-5'-monophosphate dehydrogenase; structural | 99.06 | |
| 4aef_A | 645 | Neopullulanase (alpha-amylase II); hydrolase, ther | 99.06 | |
| 4af0_A | 556 | Inosine-5'-monophosphate dehydrogenase; oxidoreduc | 99.06 | |
| 1jcn_A | 514 | Inosine monophosphate dehydrogenase I; IMPD, IMPDH | 99.04 | |
| 4avf_A | 490 | Inosine-5'-monophosphate dehydrogenase; oxidoreduc | 99.01 | |
| 2cu0_A | 486 | Inosine-5'-monophosphate dehydrogenase; structural | 98.99 | |
| 1vrd_A | 494 | Inosine-5'-monophosphate dehydrogenase; TM1347, st | 98.96 | |
| 3ghd_A | 70 | A cystathionine beta-synthase domain protein FUSE | 98.78 | |
| 1jcn_A | 514 | Inosine monophosphate dehydrogenase I; IMPD, IMPDH | 98.77 | |
| 2cu0_A | 486 | Inosine-5'-monophosphate dehydrogenase; structural | 98.76 | |
| 3ghd_A | 70 | A cystathionine beta-synthase domain protein FUSE | 98.74 | |
| 3fio_A | 70 | A cystathionine beta-synthase domain protein fused | 98.45 | |
| 3fio_A | 70 | A cystathionine beta-synthase domain protein fused | 98.4 | |
| 2z0b_A | 131 | GDE5, KIAA1434, putative glycerophosphodiester pho | 98.32 | |
| 1ac0_A | 108 | Glucoamylase; hydrolase, starch binding domain; HE | 97.81 | |
| 3c8d_A | 403 | Enterochelin esterase; alpha-beta-alpha sandwich, | 97.57 | |
| 1m7x_A | 617 | 1,4-alpha-glucan branching enzyme; alpha/beta barr | 97.57 | |
| 3k1d_A | 722 | 1,4-alpha-glucan-branching enzyme; mycobacterium t | 97.54 | |
| 3aml_A | 755 | OS06G0726400 protein; starch-branching, transferas | 97.54 | |
| 2laa_A | 104 | Beta/alpha-amylase; SBD, CBM25, hydrolase; NMR {Pa | 96.39 | |
| 3vgf_A | 558 | Malto-oligosyltrehalose trehalohydrolase; alpha/be | 96.34 | |
| 1bf2_A | 750 | Isoamylase; hydrolase, glycosidase, debranching en | 96.29 | |
| 2wsk_A | 657 | Glycogen debranching enzyme; carbohydrate metaboli | 96.08 | |
| 2bhu_A | 602 | Maltooligosyltrehalose trehalohydrolase; alpha-amy | 96.06 | |
| 2vr5_A | 718 | Glycogen operon protein GLGX; hydrolase, glycosida | 95.89 | |
| 1wzl_A | 585 | Alpha-amylase II; pullulan, GH-13, alpha-amylase f | 95.87 | |
| 2e8y_A | 718 | AMYX protein, pullulanase; multiple domain, beta-a | 95.31 | |
| 1j0h_A | 588 | Neopullulanase; beta-alpha-barrels, hydrolase; 1.9 | 95.27 | |
| 1qho_A | 686 | Alpha-amylase; glycoside hydrolase, starch degrada | 95.23 | |
| 2fhf_A | 1083 | Pullulanase; multiple domain, beta-alpha-barrel, a | 94.92 | |
| 2vn4_A | 599 | Glucoamylase; hydrolase, carbohydrate binding, gly | 94.81 | |
| 3bmv_A | 683 | Cyclomaltodextrin glucanotransferase; glycosidase, | 94.49 | |
| 4aio_A | 884 | Limit dextrinase; hydrolase, pullulanase, glycosid | 94.47 | |
| 1cyg_A | 680 | Cyclodextrin glucanotransferase; glycosyltransfera | 94.39 | |
| 1vem_A | 516 | Beta-amylase; beta-alpha-barrels, optimum PH, hydr | 94.31 | |
| 1d3c_A | 686 | Cyclodextrin glycosyltransferase; alpha-amylase, p | 94.22 | |
| 3faw_A | 877 | Reticulocyte binding protein; TIM barrel, beta bar | 94.17 | |
| 2ya0_A | 714 | Putative alkaline amylopullulanase; hydrolase, gly | 93.67 | |
| 2wan_A | 921 | Pullulanase; hydrolase, glycoside hydrolase, polys | 93.61 | |
| 3m07_A | 618 | Putative alpha amylase; IDP00968, csgid, structura | 93.46 | |
| 1ea9_C | 583 | Cyclomaltodextrinase; hydrolase, glycosidase; 3.2A | 92.74 | |
| 1ji1_A | 637 | Alpha-amylase I; beta/alpha barrel, hydrolase; 1.6 | 91.53 | |
| 2ya1_A | 1014 | Putative alkaline amylopullulanase; hydrolase, gly | 91.31 | |
| 1gcy_A | 527 | Glucan 1,4-alpha-maltotetrahydrolase; beta-alpha-b | 89.69 | |
| 2wan_A | 921 | Pullulanase; hydrolase, glycoside hydrolase, polys | 88.88 | |
| 4fch_A | 221 | Outer membrane protein SUSE; starch binding, extra | 87.86 | |
| 2c3v_A | 102 | Alpha-amylase G-6; carbohydrate-binding module, st | 85.54 |
| >3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C | Back alignment and structure |
|---|
Probab=100.00 E-value=2.4e-39 Score=323.51 Aligned_cols=309 Identities=25% Similarity=0.437 Sum_probs=247.0
Q ss_pred ChhHHHHHHHHHHHHhhhccccccCCCCcceEEecCCCCHHHHHHHHHHcCCcEeeeeeCCCCeEEEEeehHHHHHHHHH
Q 011043 152 SEADLQVSRHRVSVFLSTHTAYELLPESGKVVALDIDLPVKQAFHILYEQGISMAPLWDFSKARFVGVLSASDFILILRE 231 (495)
Q Consensus 152 ~~~~~~~~~~~i~~~l~~~~~~d~~p~s~~vi~l~~~~~v~~A~~~l~e~~i~~~Pv~d~~~~~~vGilt~~Dii~~l~~ 231 (495)
.+.+.....+++.+||+.++|||++|.+.++++++.+.|+++|++.|.+++++++||||++.++++|++|..|++.++..
T Consensus 12 ~~~~~~~~~~~i~~~l~~~~~~d~m~~~~~~v~v~~~~sv~~a~~~m~~~~~~~~pV~d~~~~~lvGilt~~Dl~~~l~~ 91 (323)
T 3t4n_C 12 VSIEQQLAVESIRKFLNSKTSYDVLPVSYRLIVLDTSLLVKKSLNVLLQNSIVSAPLWDSKTSRFAGLLTTTDFINVIQY 91 (323)
T ss_dssp HHHHHHHHHHHHHHHHHHSBHHHHSCSEEEEEEEETTSBHHHHHHHHHHTTCSCEEEEETTTTEEEEEECHHHHHHHHHH
T ss_pred ccHHHHHHHHHHHHHHHhCchHhhCCCCCcEEEEcCCCcHHHHHHHHHHcCCceEEEEeCCCCeEEEEEEHHHHHHHHHH
Confidence 34555667899999999999999999999999999999999999999999999999999887899999999999998876
Q ss_pred HhcCCCCCChhhHhhhhHHHHHHHHhhhccccCCCCcccCCCceeeCCCCcHHHHHHHHHhCCCceeeEEecCCCCCCCC
Q 011043 232 LGNHGSNLTEEELETHTISAWKEGKAYLNRQIDSHGKAFPRPLVYAGPNDNLKDVARKILHNEVATVPIIHSSSQDGSFP 311 (495)
Q Consensus 232 ~~~~~~~l~~~~l~~~~i~~~~~~~~~~~~~~~~~g~~~~~~~i~v~~~~sl~~a~~~m~~~~i~~lpVv~~d~~~g~~~ 311 (495)
++..+.. .+.++.+....+++.... ..+|.++++++.+++++.+|++.|.+++++++||++.+...+ .+
T Consensus 92 ~~~~~~~--~~~l~~~~~~~v~~i~~~--------~~~~~~~~v~v~~~~~l~~a~~~m~~~~~~~lpVvd~~~~~~-~~ 160 (323)
T 3t4n_C 92 YFSNPDK--FELVDKLQLDGLKDIERA--------LGVDQLDTASIHPSRPLFEACLKMLESRSGRIPLIDQDEETH-RE 160 (323)
T ss_dssp HHHCGGG--GGGGGGCBHHHHHHHHHH--------TTC----CCCBCTTSBHHHHHHHHHHHTCSEEEEEEECTTTC-CE
T ss_pred HHcCcch--hHHHHHHHHHHHHHHHHH--------hCCCCCCceEeCCCCcHHHHHHHHHhCCeeEEEEEecCCCCC-cc
Confidence 6543322 235555556666665443 235788999999999999999999999999999996432222 11
Q ss_pred eEEEEEehhhHHHHHHhhhccCCCCCcccccccccccCcccccccCCCCCCCceeecCCCCHHHHHHHHHHCCCCEEEEE
Q 011043 312 QLLHIASLSGILKCVCRYFRHCSSSLPILKLPICAIPVGTWVPKIGEPNRRPLAMLRPSASLSAALNLLVQAQVSSIPIV 391 (495)
Q Consensus 312 ~lvGils~~dIl~~l~~~~~~~~~~~~~l~~~v~~l~i~~~~~~v~~~m~~~~~~v~~~~sl~~a~~~m~~~~~~~lpVv 391 (495)
+++|++|.+|+++++..+... ......+++++.++ |.++++++.+++++.+|++.|.+++++++||+
T Consensus 161 ~l~Givt~~di~~~l~~~~~~----~~~~~~~v~~~~~~---------m~~~~~~v~~~~~~~~~~~~m~~~~~~~~pVv 227 (323)
T 3t4n_C 161 IVVSVLTQYRILKFVALNCRE----THFLKIPIGDLNII---------TQDNMKSCQMTTPVIDVIQMLTQGRVSSVPII 227 (323)
T ss_dssp EEEEEEEHHHHHHHHHHHCGG----GGGCCSBGGGTTCS---------BCTTCCCBCTTSBHHHHHHHHHHHTCSEEEEE
T ss_pred ceEEEecHHHHHHHHHhcCCc----hhhhhCcHHHcCCC---------CCCCcEEECCCCcHHHHHHHHHHcCCCEEEEE
Confidence 299999999999998765432 12334455554221 66789999999999999999999999999999
Q ss_pred cCCCcEEEEEeHHHHHHHHhhcccccCcccccCHHHHHHcCCCCCCCccccCCcceEecCCCCHHHHHHHHHcCCCcEEE
Q 011043 392 DDNDSLLDIYCRSDITALAKDKAYAHINLSEMTIHQALQLGQDSYSPYELRSQRCQMCLPSDTLHKVMERLANPGVRRLV 471 (495)
Q Consensus 392 d~~g~lvGivs~~Dl~~~~~~~~~~~l~~~~~~v~~~l~~~~~~~~~~~~m~~~~~~v~~~~tL~~a~~~m~~~~~~~l~ 471 (495)
|++|+++|+||.+|+++++..+.+..+ +.++.++|..... ...++++|.+++++.+|+++|.+++++++|
T Consensus 228 d~~~~~~Giit~~dl~~~~~~~~~~~~---~~~v~~~m~~~~~-------~~~~~~~v~~~~~l~~~~~~m~~~~~~~l~ 297 (323)
T 3t4n_C 228 DENGYLINVYEAYDVLGLIKGGIYNDL---SLSVGEALMRRSD-------DFEGVYTCTKNDKLSTIMDNIRKARVHRFF 297 (323)
T ss_dssp CTTCBEEEEEETTHHHHHHHTTHHHHT---TSBHHHHGGGSCT-------TCCCCEEECTTCBHHHHHHHHHHSCCCEEE
T ss_pred CCCCeEEEEEeHHHHHHHHhhchhhhc---cCCHHHHHhhccc-------cCCCCEEECCCCCHHHHHHHHHHhCCCEEE
Confidence 999999999999999997765433222 4678887743110 012689999999999999999999999999
Q ss_pred EEeCCCCeEEEEEehHHHHHHhhC
Q 011043 472 IVEAGSKRVEGIVSLSDIFKFLLG 495 (495)
Q Consensus 472 VVd~~~~~lvGiIs~~DIl~~l~~ 495 (495)
|||+ +|+++|+||.+||++++++
T Consensus 298 Vvd~-~~~l~Giit~~Dil~~l~~ 320 (323)
T 3t4n_C 298 VVDD-VGRLVGVLTLSDILKYILL 320 (323)
T ss_dssp EECT-TSBEEEEEEHHHHHHHHHH
T ss_pred EECC-CCcEEEEEEHHHHHHHHHh
Confidence 9994 7999999999999999863
|
| >2qrd_G Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} PDB: 2qrc_G* 2qr1_G* 2qre_G* 2oox_G* 2ooy_G* | Back alignment and structure |
|---|
| >2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* | Back alignment and structure |
|---|
| >3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* | Back alignment and structure |
|---|
| >3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 | Back alignment and structure |
|---|
| >2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 | Back alignment and structure |
|---|
| >1z0n_A 5'-AMP-activated protein kinase, beta-1 subunit; beta sandwich, sugar binding protein; HET: BCD; 1.49A {Rattus norvegicus} SCOP: b.1.18.21 PDB: 1z0m_A* 2f15_A | Back alignment and structure |
|---|
| >2qlv_B Protein SIP2, protein SPM2; heterotrimer, ATP-binding, carbohydrate metabolism, kinase, membrane, nucleotide-binding, nucleus; 2.60A {Saccharomyces cerevisiae} SCOP: b.1.18.21 d.353.1.1 | Back alignment and structure |
|---|
| >3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* | Back alignment and structure |
|---|
| >3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 | Back alignment and structure |
|---|
| >3nme_A Ptpkis1 protein, SEX4 glucan phosphatase; dual specificity phosphatase, carbohydrate BIND hydrolase; 2.40A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* | Back alignment and structure |
|---|
| >3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C | Back alignment and structure |
|---|
| >2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 | Back alignment and structure |
|---|
| >2qrd_G Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} PDB: 2qrc_G* 2qr1_G* 2qre_G* 2oox_G* 2ooy_G* | Back alignment and structure |
|---|
| >4esy_A CBS domain containing membrane protein; structural genomics, PSI-biology; 2.01A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >3lv9_A Putative transporter; CBS domain, PSI, MCSG, structural genomics, protein structur initiative, midwest center for structural genomics; 2.40A {Clostridium difficile 630} | Back alignment and structure |
|---|
| >3i8n_A Uncharacterized protein VP2912; APC64273.1, vibrio parahaemolyticus RIMD 2210633, structural genomics, PSI-2; 2.15A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >3k6e_A CBS domain protein; streptococcus pneumoniae TIGR4, structural genomics, PSI-2, protein structure initiative; 2.81A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3nqr_A Magnesium and cobalt efflux protein CORC; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: AMP; 2.00A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3lhh_A CBS domain protein; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG, cell membrane; HET: MSE AMP; 2.10A {Shewanella oneidensis} | Back alignment and structure |
|---|
| >3hf7_A Uncharacterized CBS-domain protein; CSB-domain PAIR, AMP, PSI, MCSG, STR genomics, midwest center for structural genomics; HET: AMP; 2.75A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3kpb_A Uncharacterized protein MJ0100; CBS domain, S-adenosylmethionine, conformational change, unknown function; HET: SAM; 1.60A {Methanocaldococcus jannaschii} SCOP: d.37.1.0 PDB: 3kpd_A* 3kpc_A* | Back alignment and structure |
|---|
| >3jtf_A Magnesium and cobalt efflux protein; CBS domain, CORC, AMP, structural genomics, PSI-2, protein S initiative; HET: MSE AMP; 2.00A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >1pbj_A Hypothetical protein; structural genomics, domain, PSI, protein structure initiative; 1.40A {Methanothermobacter thermautotrophicusdelta H} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3lfr_A Putative metal ION transporter; CBS, AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 1.53A {Pseudomonas syringae} | Back alignment and structure |
|---|
| >2nyc_A Nuclear protein SNF4; bateman2 domain, AMP kinase, protein binding; 1.90A {Saccharomyces cerevisiae} SCOP: d.37.1.1 PDB: 2nye_A | Back alignment and structure |
|---|
| >2rih_A Conserved protein with 2 CBS domains; bateman domain, AMP binding protein, ligand-BIND protein; 2.10A {Pyrobaculum aerophilum} SCOP: d.37.1.1 PDB: 2rif_A | Back alignment and structure |
|---|
| >3oco_A Hemolysin-like protein containing CBS domains; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.20A {Oenococcus oeni} | Back alignment and structure |
|---|
| >3k2v_A Putative D-arabinose 5-phosphate isomerase; KPSF-like protein, CBS domain, structural genomics, PSI-2, P structure initiative; HET: MSE CMK; 1.95A {Klebsiella pneumoniae subsp} PDB: 3fna_A* | Back alignment and structure |
|---|
| >4esy_A CBS domain containing membrane protein; structural genomics, PSI-biology; 2.01A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >1y5h_A Hypothetical protein RV2626C; CBS domain, unknown function; 1.50A {Mycobacterium tuberculosis} SCOP: d.37.1.1 PDB: 1xkf_A | Back alignment and structure |
|---|
| >2o16_A Acetoin utilization protein ACUB, putative; structural genomics, unknown function, PSI-2, protein struct initiative; 1.90A {Vibrio cholerae} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >4gqw_A CBS domain-containing protein CBSX1, chloroplasti; thioredoxin, plant, protein binding; 2.20A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2p9m_A Hypothetical protein MJ0922; structural genomics, collaboratory for structural genomics, secsg; 2.59A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} | Back alignment and structure |
|---|
| >3ocm_A Putative membrane protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADP; 1.80A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >3gby_A Uncharacterized protein CT1051; CBS domain, structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Chlorobium tepidum tls} | Back alignment and structure |
|---|
| >3fv6_A YQZB protein; CBS domain dimer, metabolism regulator, central glycolytic G regulator, transcription; 1.95A {Bacillus subtilis} PDB: 3fwr_A* 3fws_A* | Back alignment and structure |
|---|
| >2yzi_A Hypothetical protein PH0107; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; 2.25A {Pyrococcus horikoshii} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >2ef7_A Hypothetical protein ST2348; CBS-domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.10A {Sulfolobus tokodaii} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >2pfi_A Chloride channel protein CLC-Ka; cystathionine beta synthetase (CBS) domains containing protein, transport protein; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3fhm_A Uncharacterized protein ATU1752; CBS domain, prokaryotic, bound nucleotide, AMP, NADH, struct genomics, PSI-2; HET: AMP NAI; 2.70A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3l2b_A Probable manganase-dependent inorganic pyrophosphatase; family II, CBS domain, bateman domain, AP4A, diadenosine polyphosphate, DRTGG; HET: B4P; 2.27A {Clostridium perfringens} PDB: 3l31_A* | Back alignment and structure |
|---|
| >1o50_A CBS domain-containing predicted protein TM0935; CBS-domain PAIR fold, structural genomics, joint center for structural genomics, JCSG; 1.87A {Thermotoga maritima} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3kxr_A Magnesium transporter, putative; cystathionine beta-synthase, Mg2+ transporter, structural GE PSI-2, protein structure initiative; 2.41A {Shewanella oneidensis mr-1} | Back alignment and structure |
|---|
| >3lqn_A CBS domain protein; csgid, structural genomics, unknown function, center for structural genomics of infectious diseases; 1.80A {Bacillus anthracis} SCOP: d.37.1.0 | Back alignment and structure |
|---|
| >3sl7_A CBS domain-containing protein CBSX2; CBS-PAIR protein, redox regulator, plant CBS domain, thiored chloroplast, membrane protein; 1.91A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1vr9_A CBS domain protein/ACT domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.70A {Thermotoga maritima} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >2emq_A Hypothetical conserved protein; CBS domains, NPPSFA, national project on protein structural functional analyses; 2.50A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >2rc3_A CBS domain; in SITU proteolysis, BR, structural genomics, PSI-2, protein structure initiative; HET: NAD; 1.60A {Nitrosomonas europaea atcc 19718} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >1pvm_A Conserved hypothetical protein TA0289; structural genomics, CBS domain, PSI, protein structure initiative; 1.50A {Thermoplasma acidophilum dsm 1728} SCOP: d.37.1.1 g.41.13.1 PDB: 2qh1_A | Back alignment and structure |
|---|
| >3lhh_A CBS domain protein; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG, cell membrane; HET: MSE AMP; 2.10A {Shewanella oneidensis} | Back alignment and structure |
|---|
| >3kpb_A Uncharacterized protein MJ0100; CBS domain, S-adenosylmethionine, conformational change, unknown function; HET: SAM; 1.60A {Methanocaldococcus jannaschii} SCOP: d.37.1.0 PDB: 3kpd_A* 3kpc_A* | Back alignment and structure |
|---|
| >1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >2d4z_A Chloride channel protein; CLC chloride channel cytoplasmic domain, CBS domains, ION CH regulatory subunit, transport protein; 3.10A {Torpedo marmorata} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3lv9_A Putative transporter; CBS domain, PSI, MCSG, structural genomics, protein structur initiative, midwest center for structural genomics; 2.40A {Clostridium difficile 630} | Back alignment and structure |
|---|
| >4fry_A Putative signal-transduction protein with CBS DOM; CBS domain,ssgcid, structural genomics, niaid; HET: NAD AMP; 2.10A {Burkholderia ambifaria} | Back alignment and structure |
|---|
| >3k6e_A CBS domain protein; streptococcus pneumoniae TIGR4, structural genomics, PSI-2, protein structure initiative; 2.81A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3oi8_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADN; 1.99A {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >3kxr_A Magnesium transporter, putative; cystathionine beta-synthase, Mg2+ transporter, structural GE PSI-2, protein structure initiative; 2.41A {Shewanella oneidensis mr-1} | Back alignment and structure |
|---|
| >3gby_A Uncharacterized protein CT1051; CBS domain, structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Chlorobium tepidum tls} | Back alignment and structure |
|---|
| >2ef7_A Hypothetical protein ST2348; CBS-domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.10A {Sulfolobus tokodaii} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3i8n_A Uncharacterized protein VP2912; APC64273.1, vibrio parahaemolyticus RIMD 2210633, structural genomics, PSI-2; 2.15A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >1vr9_A CBS domain protein/ACT domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.70A {Thermotoga maritima} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >1pbj_A Hypothetical protein; structural genomics, domain, PSI, protein structure initiative; 1.40A {Methanothermobacter thermautotrophicusdelta H} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3jtf_A Magnesium and cobalt efflux protein; CBS domain, CORC, AMP, structural genomics, PSI-2, protein S initiative; HET: MSE AMP; 2.00A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >2j9l_A Chloride channel protein 5; ION channel, ION transport, voltage-gated; HET: ATP; 2.30A {Homo sapiens} SCOP: d.37.1.1 PDB: 2ja3_A* | Back alignment and structure |
|---|
| >3lfr_A Putative metal ION transporter; CBS, AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 1.53A {Pseudomonas syringae} | Back alignment and structure |
|---|
| >2p9m_A Hypothetical protein MJ0922; structural genomics, collaboratory for structural genomics, secsg; 2.59A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} | Back alignment and structure |
|---|
| >3nqr_A Magnesium and cobalt efflux protein CORC; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: AMP; 2.00A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2o16_A Acetoin utilization protein ACUB, putative; structural genomics, unknown function, PSI-2, protein struct initiative; 1.90A {Vibrio cholerae} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3l2b_A Probable manganase-dependent inorganic pyrophosphatase; family II, CBS domain, bateman domain, AP4A, diadenosine polyphosphate, DRTGG; HET: B4P; 2.27A {Clostridium perfringens} PDB: 3l31_A* | Back alignment and structure |
|---|
| >3oco_A Hemolysin-like protein containing CBS domains; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.20A {Oenococcus oeni} | Back alignment and structure |
|---|
| >2yzi_A Hypothetical protein PH0107; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; 2.25A {Pyrococcus horikoshii} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3oi8_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADN; 1.99A {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >3fhm_A Uncharacterized protein ATU1752; CBS domain, prokaryotic, bound nucleotide, AMP, NADH, struct genomics, PSI-2; HET: AMP NAI; 2.70A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3fv6_A YQZB protein; CBS domain dimer, metabolism regulator, central glycolytic G regulator, transcription; 1.95A {Bacillus subtilis} PDB: 3fwr_A* 3fws_A* | Back alignment and structure |
|---|
| >3hf7_A Uncharacterized CBS-domain protein; CSB-domain PAIR, AMP, PSI, MCSG, STR genomics, midwest center for structural genomics; HET: AMP; 2.75A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3lqn_A CBS domain protein; csgid, structural genomics, unknown function, center for structural genomics of infectious diseases; 1.80A {Bacillus anthracis} SCOP: d.37.1.0 | Back alignment and structure |
|---|
| >2rih_A Conserved protein with 2 CBS domains; bateman domain, AMP binding protein, ligand-BIND protein; 2.10A {Pyrobaculum aerophilum} SCOP: d.37.1.1 PDB: 2rif_A | Back alignment and structure |
|---|
| >2rc3_A CBS domain; in SITU proteolysis, BR, structural genomics, PSI-2, protein structure initiative; HET: NAD; 1.60A {Nitrosomonas europaea atcc 19718} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3k2v_A Putative D-arabinose 5-phosphate isomerase; KPSF-like protein, CBS domain, structural genomics, PSI-2, P structure initiative; HET: MSE CMK; 1.95A {Klebsiella pneumoniae subsp} PDB: 3fna_A* | Back alignment and structure |
|---|
| >4gqw_A CBS domain-containing protein CBSX1, chloroplasti; thioredoxin, plant, protein binding; 2.20A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2nyc_A Nuclear protein SNF4; bateman2 domain, AMP kinase, protein binding; 1.90A {Saccharomyces cerevisiae} SCOP: d.37.1.1 PDB: 2nye_A | Back alignment and structure |
|---|
| >1o50_A CBS domain-containing predicted protein TM0935; CBS-domain PAIR fold, structural genomics, joint center for structural genomics, JCSG; 1.87A {Thermotoga maritima} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >1pvm_A Conserved hypothetical protein TA0289; structural genomics, CBS domain, PSI, protein structure initiative; 1.50A {Thermoplasma acidophilum dsm 1728} SCOP: d.37.1.1 g.41.13.1 PDB: 2qh1_A | Back alignment and structure |
|---|
| >3ocm_A Putative membrane protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADP; 1.80A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >2yvy_A MGTE, Mg2+ transporter MGTE; membrane protein, transport protein; 2.30A {Thermus thermophilus} PDB: 2yvz_A | Back alignment and structure |
|---|
| >2emq_A Hypothetical conserved protein; CBS domains, NPPSFA, national project on protein structural functional analyses; 2.50A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >2oux_A Magnesium transporter; 10001B, structural genomics, PSI-2, P structure initiative, nysgxrc; 2.16A {Enterococcus faecalis} SCOP: a.118.26.1 d.37.1.1 | Back alignment and structure |
|---|
| >1y5h_A Hypothetical protein RV2626C; CBS domain, unknown function; 1.50A {Mycobacterium tuberculosis} SCOP: d.37.1.1 PDB: 1xkf_A | Back alignment and structure |
|---|
| >2yvy_A MGTE, Mg2+ transporter MGTE; membrane protein, transport protein; 2.30A {Thermus thermophilus} PDB: 2yvz_A | Back alignment and structure |
|---|
| >4fry_A Putative signal-transduction protein with CBS DOM; CBS domain,ssgcid, structural genomics, niaid; HET: NAD AMP; 2.10A {Burkholderia ambifaria} | Back alignment and structure |
|---|
| >2d4z_A Chloride channel protein; CLC chloride channel cytoplasmic domain, CBS domains, ION CH regulatory subunit, transport protein; 3.10A {Torpedo marmorata} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >4aee_A Alpha amylase, catalytic region; hydrolase, hyperthermostable, cyclodextrin hydrolase, GH13; 2.28A {Staphylothermus marinus} | Back alignment and structure |
|---|
| >3sl7_A CBS domain-containing protein CBSX2; CBS-PAIR protein, redox regulator, plant CBS domain, thiored chloroplast, membrane protein; 1.91A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2pfi_A Chloride channel protein CLC-Ka; cystathionine beta synthetase (CBS) domains containing protein, transport protein; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2oux_A Magnesium transporter; 10001B, structural genomics, PSI-2, P structure initiative, nysgxrc; 2.16A {Enterococcus faecalis} SCOP: a.118.26.1 d.37.1.1 | Back alignment and structure |
|---|
| >1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >2j9l_A Chloride channel protein 5; ION channel, ION transport, voltage-gated; HET: ATP; 2.30A {Homo sapiens} SCOP: d.37.1.1 PDB: 2ja3_A* | Back alignment and structure |
|---|
| >2zy9_A Mg2+ transporter MGTE; membrane protien, metal transport; 2.94A {Thermus thermophilus} PDB: 2yvx_A | Back alignment and structure |
|---|
| >3pc3_A CG1753, isoform A; CBS, synthase, PLP, heme, aminoacrylate, lyase; HET: HEM P1T; 1.55A {Drosophila melanogaster} PDB: 3pc2_A* 3pc4_A* | Back alignment and structure |
|---|
| >2zy9_A Mg2+ transporter MGTE; membrane protien, metal transport; 2.94A {Thermus thermophilus} PDB: 2yvx_A | Back alignment and structure |
|---|
| >3org_A CMCLC; transporter, transport protein; 3.50A {Cyanidioschyzon merolae} | Back alignment and structure |
|---|
| >3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* | Back alignment and structure |
|---|
| >3pc3_A CG1753, isoform A; CBS, synthase, PLP, heme, aminoacrylate, lyase; HET: HEM P1T; 1.55A {Drosophila melanogaster} PDB: 3pc2_A* 3pc4_A* | Back alignment and structure |
|---|
| >3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* | Back alignment and structure |
|---|
| >1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 | Back alignment and structure |
|---|
| >4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} | Back alignment and structure |
|---|
| >1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 | Back alignment and structure |
|---|
| >1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* | Back alignment and structure |
|---|
| >4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3org_A CMCLC; transporter, transport protein; 3.50A {Cyanidioschyzon merolae} | Back alignment and structure |
|---|
| >1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* | Back alignment and structure |
|---|
| >1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 | Back alignment and structure |
|---|
| >4af0_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase, GTP biosynthesis, drug resistance; HET: MOA IMP; 2.20A {Cryptococcus neoformans} PDB: 4af0_B* | Back alignment and structure |
|---|
| >4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} | Back alignment and structure |
|---|
| >4aef_A Neopullulanase (alpha-amylase II); hydrolase, thermostability, high temperature; 2.34A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >4af0_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase, GTP biosynthesis, drug resistance; HET: MOA IMP; 2.20A {Cryptococcus neoformans} PDB: 4af0_B* | Back alignment and structure |
|---|
| >1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* | Back alignment and structure |
|---|
| >4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2cu0_A Inosine-5'-monophosphate dehydrogenase; structural genomics, pyrococcus horikoshii OT3, riken structural genomics/PROT initiative, RSGI; HET: XMP; 2.10A {Pyrococcus horikoshii} SCOP: c.1.5.1 | Back alignment and structure |
|---|
| >1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 | Back alignment and structure |
|---|
| >3ghd_A A cystathionine beta-synthase domain protein FUSE ribbon-like domain; PF1953,APC40009,cystathionine beta-synthase domain protein; 1.81A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* | Back alignment and structure |
|---|
| >2cu0_A Inosine-5'-monophosphate dehydrogenase; structural genomics, pyrococcus horikoshii OT3, riken structural genomics/PROT initiative, RSGI; HET: XMP; 2.10A {Pyrococcus horikoshii} SCOP: c.1.5.1 | Back alignment and structure |
|---|
| >3ghd_A A cystathionine beta-synthase domain protein FUSE ribbon-like domain; PF1953,APC40009,cystathionine beta-synthase domain protein; 1.81A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2z0b_A GDE5, KIAA1434, putative glycerophosphodiester phosphodiesterase; CBM20 domain, starch-binding, hydrolase, STR genomics, NPPSFA; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1ac0_A Glucoamylase; hydrolase, starch binding domain; HET: GLC BGC GLO; NMR {Aspergillus niger} SCOP: b.3.1.1 PDB: 1acz_A* 1kul_A 1kum_A | Back alignment and structure |
|---|
| >3c8d_A Enterochelin esterase; alpha-beta-alpha sandwich, IROD, iron aquisition, structural genomics, PSI-2, protein structure initiative; HET: CIT; 1.80A {Shigella flexneri 2a str} SCOP: b.1.18.20 c.69.1.2 PDB: 2b20_A 3c87_A* 3c8h_A 3mga_A* | Back alignment and structure |
|---|
| >1m7x_A 1,4-alpha-glucan branching enzyme; alpha/beta barrel, beta sandwich, transferase; 2.30A {Escherichia coli} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 3o7y_A* 3o7z_A* | Back alignment and structure |
|---|
| >3k1d_A 1,4-alpha-glucan-branching enzyme; mycobacterium tuberculosis H37RV, mesophilic human pathogen, RV1326C gene, glycosyl transferase; 2.33A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3aml_A OS06G0726400 protein; starch-branching, transferase; HET: EPE; 1.70A {Oryza sativa japonica group} PDB: 3amk_A | Back alignment and structure |
|---|
| >2laa_A Beta/alpha-amylase; SBD, CBM25, hydrolase; NMR {Paenibacillus polymyxa} PDB: 2lab_A | Back alignment and structure |
|---|
| >3vgf_A Malto-oligosyltrehalose trehalohydrolase; alpha/beta barrel, alpha-amylas hydrolase; HET: GLC FLC; 2.30A {Sulfolobus solfataricus} PDB: 3vge_A* 3vgd_A* 3vgb_A* 1eh9_A* 3vgh_A* 3vgg_A* 1eha_A | Back alignment and structure |
|---|
| >1bf2_A Isoamylase; hydrolase, glycosidase, debranching enzyme; 2.00A {Pseudomonas amyloderamosa} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 | Back alignment and structure |
|---|
| >2wsk_A Glycogen debranching enzyme; carbohydrate metabolism, hydrolase, glycosidase, ISO-amylase glycosyl hydrolase, glycogen metabolism; 2.25A {Escherichia coli k-12} | Back alignment and structure |
|---|
| >2bhu_A Maltooligosyltrehalose trehalohydrolase; alpha-amylase, protein-carbohydrate complex, desiccation resistance; HET: TRS PGE; 1.1A {Deinococcus radiodurans} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 2bhy_A* 2bhz_A* 2bxy_A* 2bxz_A* 2by0_A* 2by1_A* 2by2_A* 2by3_A* | Back alignment and structure |
|---|
| >2vr5_A Glycogen operon protein GLGX; hydrolase, glycosidase, glycosyl hydrolase, glycogen debraching; HET: GLC A16; 2.8A {Sulfolobus solfataricus} PDB: 2vnc_A* 2vuy_A | Back alignment and structure |
|---|
| >1wzl_A Alpha-amylase II; pullulan, GH-13, alpha-amylase family, hydrolase; 2.00A {Thermoactinomyces vulgaris} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1ji2_A 1bvz_A 1vfk_A* 3a6o_A* 1wzm_A 1jf6_A 1wzk_A 2d2o_A* 1jib_A* 1jl8_A* 1vb9_A* 1g1y_A* 1vfo_A* 1vfm_A* 1vfu_A* 1jf5_A | Back alignment and structure |
|---|
| >2e8y_A AMYX protein, pullulanase; multiple domain, beta-alpha-barrel, alpha-amylase-family, HY; 2.11A {Bacillus subtilis} PDB: 2e8z_A* 2e9b_A* | Back alignment and structure |
|---|
| >1j0h_A Neopullulanase; beta-alpha-barrels, hydrolase; 1.90A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1j0i_A* 1j0j_A* 1j0k_A* 1sma_A 1gvi_A* | Back alignment and structure |
|---|
| >1qho_A Alpha-amylase; glycoside hydrolase, starch degradation; HET: MAL ABD; 1.70A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1qhp_A* | Back alignment and structure |
|---|
| >2fhf_A Pullulanase; multiple domain, beta-alpha-barrel, alpha-amylase-family, complex with maltotetraose, hydrolase; HET: GLC; 1.65A {Klebsiella aerogenes} SCOP: b.1.18.2 b.1.18.2 b.3.1.3 b.71.1.1 c.1.8.1 PDB: 2fh6_A* 2fh8_A* 2fhb_A* 2fhc_A* 2fgz_A* | Back alignment and structure |
|---|
| >2vn4_A Glucoamylase; hydrolase, carbohydrate binding, glycoside hydrolase family 15, amyloglucosidase; HET: MAN NAG BTB; 1.85A {Hypocrea jecorina} PDB: 2vn7_A* | Back alignment and structure |
|---|
| >3bmv_A Cyclomaltodextrin glucanotransferase; glycosidase, thermostable, family 13 glycosyl hydrolas; 1.60A {Thermoanaerobacterium thermosulfurigenorganism_taxid} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 3bmw_A* 1ciu_A 1a47_A 1pj9_A* 1cgt_A | Back alignment and structure |
|---|
| >4aio_A Limit dextrinase; hydrolase, pullulanase, glycoside hydrolase family 13; 1.90A {Hordeum vulgare} PDB: 2x4c_A* 2y4s_A* 2y5e_A* 2x4b_A | Back alignment and structure |
|---|
| >1cyg_A Cyclodextrin glucanotransferase; glycosyltransferase; 2.50A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 | Back alignment and structure |
|---|
| >1vem_A Beta-amylase; beta-alpha-barrels, optimum PH, hydrolase; HET: GLC; 1.85A {Bacillus cereus} SCOP: b.3.1.1 c.1.8.1 PDB: 1b90_A* 1j0y_A* 1j0z_A* 1j10_A* 1b9z_A* 1j12_A* 1j18_A* 1j11_A* 5bca_A 1veo_A* 1itc_A* 1ven_A* 1vep_A* 1cqy_A | Back alignment and structure |
|---|
| >1d3c_A Cyclodextrin glycosyltransferase; alpha-amylase, product complex, oligosaccharide, family 13 glycosyl hydrolase, transglycosylation; HET: GLC; 1.78A {Bacillus circulans} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1cxf_A* 1cxk_A* 1cdg_A* 1cxe_A* 1cxh_A* 1cxi_A* 2cxg_A* 1cgv_A* 2dij_A* 1cgy_A* 1kck_A* 1cgx_A* 1cxl_A* 1cgw_A* 1tcm_A 1kcl_A* 1eo5_A* 1eo7_A* 1dtu_A* 1ot1_A* ... | Back alignment and structure |
|---|
| >3faw_A Reticulocyte binding protein; TIM barrel, beta barrel, hydrolase, cell WALL, peptidoglycan-anchor, secreted; 2.10A {Streptococcus agalactiae COH1} PDB: 3fax_A* | Back alignment and structure |
|---|
| >2ya0_A Putative alkaline amylopullulanase; hydrolase, glycoside hydrolase; 1.85A {Streptococcus pneumoniae} PDB: 2ya2_A* | Back alignment and structure |
|---|
| >2wan_A Pullulanase; hydrolase, glycoside hydrolase, polysaccharide, amylase, starch, carbohydrate; 1.65A {Bacillus acidopullulyticus} | Back alignment and structure |
|---|
| >3m07_A Putative alpha amylase; IDP00968, csgid, structural genomics, center for structural genomics of infectious diseases, unknown function; HET: BTB PG4 PGE; 1.40A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >1ea9_C Cyclomaltodextrinase; hydrolase, glycosidase; 3.2A {Bacillus SP} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 | Back alignment and structure |
|---|
| >1ji1_A Alpha-amylase I; beta/alpha barrel, hydrolase; 1.60A {Thermoactinomyces vulgaris} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1uh3_A* 2d0f_A* 1izj_A 1uh4_A* 1uh2_A* 2d0g_A* 2d0h_A* 1izk_A | Back alignment and structure |
|---|
| >2ya1_A Putative alkaline amylopullulanase; hydrolase, glycoside hydrolase; HET: BGC GLC; 2.25A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >1gcy_A Glucan 1,4-alpha-maltotetrahydrolase; beta-alpha-barrel, beta sheet; 1.60A {Pseudomonas stutzeri} SCOP: b.71.1.1 c.1.8.1 PDB: 1jdc_A* 1jda_A* 1jdd_A* 1qi5_A* 1qi3_A* 1qi4_A* 2amg_A 1qpk_A* | Back alignment and structure |
|---|
| >2wan_A Pullulanase; hydrolase, glycoside hydrolase, polysaccharide, amylase, starch, carbohydrate; 1.65A {Bacillus acidopullulyticus} | Back alignment and structure |
|---|
| >4fch_A Outer membrane protein SUSE; starch binding, extracellular, carbohydrate-B protein; HET: GLC; 1.30A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2c3v_A Alpha-amylase G-6; carbohydrate-binding module, starch binding, carbohydrate binding, glycoside hydrolase, amylose, amylopectin; HET: TYI; 1.39A {Bacillus halodurans} PDB: 2c3v_B* 2c3w_A* 2c3x_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 495 | ||||
| d1z0na1 | 87 | b.1.18.21 (A:77-163) 5'-AMP-activated protein kina | 2e-25 | |
| d2qlvb1 | 87 | b.1.18.21 (B:161-247) SIP2 {Saccharomyces cerevisi | 4e-25 | |
| d2v8qe2 | 159 | d.37.1.1 (E:23-181) 5'-AMP-activated protein kinas | 5e-16 | |
| d2v8qe2 | 159 | d.37.1.1 (E:23-181) 5'-AMP-activated protein kinas | 7e-12 | |
| d2ooxe1 | 179 | d.37.1.1 (E:3-181) Uncharacterized protein C1556.0 | 8e-16 | |
| d2ooxe1 | 179 | d.37.1.1 (E:3-181) Uncharacterized protein C1556.0 | 7e-08 | |
| d2ooxe2 | 153 | d.37.1.1 (E:182-334) Uncharacterized protein C1556 | 4e-11 | |
| d2ooxe2 | 153 | d.37.1.1 (E:182-334) Uncharacterized protein C1556 | 0.001 | |
| d2v8qe1 | 145 | d.37.1.1 (E:182-326) 5'-AMP-activated protein kina | 1e-10 | |
| d2v8qe1 | 145 | d.37.1.1 (E:182-326) 5'-AMP-activated protein kina | 1e-04 | |
| d2nyca1 | 140 | d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's | 2e-10 | |
| d2nyca1 | 140 | d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's | 3e-04 | |
| d2yzqa1 | 156 | d.37.1.1 (A:123-278) Uncharacterized protein PH178 | 1e-09 | |
| d2o16a3 | 139 | d.37.1.1 (A:20-158) Hypothetical protein VC0737 {V | 1e-09 | |
| d2rc3a1 | 127 | d.37.1.1 (A:23-149) Uncharacterized protein NE2398 | 4e-08 | |
| d2rc3a1 | 127 | d.37.1.1 (A:23-149) Uncharacterized protein NE2398 | 0.001 | |
| d2yzia1 | 132 | d.37.1.1 (A:4-135) Uncharacterized protein PH0107 | 1e-07 | |
| d1y5ha3 | 123 | d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {M | 3e-07 | |
| d1pbja3 | 120 | d.37.1.1 (A:2-121) Hypothetical protein MTH1622 {A | 1e-06 | |
| d2j9la1 | 169 | d.37.1.1 (A:578-746) Chloride channel protein 5, C | 1e-06 | |
| d2d4za3 | 160 | d.37.1.1 (A:527-606,A:691-770) Chloride channel pr | 2e-06 | |
| d1pvma4 | 142 | d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Ar | 1e-04 | |
| d1jr1a4 | 120 | d.37.1.1 (A:113-232) Type II inosine monophosphate | 1e-04 | |
| d1jr1a4 | 120 | d.37.1.1 (A:113-232) Type II inosine monophosphate | 2e-04 | |
| d1vr9a3 | 121 | d.37.1.1 (A:1-121) Hypothetical protein TM0892, CB | 2e-04 | |
| d2ef7a1 | 127 | d.37.1.1 (A:1-127) Uncharacterized protein ST2348 | 3e-04 | |
| d1o50a3 | 145 | d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Th | 3e-04 | |
| d3ddja2 | 135 | d.37.1.1 (A:1-135) Uncharacterized protein SSO3205 | 0.001 |
| >d1z0na1 b.1.18.21 (A:77-163) 5'-AMP-activated protein kinase subunit beta-1 {Rattus norvegicus [TaxId: 10116]} Length = 87 | Back information, alignment and structure |
|---|
class: All beta proteins fold: Immunoglobulin-like beta-sandwich superfamily: E set domains family: AMPK-beta glycogen binding domain-like domain: 5'-AMP-activated protein kinase subunit beta-1 species: Rattus norvegicus [TaxId: 10116]
Score = 97.3 bits (242), Expect = 2e-25
Identities = 36/86 (41%), Positives = 50/86 (58%), Gaps = 4/86 (4%)
Query: 27 PMRFVWPYGGRSVFLSGSFNRWSELLPMSPVEGCPTVFQIIWSIPPGYHQYKFCVDGEWR 86
P F W GG+ V+LSGSFN WS+ P+ F I +P G HQYKF VDG+W
Sbjct: 3 PTVFRWTGGGKEVYLSGSFNNWSK----LPMTRSQNNFVAILDLPEGEHQYKFFVDGQWT 58
Query: 87 HDEHQPFISSEYGIVNTVLLATEPNF 112
HD +P ++S+ G VN ++ + +F
Sbjct: 59 HDPSEPIVTSQLGTVNNIIQVKKTDF 84
|
| >d2qlvb1 b.1.18.21 (B:161-247) SIP2 {Saccharomyces cerevisiae [TaxId: 4932]} Length = 87 | Back information, alignment and structure |
|---|
| >d2v8qe2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 159 | Back information, alignment and structure |
|---|
| >d2v8qe2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 159 | Back information, alignment and structure |
|---|
| >d2ooxe1 d.37.1.1 (E:3-181) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Length = 179 | Back information, alignment and structure |
|---|
| >d2ooxe1 d.37.1.1 (E:3-181) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Length = 179 | Back information, alignment and structure |
|---|
| >d2ooxe2 d.37.1.1 (E:182-334) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Length = 153 | Back information, alignment and structure |
|---|
| >d2ooxe2 d.37.1.1 (E:182-334) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Length = 153 | Back information, alignment and structure |
|---|
| >d2v8qe1 d.37.1.1 (E:182-326) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 145 | Back information, alignment and structure |
|---|
| >d2v8qe1 d.37.1.1 (E:182-326) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 145 | Back information, alignment and structure |
|---|
| >d2nyca1 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 140 | Back information, alignment and structure |
|---|
| >d2nyca1 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 140 | Back information, alignment and structure |
|---|
| >d2yzqa1 d.37.1.1 (A:123-278) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Length = 156 | Back information, alignment and structure |
|---|
| >d2o16a3 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {Vibrio cholerae [TaxId: 666]} Length = 139 | Back information, alignment and structure |
|---|
| >d2rc3a1 d.37.1.1 (A:23-149) Uncharacterized protein NE2398 {Nitrosomonas europaea [TaxId: 915]} Length = 127 | Back information, alignment and structure |
|---|
| >d2rc3a1 d.37.1.1 (A:23-149) Uncharacterized protein NE2398 {Nitrosomonas europaea [TaxId: 915]} Length = 127 | Back information, alignment and structure |
|---|
| >d2yzia1 d.37.1.1 (A:4-135) Uncharacterized protein PH0107 {Pyrococcus horikoshii [TaxId: 53953]} Length = 132 | Back information, alignment and structure |
|---|
| >d1y5ha3 d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {Mycobacterium tuberculosis [TaxId: 1773]} Length = 123 | Back information, alignment and structure |
|---|
| >d1pbja3 d.37.1.1 (A:2-121) Hypothetical protein MTH1622 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 120 | Back information, alignment and structure |
|---|
| >d2j9la1 d.37.1.1 (A:578-746) Chloride channel protein 5, ClC-5 {Human (Homo sapiens) [TaxId: 9606]} Length = 169 | Back information, alignment and structure |
|---|
| >d2d4za3 d.37.1.1 (A:527-606,A:691-770) Chloride channel protein, CBS tandem {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} Length = 160 | Back information, alignment and structure |
|---|
| >d1pvma4 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 142 | Back information, alignment and structure |
|---|
| >d1jr1a4 d.37.1.1 (A:113-232) Type II inosine monophosphate dehydrogenase CBS domains {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 120 | Back information, alignment and structure |
|---|
| >d1jr1a4 d.37.1.1 (A:113-232) Type II inosine monophosphate dehydrogenase CBS domains {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 120 | Back information, alignment and structure |
|---|
| >d1vr9a3 d.37.1.1 (A:1-121) Hypothetical protein TM0892, CBS tandem {Thermotoga maritima [TaxId: 2336]} Length = 121 | Back information, alignment and structure |
|---|
| >d2ef7a1 d.37.1.1 (A:1-127) Uncharacterized protein ST2348 {Sulfolobus tokodaii [TaxId: 111955]} Length = 127 | Back information, alignment and structure |
|---|
| >d1o50a3 d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Thermotoga maritima [TaxId: 2336]} Length = 145 | Back information, alignment and structure |
|---|
| >d3ddja2 d.37.1.1 (A:1-135) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} Length = 135 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 495 | |||
| d2qlvb1 | 87 | SIP2 {Saccharomyces cerevisiae [TaxId: 4932]} | 99.95 | |
| d1z0na1 | 87 | 5'-AMP-activated protein kinase subunit beta-1 {Ra | 99.94 | |
| d2ooxe1 | 179 | Uncharacterized protein C1556.08c {Schizosaccharom | 99.91 | |
| d2v8qe2 | 159 | 5'-AMP-activated protein kinase subunit gamma-1, A | 99.88 | |
| d2ooxe2 | 153 | Uncharacterized protein C1556.08c {Schizosaccharom | 99.81 | |
| d2nyca1 | 140 | Nuclear protein SNF4 {Baker's yeast (Saccharomyces | 99.8 | |
| d1y5ha3 | 123 | Hypothetical protein Rv2626c {Mycobacterium tuberc | 99.79 | |
| d2o16a3 | 139 | Hypothetical protein VC0737 {Vibrio cholerae [TaxI | 99.78 | |
| d2v8qe1 | 145 | 5'-AMP-activated protein kinase subunit gamma-1, A | 99.78 | |
| d2yzqa1 | 156 | Uncharacterized protein PH1780 {Pyrococcus horikos | 99.78 | |
| d2yzia1 | 132 | Uncharacterized protein PH0107 {Pyrococcus horikos | 99.76 | |
| d1pvma4 | 142 | Hypothetical protein Ta0289 {Archaeon Thermoplasma | 99.76 | |
| d1pbja3 | 120 | Hypothetical protein MTH1622 {Archaeon Methanobact | 99.76 | |
| d2ef7a1 | 127 | Uncharacterized protein ST2348 {Sulfolobus tokodai | 99.75 | |
| d2yzqa2 | 122 | Uncharacterized protein PH1780 {Pyrococcus horikos | 99.74 | |
| d2d4za3 | 160 | Chloride channel protein, CBS tandem {Marbled elec | 99.73 | |
| d2rc3a1 | 127 | Uncharacterized protein NE2398 {Nitrosomonas europ | 99.73 | |
| d1zfja4 | 126 | Type II inosine monophosphate dehydrogenase CBS do | 99.73 | |
| d2ouxa2 | 127 | Magnesium transporter MgtE {Enterococcus faecalis | 99.73 | |
| d1yava3 | 132 | Hypothetical protein YkuL {Bacillus subtilis [TaxI | 99.73 | |
| d1o50a3 | 145 | Hypothetical protein TM0935 {Thermotoga maritima [ | 99.72 | |
| d2ef7a1 | 127 | Uncharacterized protein ST2348 {Sulfolobus tokodai | 99.72 | |
| d1vr9a3 | 121 | Hypothetical protein TM0892, CBS tandem {Thermotog | 99.72 | |
| d2ouxa2 | 127 | Magnesium transporter MgtE {Enterococcus faecalis | 99.71 | |
| d3ddja1 | 141 | Uncharacterized protein SSO3205 {Sulfolobus solfat | 99.71 | |
| d2yvxa2 | 144 | Magnesium transporter MgtE {Thermus thermophilus [ | 99.7 | |
| d2o16a3 | 139 | Hypothetical protein VC0737 {Vibrio cholerae [TaxI | 99.7 | |
| d2yvxa2 | 144 | Magnesium transporter MgtE {Thermus thermophilus [ | 99.7 | |
| d1y5ha3 | 123 | Hypothetical protein Rv2626c {Mycobacterium tuberc | 99.69 | |
| d1pvma4 | 142 | Hypothetical protein Ta0289 {Archaeon Thermoplasma | 99.69 | |
| d2riha1 | 131 | Uncharacterized protein PAE2072 {Pyrobaculum aerop | 99.69 | |
| d1o50a3 | 145 | Hypothetical protein TM0935 {Thermotoga maritima [ | 99.68 | |
| d2yzqa1 | 156 | Uncharacterized protein PH1780 {Pyrococcus horikos | 99.68 | |
| d2yzia1 | 132 | Uncharacterized protein PH0107 {Pyrococcus horikos | 99.67 | |
| d1jr1a4 | 120 | Type II inosine monophosphate dehydrogenase CBS do | 99.67 | |
| d3ddja1 | 141 | Uncharacterized protein SSO3205 {Sulfolobus solfat | 99.67 | |
| d1yava3 | 132 | Hypothetical protein YkuL {Bacillus subtilis [TaxI | 99.66 | |
| d2nyca1 | 140 | Nuclear protein SNF4 {Baker's yeast (Saccharomyces | 99.66 | |
| d2v8qe2 | 159 | 5'-AMP-activated protein kinase subunit gamma-1, A | 99.66 | |
| d1zfja4 | 126 | Type II inosine monophosphate dehydrogenase CBS do | 99.66 | |
| d1pbja3 | 120 | Hypothetical protein MTH1622 {Archaeon Methanobact | 99.66 | |
| d3ddja2 | 135 | Uncharacterized protein SSO3205 {Sulfolobus solfat | 99.65 | |
| d2rc3a1 | 127 | Uncharacterized protein NE2398 {Nitrosomonas europ | 99.65 | |
| d2d4za3 | 160 | Chloride channel protein, CBS tandem {Marbled elec | 99.63 | |
| d1vr9a3 | 121 | Hypothetical protein TM0892, CBS tandem {Thermotog | 99.63 | |
| d2yzqa2 | 122 | Uncharacterized protein PH1780 {Pyrococcus horikos | 99.63 | |
| d3ddja2 | 135 | Uncharacterized protein SSO3205 {Sulfolobus solfat | 99.62 | |
| d2riha1 | 131 | Uncharacterized protein PAE2072 {Pyrobaculum aerop | 99.61 | |
| d2ooxe2 | 153 | Uncharacterized protein C1556.08c {Schizosaccharom | 99.59 | |
| d2v8qe1 | 145 | 5'-AMP-activated protein kinase subunit gamma-1, A | 99.59 | |
| d2ooxe1 | 179 | Uncharacterized protein C1556.08c {Schizosaccharom | 99.59 | |
| d1jr1a4 | 120 | Type II inosine monophosphate dehydrogenase CBS do | 99.59 | |
| d2j9la1 | 169 | Chloride channel protein 5, ClC-5 {Human (Homo sap | 99.57 | |
| d2j9la1 | 169 | Chloride channel protein 5, ClC-5 {Human (Homo sap | 99.5 | |
| d2bhua1 | 97 | Glycosyltrehalose trehalohydrolase, N-terminal dom | 98.66 | |
| d1m7xa1 | 110 | 1,4-alpha-glucan branching enzyme, N-terminal doma | 98.58 | |
| d1eh9a1 | 90 | Glycosyltrehalose trehalohydrolase, N-terminal dom | 97.88 | |
| d3bmva2 | 105 | Cyclodextrin glycosyltransferase, C-terminal domai | 97.66 | |
| d1kula_ | 108 | Glucoamylase, granular starch-binding domain {Aspe | 97.66 | |
| d1cyga2 | 106 | Cyclodextrin glycosyltransferase, C-terminal domai | 97.65 | |
| d1qhoa2 | 110 | Cyclodextrin glycosyltransferase, C-terminal domai | 97.5 | |
| d1vema1 | 99 | beta-amylase {Bacillus cereus [TaxId: 1396]} | 97.47 | |
| d2fhfa1 | 115 | Pullulanase PulA {Klebsiella pneumoniae [TaxId: 57 | 96.38 | |
| d1bf2a1 | 162 | Isoamylase, N-terminal domain N {Pseudomonas amylo | 95.98 | |
| d3c8da1 | 145 | Enterochelin esterase {Shigella flexneri 2a str. 2 | 84.34 | |
| d1ji1a1 | 122 | Maltogenic amylase, N-terminal domain N {Thermoact | 80.94 |
| >d2qlvb1 b.1.18.21 (B:161-247) SIP2 {Saccharomyces cerevisiae [TaxId: 4932]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: Immunoglobulin-like beta-sandwich superfamily: E set domains family: AMPK-beta glycogen binding domain-like domain: SIP2 species: Saccharomyces cerevisiae [TaxId: 4932]
Probab=99.95 E-value=1.2e-28 Score=194.43 Aligned_cols=86 Identities=24% Similarity=0.627 Sum_probs=80.5
Q ss_pred ceeeEEEEecCCCceEEEEEccCCCCCCCCCCcccCCCCeEEEEEEeCCceEEEEEEECCEEeeCCCCCeeeCCCCCeee
Q 011043 24 VLIPMRFVWPYGGRSVFLSGSFNRWSELLPMSPVEGCPTVFQIIWSIPPGYHQYKFCVDGEWRHDEHQPFISSEYGIVNT 103 (495)
Q Consensus 24 ~~~~~~f~~~~~~~~V~v~Gsf~~W~~~~~m~~~~~~~~~~~~~~~l~~g~~~ykf~vdg~w~~d~~~~~~~~~~g~~nn 103 (495)
-+|||+|+|+++|++|+|+||||+|++..+|.+..+.+|.|+++++|+||.|+|||+|||+|++||.+|++.|++|+.||
T Consensus 2 ~~vpv~f~w~~~g~~V~v~GsFn~W~~~~~~~~~~~~~g~~~~~l~l~~G~y~YKFiVDG~w~~d~~~p~~~d~~G~~nn 81 (87)
T d2qlvb1 2 LMVPVEIRWQQGGSKVYVTGSFTKWRKMIGLIPDSDNNGSFHVKLRLLPGTHRFRFIVDNELRVSDFLPTATDQMGNFVN 81 (87)
T ss_dssp CCEEEEEEECSCCSCEEEEEGGGTTSSCEECEECSSSTTCEEEEEEECSEEEEEEEEETTEEECCTTSCEEBCSSCCCEE
T ss_pred eEEEEEEEECCCCeEEEEEEEecCcCcccccccccCCCccEEEEEeCCCCCEEEEEEECCcEEcCCCCCeeECCCCCEeE
Confidence 36999999999999999999999999987777665678999999999999999999999999999999999999999999
Q ss_pred EEEecC
Q 011043 104 VLLATE 109 (495)
Q Consensus 104 ~~~v~~ 109 (495)
+|.|++
T Consensus 82 vi~V~~ 87 (87)
T d2qlvb1 82 YIEVRQ 87 (87)
T ss_dssp EEEECC
T ss_pred EEEEEC
Confidence 999975
|
| >d1z0na1 b.1.18.21 (A:77-163) 5'-AMP-activated protein kinase subunit beta-1 {Rattus norvegicus [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2ooxe1 d.37.1.1 (E:3-181) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2v8qe2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2ooxe2 d.37.1.1 (E:182-334) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2nyca1 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1y5ha3 d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2o16a3 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d2v8qe1 d.37.1.1 (E:182-326) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2yzqa1 d.37.1.1 (A:123-278) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2yzia1 d.37.1.1 (A:4-135) Uncharacterized protein PH0107 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1pvma4 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1pbja3 d.37.1.1 (A:2-121) Hypothetical protein MTH1622 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d2ef7a1 d.37.1.1 (A:1-127) Uncharacterized protein ST2348 {Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d2yzqa2 d.37.1.1 (A:1-122) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2d4za3 d.37.1.1 (A:527-606,A:691-770) Chloride channel protein, CBS tandem {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} | Back information, alignment and structure |
|---|
| >d2rc3a1 d.37.1.1 (A:23-149) Uncharacterized protein NE2398 {Nitrosomonas europaea [TaxId: 915]} | Back information, alignment and structure |
|---|
| >d1zfja4 d.37.1.1 (A:95-220) Type II inosine monophosphate dehydrogenase CBS domains {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d2ouxa2 d.37.1.1 (A:136-262) Magnesium transporter MgtE {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1yava3 d.37.1.1 (A:13-144) Hypothetical protein YkuL {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1o50a3 d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2ef7a1 d.37.1.1 (A:1-127) Uncharacterized protein ST2348 {Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d1vr9a3 d.37.1.1 (A:1-121) Hypothetical protein TM0892, CBS tandem {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2ouxa2 d.37.1.1 (A:136-262) Magnesium transporter MgtE {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d3ddja1 d.37.1.1 (A:136-276) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2yvxa2 d.37.1.1 (A:132-275) Magnesium transporter MgtE {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2o16a3 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d2yvxa2 d.37.1.1 (A:132-275) Magnesium transporter MgtE {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1y5ha3 d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1pvma4 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d2riha1 d.37.1.1 (A:2-132) Uncharacterized protein PAE2072 {Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1o50a3 d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2yzqa1 d.37.1.1 (A:123-278) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2yzia1 d.37.1.1 (A:4-135) Uncharacterized protein PH0107 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1jr1a4 d.37.1.1 (A:113-232) Type II inosine monophosphate dehydrogenase CBS domains {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d3ddja1 d.37.1.1 (A:136-276) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1yava3 d.37.1.1 (A:13-144) Hypothetical protein YkuL {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2nyca1 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2v8qe2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1zfja4 d.37.1.1 (A:95-220) Type II inosine monophosphate dehydrogenase CBS domains {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1pbja3 d.37.1.1 (A:2-121) Hypothetical protein MTH1622 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d3ddja2 d.37.1.1 (A:1-135) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2rc3a1 d.37.1.1 (A:23-149) Uncharacterized protein NE2398 {Nitrosomonas europaea [TaxId: 915]} | Back information, alignment and structure |
|---|
| >d2d4za3 d.37.1.1 (A:527-606,A:691-770) Chloride channel protein, CBS tandem {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} | Back information, alignment and structure |
|---|
| >d1vr9a3 d.37.1.1 (A:1-121) Hypothetical protein TM0892, CBS tandem {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2yzqa2 d.37.1.1 (A:1-122) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d3ddja2 d.37.1.1 (A:1-135) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2riha1 d.37.1.1 (A:2-132) Uncharacterized protein PAE2072 {Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d2ooxe2 d.37.1.1 (E:182-334) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2v8qe1 d.37.1.1 (E:182-326) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2ooxe1 d.37.1.1 (E:3-181) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1jr1a4 d.37.1.1 (A:113-232) Type II inosine monophosphate dehydrogenase CBS domains {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d2j9la1 d.37.1.1 (A:578-746) Chloride channel protein 5, ClC-5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2j9la1 d.37.1.1 (A:578-746) Chloride channel protein 5, ClC-5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bhua1 b.1.18.2 (A:14-110) Glycosyltrehalose trehalohydrolase, N-terminal domain N {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1m7xa1 b.1.18.2 (A:117-226) 1,4-alpha-glucan branching enzyme, N-terminal domain N {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1eh9a1 b.1.18.2 (A:1-90) Glycosyltrehalose trehalohydrolase, N-terminal domain N {Archaeon Sulfolobus solfataricus, km1 [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d3bmva2 b.3.1.1 (A:579-683) Cyclodextrin glycosyltransferase, C-terminal domain {Thermoanaerobacterium [TaxId: 28895]} | Back information, alignment and structure |
|---|
| >d1kula_ b.3.1.1 (A:) Glucoamylase, granular starch-binding domain {Aspergillus niger [TaxId: 5061]} | Back information, alignment and structure |
|---|
| >d1cyga2 b.3.1.1 (A:575-680) Cyclodextrin glycosyltransferase, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1qhoa2 b.3.1.1 (A:577-686) Cyclodextrin glycosyltransferase, C-terminal domain {Bacillus stearothermophilus, maltogenic alpha-amylase [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1vema1 b.3.1.1 (A:418-516) beta-amylase {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d2fhfa1 b.1.18.2 (A:288-402) Pullulanase PulA {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d1bf2a1 b.1.18.2 (A:1-162) Isoamylase, N-terminal domain N {Pseudomonas amyloderamosa [TaxId: 32043]} | Back information, alignment and structure |
|---|
| >d3c8da1 b.1.18.20 (A:6-150) Enterochelin esterase {Shigella flexneri 2a str. 2457T [TaxId: 198215]} | Back information, alignment and structure |
|---|
| >d1ji1a1 b.1.18.2 (A:1-122) Maltogenic amylase, N-terminal domain N {Thermoactinomyces vulgaris, TVAI [TaxId: 2026]} | Back information, alignment and structure |
|---|