Citrus Sinensis ID: 011117

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490---
MLQIRLKKVPSSESGGAVKPLPVETVTVACPDHLVLADLPVAKGIGAATAASLVKTVGRRSRRQLGERVHFCVRCDYPIAIYGRLNPCEHVFCLDCARSDSMCYLCDERIQKIQTIKLMEGIFICAAPHCLKSFLKKTEFEAHIHVSHADLLLQPNAEKEDNESESAKQPTVSESSVRAPPRPVFSPGQNSQLNDRDDKARWQQPREQPPPRAGLLPKQPPVFGQLQNYQSDAQPDGSLPPGFERPGPHNRFQQSFDMQGTPQQESSQQQGILSETQFPEYPPMHPMQPPNFVVPMNSNPLLTPPFPPFPTEGSQQFYGAPFGMPRPDSVTEVGSEQASLLGFPPGPPGGVNFPPSYSQLWNPGPGGAPFEVPSGGQGIAEGFGNMSDSQGKAAFYQGYAQNPGGAPMINPPLPTGNKGMEAVQGSSGMDPRDGKGILTPPAMSLPPPPPGPPPQSHMSQHKRGKYYSGDMVRESPGFGWPHENRDGFGSSQE
cccEEEcccccccccccccccccccEEEEccccHHHccccHHHHcccccHHHHHHHHcccccccccccEEEcccccccEEEEEEEcccccccccccccccccccccHHHHHHHEEEcccccEEEEccccHHHHHccHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
ccEEEEcccccccccccccccccccEEEEccccEEEEccccHHccccccHHHHHHHcccccccccccEEEEcccccccEEEEEEEcccccEEEEcccccccccccccccEEEEEEcccccEEEEEcccccccccccHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
mlqirlkkvpssesggavkplpvetvtvacpdhlvladlpvakgiGAATAASLVKTVGRrsrrqlgervhfcvrcdypiaiygrlnpcehvfcldcarsdsmcylCDERIQKIQTIKLMEGIFICAAPHCLKSFLKKTEFEAHIhvshadlllqpnaekednesesakqptvsessvrapprpvfspgqnsqlndrddkarwqqpreqpppragllpkqppvfgqlqnyqsdaqpdgslppgferpgphnrfqqsfdmqgtpqqessqqqgilsetqfpeyppmhpmqppnfvvpmnsnplltppfppfptegsqqfygapfgmprpdsvtevgseqasllgfppgppggvnfppsysqlwnpgpggapfevpsggqgiaegfgnmsdsqgKAAFYQgyaqnpggapminpplptgnkgmeavqgssgmdprdgkgiltppamslpppppgpppqshmsqhkrgkyysgdmvrespgfgwphenrdgfgssqe
mlqirlkkvpssesggavkplpVETVTVACPDHLVLADLPVAKGIGAATAASLVKTvgrrsrrqlgervhfcVRCDYPIAIYGRLNPCEHVFCLDCARSDSMCYLCDERIQKIQTIKLMEGIFICAAPHCLKSFLKKTEFEAHIHVSHADLLLQPNAEKEDNEsesakqptvsessvrapprpvfspgqnsqlndrDDKARWQQPreqpppragllpKQPPVFGQLQNYQSDAQPDGSLPPGFERPGPHNRFQQSFDMQGTPQQESSQQQGILSETQFPEYPPMHPMQPPNFVVPMNSNPLLTPPFPPFPTEGSQQFYGAPFGMPRPDSVTEVGSEQASLLGFPPGPPGGVNFPPSYSQLWNPGPGGAPFEVPSGGQGIAEGFGNMSDSQGKAAFYQGYAQNPGGAPMINPPLPTGNKGMEAVQGSSGMDPRDGKGILTPPAMSLPPPPPGPPPQSHMSQHKRGKYYSGDMVRESpgfgwphenrdgfgssqe
MLQIRLKKVPSSESGGAVKPLPVETVTVACPDHLVLADLPVAKGIGAATAASLVKTVGRRSRRQLGERVHFCVRCDYPIAIYGRLNPCEHVFCLDCARSDSMCYLCDERIQKIQTIKLMEGIFICAAPHCLKSFLKKTEFEAHIHVSHADLLLQPNAEKEDNESESAKQPTVSESSVRAPPRPVFSPGQNSQLNDRDDKArwqqpreqppprAGLLPKQPPVFGQLQNYQSDAQPDGSLPPGFERPGPHNRFQQSFDMQGTPqqessqqqGILSETQFpeyppmhpmqppNFVVPMNSNplltppfppfptEGSQQFYGAPFGMPRPDSVTEVGSEQASLLgfppgppggvnfppSYSQLWNPGPGGAPFEVPSGGQGIAEGFGNMSDSQGKAAFYQGYAQNPGGAPMINPPLPTGNKGMEAVQGSSGMDPRDGKGILTppamslpppppgpppQSHMSQHKRGKYYSGDMVRESPGFGWPHENRDGFGSSQE
********************LPVETVTVACPDHLVLADLPVAKGIGAATAASLVKTVGRRSRRQLGERVHFCVRCDYPIAIYGRLNPCEHVFCLDCARSDSMCYLCDERIQKIQTIKLMEGIFICAAPHCLKSFLKKTEFEAHIHVSHADLLL****************************************************************************************************************************************************************************************************************************************************************************************************************************************************
************************TVTVACPDHLVLADLPVAKGIGAATAASLVKTVGRRSRRQLGERVHFCVRCDYPIAIYGRLNPCEHVFCLDCARSDSMCYLCDERIQKIQTIKLMEGIFICAAPHCLKSFLKKTEFEAHI*************************************************************************************************************************************************************************************************************************************************************************************************************************************************************
*****************VKPLPVETVTVACPDHLVLADLPVAKGIGAATAASLVKTVGRRSRRQLGERVHFCVRCDYPIAIYGRLNPCEHVFCLDCARSDSMCYLCDERIQKIQTIKLMEGIFICAAPHCLKSFLKKTEFEAHIHVSHADLLLQPN***********************PPRPVFS*************************RAGLLPKQPPVFGQLQNYQSDAQPDGSLPPGFERPGPHNRFQQSF***************ILSETQFPEYPPMHPMQPPNFVVPMNSNPLLTPPFPPFPTEGSQQFYGAPFGMPRPD*********ASLLGFPPGPPGGVNFPPSYSQLWNPGPGGAPFEVPSGGQGIAEGFGNMSDSQGKAAFYQGYAQNPGGAPMINPPLPTGNK************PRDGKGILTPPAMSLPP****************GKYYSGDMVRESPGFGWPHENRDGFGSSQE
***********************ETVTVACPDHLVLADLPVAKGIGAATAASLVKTVGRRSRRQLGERVHFCVRCDYPIAIYGRLNPCEHVFCLDCARSDSMCYLCDERIQKIQTIKLMEGIFICAAPHCLKSFLKKTEFEAHIHVSHADL**************************************************************************************************************************SETQFPEY*P*H******FVVP*N****LTPPF*************************************************SYSQLWNP*PGGA*F*******************************************************************L***AMSLPPPPPGP*****************************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLQIRLKKVPSSESGGAVKPLPVETVTVACPDHLVLADLPVAKGIGAATAASLVKTVGRRSRRQLGERVHFCVRCDYPIAIYGRLNPCEHVFCLDCARSDSMCYLCDERIQKIQTIKLMEGIFICAAPHCLKSFLKKTEFEAHIHVSHADLLLQPNAEKEDNESESAKQPTVSESSVRAPPRPVFSPGQNSQLNDRDDKARWQQPREQPPPRAGLLPKQPPVFGQLQNYQSDAQPDGSLPPGFERPGPHNRFQQSFDMQGTPQQESSQQQGILSETQFPEYPPMHPMQPPNFVVPMNSNPLLTPPFPPFPTEGSQQFYGAPFGMPRPDSVTEVGSEQASLLGFPPGPPGGVNFPPSYSQLWNPGPGGAPFEVPSGGQGIAEGFGNMSDSQGKAAFYQGYAQNPGGAPMINPPLPTGNKGMEAVQGSSGMDPRDGKGILTPPAMSLPPPPPGPPPQSHMSQHKRGKYYSGDMVRESPGFGWPHENRDGFGSSQE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query493 2.2.26 [Sep-21-2011]
Q5ZHZ4493 E3 ubiquitin-protein liga yes no 0.168 0.168 0.393 2e-13
Q4R7I8490 E3 ubiquitin-protein liga N/A no 0.168 0.169 0.393 6e-13
Q75N03491 E3 ubiquitin-protein liga yes no 0.168 0.169 0.393 6e-13
Q9JIY2491 E3 ubiquitin-protein liga yes no 0.168 0.169 0.382 9e-13
Q8N7E2425 E3 ubiquitin-protein liga no no 0.168 0.195 0.340 2e-09
>sp|Q5ZHZ4|HAKAI_CHICK E3 ubiquitin-protein ligase Hakai OS=Gallus gallus GN=CBLL1 PE=2 SV=1 Back     alignment and function desciption
 Score = 77.8 bits (190), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 58/94 (61%), Gaps = 11/94 (11%)

Query: 65  LGER----VHFCVRCDYPIAIYGRLNPCEHVFCLDCA-----RSDSMCYLCDERIQKIQT 115
           LGE+    VHFC +C  PI +YGR+ PC+HVFC DCA     + D MC  C+E +Q+I+ 
Sbjct: 98  LGEKDDTPVHFCDKCGLPIKMYGRMIPCKHVFCYDCAILHEKKGDKMCPGCNEPVQRIEQ 157

Query: 116 IKLMEGIFICAAPH-CLKSFLKKTEFEAHIHVSH 148
             +   +F+C+    C +++L + + +AHI+  H
Sbjct: 158 C-VRGSLFMCSIVQGCKRTYLSQRDLQAHINHRH 190
Promotes ubiquitination of tyrosine-phosphorylated CDH1, thus targeting CDH1 for endocytosis and degradation.
Gallus gallus (taxid: 9031)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|Q4R7I8|HAKAI_MACFA E3 ubiquitin-protein ligase Hakai OS=Macaca fascicularis GN=CBLL1 PE=2 SV=1 Back     alignment and function description
>sp|Q75N03|HAKAI_HUMAN E3 ubiquitin-protein ligase Hakai OS=Homo sapiens GN=CBLL1 PE=1 SV=1 Back     alignment and function description
>sp|Q9JIY2|HAKAI_MOUSE E3 ubiquitin-protein ligase Hakai OS=Mus musculus GN=Cbll1 PE=1 SV=1 Back     alignment and function description
>sp|Q8N7E2|ZN645_HUMAN E3 ubiquitin-protein ligase ZNF645 OS=Homo sapiens GN=ZNF645 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query493
225440592497 PREDICTED: uncharacterized protein LOC10 0.981 0.973 0.673 1e-167
255573899484 conserved hypothetical protein [Ricinus 0.959 0.977 0.685 1e-167
449440285471 PREDICTED: uncharacterized protein LOC10 0.924 0.968 0.604 1e-153
356520981439 PREDICTED: uncharacterized protein LOC10 0.866 0.972 0.554 1e-132
224087663336 predicted protein [Populus trichocarpa] 0.663 0.973 0.688 1e-129
356568039440 PREDICTED: uncharacterized protein LOC10 0.866 0.970 0.548 1e-128
147823358380 hypothetical protein VITISV_014340 [Viti 0.689 0.894 0.682 1e-127
297740257355 unnamed protein product [Vitis vinifera] 0.632 0.878 0.637 1e-116
15240902360 e-cadherin binding protein-like protein 0.638 0.875 0.546 5e-90
21536615361 unknown [Arabidopsis thaliana] 0.640 0.875 0.543 2e-89
>gi|225440592|ref|XP_002273666.1| PREDICTED: uncharacterized protein LOC100244343 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  595 bits (1534), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 341/506 (67%), Positives = 383/506 (75%), Gaps = 22/506 (4%)

Query: 1   MLQIRLKKVPSSESGGAVKPLPVETVTVACPDHLVLADLPVAKGIGAATAASLVKTVGRR 60
           MLQIRL + PS  SG   KPLPVETVTVACPDHLVLADLPVAK +G+ TAASLVKTVGRR
Sbjct: 1   MLQIRLSRDPSLGSGSGSKPLPVETVTVACPDHLVLADLPVAKSLGSMTAASLVKTVGRR 60

Query: 61  SRRQLGERVHFCVRCDYPIAIYGRLNPCEHVFCLDCARSDSMCYLCDERIQKIQTIKLME 120
           SRRQLGERVHFCVRCD+PIAIYGRL PCEH FCLDCARSDS+CYLCDERIQKIQTIK+ME
Sbjct: 61  SRRQLGERVHFCVRCDFPIAIYGRLIPCEHAFCLDCARSDSICYLCDERIQKIQTIKMME 120

Query: 121 GIFICAAPHCLKSFLKKTEFEAHIHVSHADLLLQPNAEKED-NESE--SAKQPTVSESSV 177
           GIFICAAPHCLKSFLK+ EFE+HIH SHAD LLQPNAEKED NESE  S KQ TVS+S+ 
Sbjct: 121 GIFICAAPHCLKSFLKRAEFESHIHESHAD-LLQPNAEKEDGNESEALSVKQSTVSDSTA 179

Query: 178 RAPPRPVFSPGQNSQLNDRDDKARWQQPRE-QPPPRAGLLPKQPPVFGQLQNYQSDAQPD 236
           RAP RPVFSP  +SQL+DR+DKAR QQPRE QPP R  + PK PP F     + S+ QPD
Sbjct: 180 RAPSRPVFSPSSSSQLHDREDKARRQQPREQQPPSRPIIQPKPPPFF-----HPSELQPD 234

Query: 237 GSLPP-GFERPGPHNRFQQSFDMQGTPQQESSQ----QQGILSETQFPEYPPMHPMQPPN 291
            + PP GF+RPG H    Q+FD QG  QQES+Q    QQGILSE+ + EYPP+H  QPPN
Sbjct: 235 NNRPPQGFDRPGLHRFHPQTFDNQGGLQQESAQFSDKQQGILSESPYAEYPPLHSHQPPN 294

Query: 292 FVVPMNSNPLLTPP---FPPFPTEGSQQFYGAPFGMPRPDSVTEVGSEQASLLGFPPGPP 348
           F VP+N NPLLTPP   +  FP+EG+Q FY +P  M RPDS  +VG+EQ SLLGFPPGP 
Sbjct: 295 FAVPLNPNPLLTPPPFNYHHFPSEGAQTFYSSPHEMARPDSAPDVGTEQGSLLGFPPGPV 354

Query: 349 GGVNFPPSYSQLWNPGPGGAPFEVPSGGQGIAEGFGNMSDSQGKAAFYQG-YAQNPGGAP 407
           GGVNFP SY + WN GP G PFE P+GGQ I +G GN SD QG+ AF+QG Y +NPG  P
Sbjct: 355 GGVNFPESYPRPWNSGPVGVPFEGPTGGQPIPDGLGNASDPQGRGAFFQGDYGRNPGSLP 414

Query: 408 MINPPLPTGNKGMEAVQGSSGMDPRDGKGILTPPAMSLPPPPPGPPPQSHMSQHKRGKYY 467
              P  P  NKGME  QGS+ MDPRDGKGIL   A    P PP PPP  H+SQ KR K++
Sbjct: 415 SNPPLPPLANKGMEPTQGSAAMDPRDGKGIL---AQPPLPLPPPPPPPPHLSQLKRAKFF 471

Query: 468 SGDMVRESPGFGWPHENRDGFGSSQE 493
           SGD  R+  GFGW  E  D FGS Q+
Sbjct: 472 SGDTSRDGQGFGWQQEKHDSFGSGQD 497

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255573899|ref|XP_002527868.1| conserved hypothetical protein [Ricinus communis] gi|223532719|gb|EEF34499.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|449440285|ref|XP_004137915.1| PREDICTED: uncharacterized protein LOC101220422 [Cucumis sativus] gi|449483687|ref|XP_004156660.1| PREDICTED: uncharacterized protein LOC101227330 [Cucumis sativus] Back     alignment and taxonomy information
>gi|356520981|ref|XP_003529137.1| PREDICTED: uncharacterized protein LOC100817582 [Glycine max] Back     alignment and taxonomy information
>gi|224087663|ref|XP_002308203.1| predicted protein [Populus trichocarpa] gi|222854179|gb|EEE91726.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356568039|ref|XP_003552221.1| PREDICTED: uncharacterized protein LOC100803063 [Glycine max] Back     alignment and taxonomy information
>gi|147823358|emb|CAN64199.1| hypothetical protein VITISV_014340 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297740257|emb|CBI30439.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|15240902|ref|NP_195736.1| e-cadherin binding protein-like protein [Arabidopsis thaliana] gi|6759439|emb|CAB69844.1| putative protein [Arabidopsis thaliana] gi|89000985|gb|ABD59082.1| At5g01160 [Arabidopsis thaliana] gi|110742738|dbj|BAE99278.1| hypothetical protein [Arabidopsis thaliana] gi|332002922|gb|AED90305.1| e-cadherin binding protein-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|21536615|gb|AAM60947.1| unknown [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query493
TAIR|locus:2150094360 AT5G01160 [Arabidopsis thalian 0.387 0.530 0.681 2.5e-81
UNIPROTKB|C9J121282 CBLL1 "E3 ubiquitin-protein li 0.168 0.294 0.393 1.2e-12
RGD|1310703416 Cbll1 "Cbl proto-oncogene, E3 0.168 0.199 0.382 3.8e-12
UNIPROTKB|C9J2P9323 CBLL1 "E3 ubiquitin-protein li 0.168 0.256 0.393 6.3e-12
UNIPROTKB|Q5ZHZ4493 CBLL1 "E3 ubiquitin-protein li 0.168 0.168 0.393 9.3e-12
UNIPROTKB|F1MEB7492 CBLL1 "Uncharacterized protein 0.245 0.245 0.308 3e-11
UNIPROTKB|B7ZM03490 CBLL1 "CBLL1 protein" [Homo sa 0.168 0.169 0.393 6.6e-11
UNIPROTKB|I3LM23490 CBLL1 "Uncharacterized protein 0.168 0.169 0.393 6.6e-11
UNIPROTKB|Q4R7I8490 CBLL1 "E3 ubiquitin-protein li 0.168 0.169 0.393 6.6e-11
UNIPROTKB|J9NV88491 CBLL1 "Uncharacterized protein 0.168 0.169 0.393 6.6e-11
TAIR|locus:2150094 AT5G01160 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 703 (252.5 bits), Expect = 2.5e-81, Sum P(3) = 2.5e-81
 Identities = 135/198 (68%), Positives = 162/198 (81%)

Query:     1 MLQIRLKKVPSSESGGAVKPLPVETVTVACPDHLVLADLPVAKGIGAATAASLVKTVGRR 60
             MLQIRL++   +E+G   +P P ETVTVACPDHLVLADLPVAKGIG+ T  +++K VGRR
Sbjct:     1 MLQIRLRRDSPTETGNGARPSPTETVTVACPDHLVLADLPVAKGIGSVTPTTVIKPVGRR 60

Query:    61 SRRQLGERVHFCVRCDYPIAIYGRLNPCEHVFCLDCARSDSMCYLCDERIQKIQTIKLME 120
             SRRQLGERVHFCVRCD+PIAIYGRL PC+H FCL+CARSDS+CYLCDERIQKIQTIK+ME
Sbjct:    61 SRRQLGERVHFCVRCDFPIAIYGRLIPCDHAFCLECARSDSICYLCDERIQKIQTIKMME 120

Query:   121 GIFICAAPHCLKSFLKKTEFEAHIHVSHADLLLQPNAEKED-NESE---SAKQPTVSESS 176
             GIFICAAPHCL+SFLKK +FEAH+H  H  LL Q +AEKED N+S+   + +Q + SES+
Sbjct:   121 GIFICAAPHCLRSFLKKLDFEAHVHDLHGSLL-QADAEKEDGNQSDVQSTMQQSSASEST 179

Query:   177 VRAPPRPVFSPGQNSQLN 194
             +RAP R      Q+ +LN
Sbjct:   180 LRAPLRSQLQ--QSRELN 195
GO:0005622 "intracellular" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0008270 "zinc ion binding" evidence=IEA
UNIPROTKB|C9J121 CBLL1 "E3 ubiquitin-protein ligase Hakai" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1310703 Cbll1 "Cbl proto-oncogene, E3 ubiquitin protein ligase-like 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|C9J2P9 CBLL1 "E3 ubiquitin-protein ligase Hakai" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZHZ4 CBLL1 "E3 ubiquitin-protein ligase Hakai" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1MEB7 CBLL1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|B7ZM03 CBLL1 "CBLL1 protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|I3LM23 CBLL1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q4R7I8 CBLL1 "E3 ubiquitin-protein ligase Hakai" [Macaca fascicularis (taxid:9541)] Back     alignment and assigned GO terms
UNIPROTKB|J9NV88 CBLL1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query493
pfam09770 804 pfam09770, PAT1, Topoisomerase II-associated prote 3e-05
cd0016245 cd00162, RING, RING-finger (Really Interesting New 0.001
pfam09770 804 pfam09770, PAT1, Topoisomerase II-associated prote 0.004
pfam04959211 pfam04959, ARS2, Arsenite-resistance protein 2 0.004
>gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 Back     alignment and domain information 
 Score = 46.3 bits (110), Expect = 3e-05
 Identities = 29/138 (21%), Positives = 43/138 (31%), Gaps = 3/138 (2%)

Query: 179 APPRPVFSPGQNSQLNDRDDKARWQQPREQPPPRAGLLPKQPPVFGQLQNYQSDAQPDGS 238
            P +P   P       ++    ++     Q P +  L P+ P     LQ  Q        
Sbjct: 196 PPEQPPGYPQPPQGHPEQVQPQQFLPAPSQAPAQPPLPPQLPQQPPPLQQPQFPGLSQQ- 254

Query: 239 LPPGFERPGPHNRFQQSFDMQGTPQQESSQQQGILSETQFPEYPPMHPMQPPNFVVPMNS 298
           +PP   +P    +       Q  PQ + +   G+      P  PP  P   P    P   
Sbjct: 255 MPPPPPQPPQQQQQPPQPQAQPPPQNQPTPHPGLPQGQNAPLPPPQQPQLLPLVQQPQGQ 314

Query: 299 NPLLTPPFPPFPTEGSQQ 316
                P F     + SQQ
Sbjct: 315 QR--GPQFREQLVQLSQQ 330

Members of this family are necessary for accurate chromosome transmission during cell division. Length = 804
>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 Back     alignment and domain information
>gnl|CDD|218350 pfam04959, ARS2, Arsenite-resistance protein 2 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 493
KOG2932389 consensus E3 ubiquitin ligase involved in ubiquiti 100.0
COG5222427 Uncharacterized conserved protein, contains RING Z 98.07
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 98.06
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 97.97
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 97.92
cd0016245 RING RING-finger (Really Interesting New Gene) dom 97.88
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 97.88
PHA02929238 N1R/p28-like protein; Provisional 97.84
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 97.83
KOG2164513 consensus Predicted E3 ubiquitin ligase [Posttrans 97.83
smart0050463 Ubox Modified RING finger domain. Modified RING fi 97.67
TIGR00599397 rad18 DNA repair protein rad18. This family is bas 97.66
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 97.66
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 97.5
KOG2177386 consensus Predicted E3 ubiquitin ligase [Posttrans 97.44
PF1463444 zf-RING_5: zinc-RING finger domain 97.35
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 97.27
PHA02926242 zinc finger-like protein; Provisional 97.26
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 97.24
COG5432391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 97.17
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 97.15
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 97.15
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 97.01
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 96.98
KOG0824324 consensus Predicted E3 ubiquitin ligase [Posttrans 96.71
KOG0287442 consensus Postreplication repair protein RAD18 [Re 96.67
TIGR00570309 cdk7 CDK-activating kinase assembly factor MAT1. A 96.3
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 96.29
KOG0823230 consensus Predicted E3 ubiquitin ligase [Posttrans 96.21
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 96.18
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 95.71
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 95.63
KOG0802543 consensus E3 ubiquitin ligase [Posttranslational m 95.44
PF04641260 Rtf2: Rtf2 RING-finger 95.43
KOG1039344 consensus Predicted E3 ubiquitin ligase [Posttrans 95.39
COG5243491 HRD1 HRD ubiquitin ligase complex, ER membrane com 95.38
KOG4739233 consensus Uncharacterized protein involved in syna 95.34
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 95.33
KOG0311381 consensus Predicted E3 ubiquitin ligase [Posttrans 95.21
COG5236493 Uncharacterized conserved protein, contains RING Z 95.06
KOG1734328 consensus Predicted RING-containing E3 ubiquitin l 94.98
KOG2660331 consensus Locus-specific chromosome binding protei 94.91
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 94.34
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 94.32
KOG4692489 consensus Predicted E3 ubiquitin ligase [Posttrans 93.87
COG5152259 Uncharacterized conserved protein, contains RING a 93.75
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 93.66
KOG0297391 consensus TNF receptor-associated factor [Signal t 93.17
KOG3039303 consensus Uncharacterized conserved protein [Funct 93.15
KOG1100207 consensus Predicted E3 ubiquitin ligase [Posttrans 92.85
KOG1001674 consensus Helicase-like transcription factor HLTF/ 92.62
KOG1571355 consensus Predicted E3 ubiquitin ligase [Posttrans 92.53
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 92.46
COG5189423 SFP1 Putative transcriptional repressor regulating 92.32
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 92.17
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 91.9
KOG1785563 consensus Tyrosine kinase negative regulator CBL [ 91.67
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 91.55
KOG0825 1134 consensus PHD Zn-finger protein [General function 91.53
KOG1002791 consensus Nucleotide excision repair protein RAD16 91.15
KOG4159398 consensus Predicted E3 ubiquitin ligase [Posttrans 90.69
KOG4275350 consensus Predicted E3 ubiquitin ligase [Posttrans 89.64
PHA03096284 p28-like protein; Provisional 89.31
KOG3002299 consensus Zn finger protein [General function pred 88.75
KOG1941518 consensus Acetylcholine receptor-associated protei 87.86
KOG0804493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 87.22
PF0289150 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR0041 86.52
KOG4185296 consensus Predicted E3 ubiquitin ligase [Posttrans 85.1
PF0797551 C1_4: TFIIH C1-like domain; InterPro: IPR004595 Al 84.9
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 84.64
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 83.15
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 83.11
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 82.65
KOG0826357 consensus Predicted E3 ubiquitin ligase involved i 81.94
smart0035526 ZnF_C2H2 zinc finger. 81.71
KOG4362 684 consensus Transcriptional regulator BRCA1 [Replica 80.91
>KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=3e-66  Score=510.93  Aligned_cols=306  Identities=52%  Similarity=0.934  Sum_probs=256.1

Q ss_pred             CceeeeecCCCCCCCCCCC----CCCcceEEeecCCeEEEecCccccccccchh-hhhhhhhhhhhhhhcCcccccccCC
Q 011117            1 MLQIRLKKVPSSESGGAVK----PLPVETVTVACPDHLVLADLPVAKGIGAATA-ASLVKTVGRRSRRQLGERVHFCVRC   75 (493)
Q Consensus         1 mlqirl~~~~~~~~~~~~~----~~~pesVtVnc~Dh~VIA~~pvae~~gaats-s~~~k~~GrrSkrqlgEKvhFCdIC   75 (493)
                      |+||||+++...+.+.+..    +.+.|+|||+|.||||+++.++.++++..|- -+.++.++++.+|++++++||||+|
T Consensus        17 lg~i~~rr~~p~~t~~~q~nkaaPpp~e~~tv~~e~~~~~~~~p~f~~~~r~pphl~w~~~V~~~gek~l~p~VHfCd~C   96 (389)
T KOG2932|consen   17 LGQIRLRRDSPTETGNGQRNKAAPPPTETVTVACEDHLVLADLPVFKGIGRVPPHLTWIKPVGRRGEKQLGPRVHFCDRC   96 (389)
T ss_pred             ccceeecccCCccccchhhcccCCCCcceeeeccchhhhhcCCchhcccccCCCceeeeeecccccccccCcceEeeccc
Confidence            6899999999999988765    8899999999999999999999999987776 5566999999999999999999999


Q ss_pred             Cccccccccccccccccchhhhh--CCCCcccchHhHhhheeeecCCcEEEec-CCchhhhhcChhHHHHhhhhhhcccc
Q 011117           76 DYPIAIYGRLNPCEHVFCLDCAR--SDSMCYLCDERIQKIQTIKLMEGIFICA-APHCLKSFLKKTEFEAHIHVSHADLL  152 (493)
Q Consensus        76 dlPI~iygRmIPCKHVFCydCA~--sDktCP~Cna~VqrIEri~p~esIFIC~-~~gCkRtYLSqRDLQAHInhrH~~l~  152 (493)
                      |+||+||||||||||||||+||+  .||+|++|+++|++||+| .+|+||||+ +.+|+|||||+|||||||||||..| 
T Consensus        97 d~PI~IYGRmIPCkHvFCl~CAr~~~dK~Cp~C~d~VqrIeq~-~~g~iFmC~~~~GC~RTyLsqrDlqAHInhrH~~~-  174 (389)
T KOG2932|consen   97 DFPIAIYGRMIPCKHVFCLECARSDSDKICPLCDDRVQRIEQI-MMGGIFMCAAPHGCLRTYLSQRDLQAHINHRHGSL-  174 (389)
T ss_pred             CCcceeeecccccchhhhhhhhhcCccccCcCcccHHHHHHHh-cccceEEeecchhHHHHHhhHHHHHHHhhhhhccc-
Confidence            99999999999999999999999  568999999999999999 589999999 5779999999999999999999999 


Q ss_pred             CCccccccc-cc--cccc-ccCCCcCCccccCCCCcCCCCCcccccchhHHHhhhCCCCCCCCCCCCCCCC--CCccCcc
Q 011117          153 LQPNAEKED-NE--SESA-KQPTVSESSVRAPPRPVFSPGQNSQLNDRDDKARWQQPREQPPPRAGLLPKQ--PPVFGQL  226 (493)
Q Consensus       153 Lqpn~~ke~-ne--~q~~-~~~~~~~s~arap~~~~~sP~~~S~~~~~~d~~r~q~~r~q~~~r~~~~~~~--p~~~~~~  226 (493)
                      |++.++||| |-  +|.+ .+++++.++.|++.+        ||++               ++|..+-+.+  -+.+-++
T Consensus       175 ~~p~~~~e~~~pp~~qp~~q~s~~~e~p~~~~l~--------s~~~---------------~s~~i~~s~a~~qs~p~~~  231 (389)
T KOG2932|consen  175 LQPDAEKEDGNPPDVQPTMQQSSASESPLRAPLR--------SQLQ---------------QSREINRSAAKSQSGPSQV  231 (389)
T ss_pred             cCCchhhhcCCCCCCCCccccchhhcCCcccchh--------cccc---------------cccccccCccccccCchhh
Confidence            999999999 44  5555 567778888888777        4431               2222222222  2456778


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCcccccccCCCCCcccccccccCcCCCCCCCCC-CCCCCCCCceeeecCCCCCCCCC
Q 011117          227 QNYQSDAQPDGSLPPGFERPGPHNRFQQSFDMQGTPQQESSQQQGILSETQFPEYP-PMHPMQPPNFVVPMNSNPLLTPP  305 (493)
Q Consensus       227 ~~~~~~~~~~n~~p~gf~rp~~~~~~~~~~~~~~~~~~~s~~~q~~~~~~~~~~~p-~mh~~qp~n~~~~~n~np~~~~~  305 (493)
                      +|||.|.  +|..|.||+..-             |+-         ++-..|+.|+ +|.-++++|+.++||+|+-..++
T Consensus       232 ~n~P~~~--~~~~p~~~~~ap-------------Ppp---------vs~~~f~~~~~~hs~l~~~~l~~~~N~na~ep~q  287 (389)
T KOG2932|consen  232 QNYPPDS--DNSRPPGFETAP-------------PPP---------VSGIRFPDYPQPHSLLQPPSLPVPMNQNAGEPQQ  287 (389)
T ss_pred             ccCCCcc--cCCCCcccccCC-------------CCC---------ccccccccCCCCccccccCCcCCcccCCcCCCCC
Confidence            8999987  888888887653             221         4455899999 88889999999999999988776


Q ss_pred             --CCCCCC---CCCCCccC-CCCCCCCCCCCccccccccccCCCCC-CCCCCCCCCCCCC
Q 011117          306 --FPPFPT---EGSQQFYG-APFGMPRPDSVTEVGSEQASLLGFPP-GPPGGVNFPPSYS  358 (493)
Q Consensus       306 --~p~~~~---~g~~~f~~-ap~~m~~~ds~~d~g~~q~s~~g~~p-~p~~~~nf~~~~~  358 (493)
                        ||.|++   -..+.||. +.|.|.|+.+   .|++|+|+||+|| .+.++.||+++|.
T Consensus       288 ~~~p~y~~~~~~s~~h~~~~~q~h~t~~~~---~~s~~Ss~l~~pp~aagtp~~~~~~~p  344 (389)
T KOG2932|consen  288 FGFPSYPTTESGSSQHFFNGAQYHMTRTES---GGSEQSSLLGYPPPAAGTPLNFQGSYP  344 (389)
T ss_pred             CCCCcCCccccccccccccCCcccccCCCC---CCcccccccCCCCCCCCCCccCCCCCC
Confidence              788887   34678876 8999999976   6899999999865 4445667777665

>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1100 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA03096 p28-like protein; Provisional Back     alignment and domain information
>KOG3002 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>PF02891 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07975 C1_4: TFIIH C1-like domain; InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>KOG4362 consensus Transcriptional regulator BRCA1 [Replication, recombination and repair; Transcription] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query493
3vk6_A101 Crystal Structure Of A Phosphotyrosine Binding Doma 3e-13
>pdb|3VK6|A Chain A, Crystal Structure Of A Phosphotyrosine Binding Domain Length = 101 Back     alignment and structure 
Iteration: 1

 Score = 73.6 bits (179), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 33/86 (38%), Positives = 52/86 (60%), Gaps = 7/86 (8%)
Query: 69  VHFCVRCDYPIAIYGRLNPCEHVFCLDCA-----RSDSMCYLCDERIQKIQTIKLMEGIF 123
           VHFC +C  PI +YGR+ PC+HVFC DCA     + D MC  C + +Q+I+       +F
Sbjct: 1   VHFCDKCGLPIKVYGRMIPCKHVFCYDCAILHEKKGDKMCPGCSDPVQRIEQCT-RGSLF 59
Query: 124 ICAAPH-CLKSFLKKTEFEAHIHVSH 148
           +C+    C +++L + + +AHI+  H
Sbjct: 60  MCSIVQGCKRTYLSQRDLQAHINHRH 85
  Database: pdbaa

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query493
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 8e-38
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 2e-04
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 6e-04
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 2e-04
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Length = 101 Back     alignment and structure
 Score =  133 bits (334), Expect = 8e-38
 Identities = 32/99 (32%), Positives = 49/99 (49%), Gaps = 6/99 (6%)

Query: 69  VHFCVRCDYPIAIYGRLNPCEHVFCLDCA-----RSDSMCYLCDERIQKIQTIKLMEGIF 123
           VHFC +C  PI +YGR+ PC+HVFC DCA     + D MC  C + +Q+I+         
Sbjct: 1   VHFCDKCGLPIKVYGRMIPCKHVFCYDCAILHEKKGDKMCPGCSDPVQRIEQCTRGSLFM 60

Query: 124 ICAAPHCLKSFLKKTEFEAHIHVSHADLLLQPNAEKEDN 162
                 C +++L + + +AHI+  H     +P       
Sbjct: 61  CSIVQGCKRTYLSQRDLQAHINHRHMR-AGKPVTRASLE 98
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query493
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 100.0
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 98.56
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 98.55
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 98.52
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 98.44
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 98.4
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 98.36
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 98.35
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 98.35
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 98.33
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 98.33
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 98.3
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 98.3
2ect_A78 Ring finger protein 126; metal binding protein, st 98.29
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 98.28
2ysl_A73 Tripartite motif-containing protein 31; ring-type 98.28
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 98.27
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 98.27
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 98.26
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 98.26
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 98.26
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 98.25
2ecw_A85 Tripartite motif-containing protein 30; metal bind 98.25
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 98.25
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 98.23
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 98.22
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 98.21
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.2
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 98.2
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 98.19
2ecm_A55 Ring finger and CHY zinc finger domain- containing 98.18
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 98.18
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 98.17
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 98.16
2ea5_A68 Cell growth regulator with ring finger domain prot 98.14
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 98.14
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 98.13
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 98.11
2ysj_A63 Tripartite motif-containing protein 31; ring-type 98.1
1z6u_A150 NP95-like ring finger protein isoform B; structura 98.08
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 98.08
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 98.06
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 98.04
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 98.03
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 98.03
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 98.0
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 97.99
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 97.96
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 97.86
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 97.85
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 97.81
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 97.8
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 97.71
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 97.65
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 97.61
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 97.59
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 97.52
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 97.47
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 97.43
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 97.43
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 97.4
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 97.38
2f42_A179 STIP1 homology and U-box containing protein 1; cha 97.21
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 97.15
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 97.09
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 96.78
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 96.65
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 96.33
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 96.24
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 96.07
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 95.98
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 95.9
2lv2_A85 Insulinoma-associated protein 1; structural genomi 95.8
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 95.8
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 95.72
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 95.66
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 95.6
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 95.58
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 95.52
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 95.34
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 95.14
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 95.09
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 95.05
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 94.98
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 94.95
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 94.85
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 94.56
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 94.51
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 94.36
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 94.13
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 94.13
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 94.12
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 94.09
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 93.98
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 93.91
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 93.9
2epa_A72 Krueppel-like factor 10; transforming growth facto 93.72
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 93.61
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 93.32
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 93.26
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 93.18
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 92.54
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 92.08
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 92.03
1tf6_A190 Protein (transcription factor IIIA); complex (tran 91.73
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 91.62
1tf6_A190 Protein (transcription factor IIIA); complex (tran 91.57
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 91.49
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 91.09
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 91.07
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 90.72
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 90.37
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 90.34
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 90.23
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 89.94
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 89.78
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 89.6
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 89.54
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 89.11
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 89.02
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 88.74
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 88.71
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 87.96
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 87.76
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 87.49
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 87.47
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 86.8
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 86.33
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 86.1
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 85.66
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 85.43
2epa_A72 Krueppel-like factor 10; transforming growth facto 85.24
3i2d_A371 E3 SUMO-protein ligase SIZ1; signal transduction, 84.28
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 84.13
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 84.04
1z60_A59 TFIIH basal transcription factor complex P44 subun 83.44
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 83.35
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 83.18
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 82.82
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 82.36
3nw0_A238 Non-structural maintenance of chromosomes element 82.07
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 81.99
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 81.8
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 81.43
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 81.19
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 80.86
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 80.69
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 80.22
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 80.16
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
Probab=100.00  E-value=2.8e-36  Score=257.10  Aligned_cols=82  Identities=40%  Similarity=0.993  Sum_probs=78.9

Q ss_pred             cccccCCCccccccccccccccccchhhhh-----CCCCcccchHhHhhheeeecCCcEEEec-CCchhhhhcChhHHHH
Q 011117           69 VHFCVRCDYPIAIYGRLNPCEHVFCLDCAR-----SDSMCYLCDERIQKIQTIKLMEGIFICA-APHCLKSFLKKTEFEA  142 (493)
Q Consensus        69 vhFCdICdlPI~iygRmIPCKHVFCydCA~-----sDktCP~Cna~VqrIEri~p~esIFIC~-~~gCkRtYLSqRDLQA  142 (493)
                      +|||++|++||++|||||||||||||+||.     .+++||+|+++|++||++. +|+||||+ +++|+|||||+|||||
T Consensus         1 ~hfC~~C~~Pi~iygRmIPCkHvFCydCa~~~~~~~~k~Cp~C~~~V~rVe~~~-~~~if~C~~~~~CkrtyLs~rdlqa   79 (101)
T 3vk6_A            1 VHFCDKCGLPIKVYGRMIPCKHVFCYDCAILHEKKGDKMCPGCSDPVQRIEQCT-RGSLFMCSIVQGCKRTYLSQRDLQA   79 (101)
T ss_dssp             CCBCTTTCSBCSEEEEEETTCCEEEHHHHHHHHHTTCCBCTTTCCBCSEEEEEE-GGGCCCCCCCCCCCCCCSSHHHHHH
T ss_pred             CeecCccCCCeEEEeeeccccccHHHHHHHHHHhccCCCCcCcCCeeeeeEEec-cCCEEECCCCCCHHHHhcCHHHHHH
Confidence            599999999999999999999999999995     5799999999999999986 59999999 9999999999999999


Q ss_pred             hhhhhhccc
Q 011117          143 HIHVSHADL  151 (493)
Q Consensus       143 HInhrH~~l  151 (493)
                      ||||+|++.
T Consensus        80 HI~~~H~~~   88 (101)
T 3vk6_A           80 HINHRHMRA   88 (101)
T ss_dssp             HHHHHTTTS
T ss_pred             HHHHHhhhc
Confidence            999999998
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>3i2d_A E3 SUMO-protein ligase SIZ1; signal transduction, replication, ring E3, PIAS, ubiquitin, UBC9, metal-binding, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1z60_A TFIIH basal transcription factor complex P44 subunit; basic transcription factor, zinc binding protein, ring finger; NMR {Homo sapiens} SCOP: g.49.1.2 Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 493
d1chca_68 g.44.1.1 (A:) Immediate early protein, IEEHV {Equi 0.004
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: Immediate early protein, IEEHV
species: Equine herpesvirus 1 [TaxId: 10326]

 Score = 33.8 bits (77), Expect = 0.004
 Identities = 13/46 (28%), Positives = 18/46 (39%), Gaps = 4/46 (8%)

Query: 72  CVRCDYPIAIYGRLNPCEHVFCLDC----ARSDSMCYLCDERIQKI 113
           C  C    + Y    PC H FC  C     R +  C LC   ++ +
Sbjct: 8   CPICLEDPSNYSMALPCLHAFCYVCITRWIRQNPTCPLCKVPVESV 53

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query493
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 98.61
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 98.38
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 98.37
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 98.29
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 98.16
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 98.15
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 98.1
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 98.09
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 97.98
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 97.94
d2c2la280 STIP1 homology and U box-containing protein 1, STU 97.92
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 97.79
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 97.77
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 97.37
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 97.36
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 96.79
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 95.85
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 94.61
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 94.31
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 93.79
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 93.74
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 93.56
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 93.12
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 92.26
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 92.24
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 91.66
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 88.72
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 87.86
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 86.9
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 85.73
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 85.71
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 85.53
d1z60a159 TFIIH p44 subunit cysteine-rich domain {Human (Hom 82.02
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: Immediate early protein, IEEHV
species: Equine herpesvirus 1 [TaxId: 10326]

Probab=98.61  E-value=2.4e-09  Score=80.80  Aligned_cols=47  Identities=26%  Similarity=0.605  Sum_probs=40.5

Q ss_pred             cccccCCCccccccccccccccccchhhhh----CCCCcccchHhHhhhee
Q 011117           69 VHFCVRCDYPIAIYGRLNPCEHVFCLDCAR----SDSMCYLCDERIQKIQT  115 (493)
Q Consensus        69 vhFCdICdlPI~iygRmIPCKHVFCydCA~----sDktCP~Cna~VqrIEr  115 (493)
                      .-.|+||-..|....+++||+|+||.+|+.    ...+||.|+.+|..+..
T Consensus         5 ~d~C~IC~~~~~~~~~~~~C~H~Fc~~Ci~~w~~~~~~CP~CR~~i~~~~~   55 (68)
T d1chca_           5 AERCPICLEDPSNYSMALPCLHAFCYVCITRWIRQNPTCPLCKVPVESVVH   55 (68)
T ss_dssp             CCCCSSCCSCCCSCEEETTTTEEESTTHHHHHHHHSCSTTTTCCCCCCEEC
T ss_pred             CCCCccCCcCccCCcEEeCCCCcCcHHHHHHHHHhCCcCCCCCcchHhhcc
Confidence            457999998888888899999999999998    55789999998876553
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1z60a1 g.49.1.2 (A:328-386) TFIIH p44 subunit cysteine-rich domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure