Citrus Sinensis ID: 011140
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 492 | 2.2.26 [Sep-21-2011] | |||||||
| Q6VNB8 | 3508 | WD repeat and FYVE domain | yes | no | 0.168 | 0.023 | 0.385 | 1e-13 | |
| Q8IZQ1 | 3526 | WD repeat and FYVE domain | yes | no | 0.168 | 0.023 | 0.385 | 1e-13 | |
| Q15075 | 1411 | Early endosome antigen 1 | no | no | 0.115 | 0.040 | 0.525 | 1e-13 | |
| Q54CH1 | 580 | Arrestin domain-containin | yes | no | 0.119 | 0.101 | 0.508 | 4e-13 | |
| Q8BL66 | 1411 | Early endosome antigen 1 | no | no | 0.115 | 0.040 | 0.508 | 2e-12 | |
| Q9TZD0 | 661 | Lateral signaling target | yes | no | 0.126 | 0.093 | 0.483 | 2e-12 | |
| A8XJZ8 | 651 | Lateral signaling target | N/A | no | 0.126 | 0.095 | 0.483 | 3e-12 | |
| Q0P4S0 | 951 | Lateral signaling target | no | no | 0.119 | 0.062 | 0.508 | 3e-12 | |
| Q9HCC9 | 887 | Lateral signaling target | no | no | 0.121 | 0.067 | 0.5 | 6e-12 | |
| Q6ZPK7 | 905 | Lateral signaling target | no | no | 0.121 | 0.066 | 0.483 | 1e-11 |
| >sp|Q6VNB8|WDFY3_MOUSE WD repeat and FYVE domain-containing protein 3 OS=Mus musculus GN=Wdfy3 PE=1 SV=1 | Back alignment and function desciption |
|---|
Score = 78.6 bits (192), Expect = 1e-13, Method: Compositional matrix adjust.
Identities = 32/83 (38%), Positives = 42/83 (50%)
Query: 398 TGEQKKGFADWMNLMKPGNEEKDHWVPDEAVSKCTACGTDFSAFVRKHHCRNCGDIFCDK 457
G+ + W +PG DHWV DE C+ C FS R+HHCRNCG +FC K
Sbjct: 3409 VGDSRGRVFSWSVSDQPGRSAADHWVKDEGGDSCSGCSVRFSLTERRHHCRNCGQLFCQK 3468
Query: 458 CTHGRIALTADANAQPVRVCDRC 480
C+ + + + PVRVC C
Sbjct: 3469 CSRFQSEIKRLKISSPVRVCQNC 3491
|
Mus musculus (taxid: 10090) |
| >sp|Q8IZQ1|WDFY3_HUMAN WD repeat and FYVE domain-containing protein 3 OS=Homo sapiens GN=WDFY3 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q15075|EEA1_HUMAN Early endosome antigen 1 OS=Homo sapiens GN=EEA1 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q54CH1|ADCA_DICDI Arrestin domain-containing protein A OS=Dictyostelium discoideum GN=adcA PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q8BL66|EEA1_MOUSE Early endosome antigen 1 OS=Mus musculus GN=Eea1 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q9TZD0|LST2_CAEEL Lateral signaling target protein 2 OS=Caenorhabditis elegans GN=lst-2 PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|A8XJZ8|LST2_CAEBR Lateral signaling target protein 2 OS=Caenorhabditis briggsae GN=lst-2 PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q0P4S0|LST2_XENTR Lateral signaling target protein 2 homolog OS=Xenopus tropicalis GN=zfyve28 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9HCC9|LST2_HUMAN Lateral signaling target protein 2 homolog OS=Homo sapiens GN=ZFYVE28 PE=1 SV=3 | Back alignment and function description |
|---|
| >sp|Q6ZPK7|LST2_MOUSE Lateral signaling target protein 2 homolog OS=Mus musculus GN=Zfyve28 PE=1 SV=2 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 492 | ||||||
| 225457901 | 585 | PREDICTED: uncharacterized protein LOC10 | 0.941 | 0.791 | 0.650 | 1e-177 | |
| 255539014 | 603 | zinc finger protein, putative [Ricinus c | 0.967 | 0.789 | 0.666 | 1e-176 | |
| 147787645 | 528 | hypothetical protein VITISV_027811 [Viti | 0.930 | 0.867 | 0.649 | 1e-175 | |
| 317106594 | 601 | JHL20J20.9 [Jatropha curcas] | 0.977 | 0.800 | 0.666 | 1e-175 | |
| 449437190 | 591 | PREDICTED: uncharacterized protein LOC10 | 0.963 | 0.802 | 0.620 | 1e-153 | |
| 356517818 | 548 | PREDICTED: uncharacterized protein LOC10 | 0.920 | 0.826 | 0.625 | 1e-151 | |
| 297844980 | 967 | hypothetical protein ARALYDRAFT_312939 [ | 0.971 | 0.494 | 0.577 | 1e-149 | |
| 18394823 | 601 | RING/FYVE/PHD zinc finger-containing pro | 0.961 | 0.787 | 0.577 | 1e-148 | |
| 8778986 | 967 | Contains similarity to an unknown mRNA f | 0.961 | 0.489 | 0.579 | 1e-146 | |
| 357466985 | 549 | Lateral signaling target protein-like pr | 0.898 | 0.805 | 0.599 | 1e-143 |
| >gi|225457901|ref|XP_002271105.1| PREDICTED: uncharacterized protein LOC100259195 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 629 bits (1621), Expect = e-177, Method: Compositional matrix adjust.
Identities = 343/527 (65%), Positives = 389/527 (73%), Gaps = 64/527 (12%)
Query: 1 MQQGDYSSY-YHQY------------------PNPNPNPAVDLQPRSYASAPPFSTSYSP 41
MQQGDY+S Y+QY +P PNP+ P +YASAPPF+TSYSP
Sbjct: 1 MQQGDYNSVSYYQYQHPQNPNPNPIPNPNSIPIDPQPNPS----PSTYASAPPFTTSYSP 56
Query: 42 SDYSGGYPQNYPPYPQNSDPVP---PTAPSYTPATPTATPSSPNPNSLSSFNPIPPQQFP 98
SDYS Y YPPYPQN +PVP PTAPSY+P SPN L SFNP P
Sbjct: 57 SDYSV-YTPAYPPYPQNPEPVPNIPPTAPSYSP--------SPN---LQSFNPSPQPSSF 104
Query: 99 PY-DSHAPYQPPQQPPAFYPPFDQHQTGPNYAPPNPNPNS-------PYSSTPFSHVGST 150
P ++ YQPP Q P ++P +DQH T PN++ P PN N+ P S +SHVGS+
Sbjct: 105 PPFEAQGSYQPPAQQPPYHPQYDQHLTAPNFSNPIPNSNANPSYANPPAYSASYSHVGSS 164
Query: 151 VPPVYDNLYENPNSVKFDSGGGYFDD---KYGGYNGSRSNLGSDLYAKRPESVNLPLYD- 206
VPPVY+N YE + KFD GGYFD+ +YGGY+ +RS+LGS++Y+KR +S YD
Sbjct: 165 VPPVYENPYET--TPKFDQTGGYFDETSGRYGGYSRTRSDLGSEMYSKRSDSGVSSRYDL 222
Query: 207 -----DGYGDGVYAYEGGKLEPYGARGTVPKSSNSTLFDDYGRSISFPSAKDSRSSVGSG 261
DGYGDGVYAYEG K+EPYGARGT PKSS FDDYGRSISFPS KD
Sbjct: 223 GSIRDDGYGDGVYAYEGSKVEPYGARGTAPKSSTWVGFDDYGRSISFPSGKDQ------P 276
Query: 262 SSKIVRAVPKVDTHQDVKSGVQKFRVKLLAESGGQSTMDVLCQIGLDGIRMLDPNTSRTL 321
S+KIVRAVPK +T QDVKSGVQKFRVKLL+E GGQS+MDVLCQIGLDGIRML+P+TSRTL
Sbjct: 277 SAKIVRAVPKAETQQDVKSGVQKFRVKLLSEGGGQSSMDVLCQIGLDGIRMLEPSTSRTL 336
Query: 322 RIYPLENITRCELADSSTLAFWSKSSVDIEPRRIRLQSNSYTATTLLDIVTAATVQLKEM 381
RIYPLE ITRCE+ DSST AFWSKSSVDIEPRRIRLQSNSYT T+LD VTAATVQ+KEM
Sbjct: 337 RIYPLETITRCEVTDSSTFAFWSKSSVDIEPRRIRLQSNSYTTNTILDTVTAATVQIKEM 396
Query: 382 GGGRSRSSDSLKTAEQTGEQKKGFADWMNLMKPGNEEKDHWVPDEAVSKCTACGTDFSAF 441
GGRSR S+SLKT EQ E+KKGFADWMN++KPGNEEKDHWVPDEAV+KCTACGTDF AF
Sbjct: 397 -GGRSRPSESLKTTEQPTEKKKGFADWMNIIKPGNEEKDHWVPDEAVTKCTACGTDFGAF 455
Query: 442 VRKHHCRNCGDIFCDKCTHGRIALTADANAQPVRVCDRCMVGVIDWL 488
VR+HHCRNCGDIFCDKCTHGRIALTAD +AQPVRVCDRCM V L
Sbjct: 456 VRRHHCRNCGDIFCDKCTHGRIALTADESAQPVRVCDRCMAEVTQRL 502
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255539014|ref|XP_002510572.1| zinc finger protein, putative [Ricinus communis] gi|223551273|gb|EEF52759.1| zinc finger protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|147787645|emb|CAN63053.1| hypothetical protein VITISV_027811 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|317106594|dbj|BAJ53102.1| JHL20J20.9 [Jatropha curcas] | Back alignment and taxonomy information |
|---|
| >gi|449437190|ref|XP_004136375.1| PREDICTED: uncharacterized protein LOC101213650 [Cucumis sativus] gi|449515524|ref|XP_004164799.1| PREDICTED: uncharacterized LOC101213650 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356517818|ref|XP_003527583.1| PREDICTED: uncharacterized protein LOC100794840 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|297844980|ref|XP_002890371.1| hypothetical protein ARALYDRAFT_312939 [Arabidopsis lyrata subsp. lyrata] gi|297336213|gb|EFH66630.1| hypothetical protein ARALYDRAFT_312939 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|18394823|ref|NP_564103.1| RING/FYVE/PHD zinc finger-containing protein [Arabidopsis thaliana] gi|13605833|gb|AAK32902.1|AF367315_1 At1g20110/T20H2_10 [Arabidopsis thaliana] gi|16226228|gb|AAL16109.1|AF428277_1 At1g20110/T20H2_10 [Arabidopsis thaliana] gi|23506043|gb|AAN28881.1| At1g20110/T20H2_10 [Arabidopsis thaliana] gi|332191816|gb|AEE29937.1| RING/FYVE/PHD zinc finger-containing protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|8778986|gb|AAF79901.1|AC022472_10 Contains similarity to an unknown mRNA from Triticum sativum gb|AF004816 and contains a Lipase/Acylhydrolase with GDSL-like motif PF|00657 and FYVE zinc finger PF|01363 domain. ESTs gb|AV541158, gb|AA394699, gb|AI993442, gb|T88167, gb|BE038227, gb|AI993489, gb|T88521 come from this gene [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|357466985|ref|XP_003603777.1| Lateral signaling target protein-like protein [Medicago truncatula] gi|355492825|gb|AES74028.1| Lateral signaling target protein-like protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 492 | ||||||
| TAIR|locus:2198646 | 601 | AT1G20110 [Arabidopsis thalian | 0.658 | 0.539 | 0.629 | 2.4e-110 | |
| UNIPROTKB|Q49AA1 | 192 | ZFYVE28 "ZFYVE28 protein" [Hom | 0.130 | 0.333 | 0.484 | 8.1e-14 | |
| UNIPROTKB|E2RPX2 | 234 | ZFYVE21 "Uncharacterized prote | 0.136 | 0.286 | 0.432 | 6.9e-12 | |
| ZFIN|ZDB-GENE-070705-153 | 3522 | si:ch211-259k10.1 "si:ch211-25 | 0.166 | 0.023 | 0.402 | 1.5e-11 | |
| ZFIN|ZDB-GENE-030131-1296 | 252 | zfyve21 "zinc finger, FYVE dom | 0.136 | 0.265 | 0.432 | 2.5e-11 | |
| UNIPROTKB|F1S8Q3 | 866 | ZFYVE28 "Uncharacterized prote | 0.134 | 0.076 | 0.484 | 3e-11 | |
| UNIPROTKB|Q0P4S0 | 951 | zfyve28 "Lateral signaling tar | 0.130 | 0.067 | 0.484 | 3.1e-11 | |
| UNIPROTKB|F1S8Q5 | 903 | ZFYVE28 "Uncharacterized prote | 0.134 | 0.073 | 0.484 | 3.2e-11 | |
| UNIPROTKB|I3LHY3 | 931 | ZFYVE28 "Uncharacterized prote | 0.134 | 0.070 | 0.484 | 3.3e-11 | |
| RGD|1307097 | 3505 | Wdfy3 "WD repeat and FYVE doma | 0.166 | 0.023 | 0.390 | 3.3e-11 |
| TAIR|locus:2198646 AT1G20110 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1046 (373.3 bits), Expect = 2.4e-110, Sum P(2) = 2.4e-110
Identities = 212/337 (62%), Positives = 235/337 (69%)
Query: 148 GSTVPPVYDNLYENPNSVKFXXXXXXXXXXXXXXXXSRSNLGSDLYAKRPESVNLPLXXX 207
GS++PP Y E P SVKF SRS+LGSDLY KR +S P
Sbjct: 191 GSSIPPSY----EKP-SVKFDQSGYDGYNR------SRSDLGSDLYGKRSDSGEYPAFED 239
Query: 208 XXXXXXXXXXXXKLEPYGARGTVPKSSNSTLFDDYGRSISFPXXXXXXXXXXXXXXXXXX 267
K+EPYG+RGT PKSSNSTLFDDYGRSISF
Sbjct: 240 SYGDGVYAYQGGKVEPYGSRGTAPKSSNSTLFDDYGRSISF-SSSGRDSSVSSNSAKIVR 298
Query: 268 AVPKVDTHQDVKSGVQKFRVKLLAESGGQSTMDVLCQIGLDGIRMLDPNTSRTLRIYPLE 327
AVPK D +D GVQKFRVKLLAE+ GQ+T DVLCQIGLDG+RMLDP+TSRTLRIYPLE
Sbjct: 299 AVPKADVQEDSTGGVQKFRVKLLAETYGQTTTDVLCQIGLDGLRMLDPSTSRTLRIYPLE 358
Query: 328 NITRCELADSSTLAFWSKSSVDIEPRRIRLQSNSYTATTLLDIVTAATVQLKEMGGGRSR 387
NITRCE DSS LAFWSK+ VDIE +RIRLQSNSYT TLLD VTAA Q KE+GG SR
Sbjct: 359 NITRCEKLDSSILAFWSKTPVDIEAKRIRLQSNSYTTNTLLDTVTAAMFQAKEIGGS-SR 417
Query: 388 SSDSLKTAEQTGEQKKGFADWMNLMKPGNEEKDHWVPDEAVSKCTACGTDFSAFVRKHHC 447
S K EQT E+KKG DWMN++KP NEEKDHWVPDEAVSKCT+CG+DF AF+R+HHC
Sbjct: 418 PPTSGKLIEQTAEKKKGLGDWMNIIKPVNEEKDHWVPDEAVSKCTSCGSDFGAFIRRHHC 477
Query: 448 RNCGDIFCDKCTHGRIALTADANAQPVRVCDRCMVGV 484
RNCGD+FCDKCT GRIALTA+ NA VRVCDRCM V
Sbjct: 478 RNCGDVFCDKCTQGRIALTAEDNAPQVRVCDRCMAEV 514
|
|
| UNIPROTKB|Q49AA1 ZFYVE28 "ZFYVE28 protein" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RPX2 ZFYVE21 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-070705-153 si:ch211-259k10.1 "si:ch211-259k10.1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030131-1296 zfyve21 "zinc finger, FYVE domain containing 21" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1S8Q3 ZFYVE28 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q0P4S0 zfyve28 "Lateral signaling target protein 2 homolog" [Xenopus (Silurana) tropicalis (taxid:8364)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1S8Q5 ZFYVE28 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3LHY3 ZFYVE28 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| RGD|1307097 Wdfy3 "WD repeat and FYVE domain containing 3" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
No EC number assignment, probably not an enzyme!
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 492 | |||
| smart00064 | 68 | smart00064, FYVE, Protein present in Fab1, YOTB, V | 1e-28 | |
| pfam01363 | 68 | pfam01363, FYVE, FYVE zinc finger | 8e-26 | |
| cd00065 | 57 | cd00065, FYVE, FYVE domain; Zinc-binding domain; t | 2e-23 | |
| pfam04652 | 315 | pfam04652, DUF605, Vta1 like | 3e-07 | |
| pfam09770 | 804 | pfam09770, PAT1, Topoisomerase II-associated prote | 3e-06 | |
| pfam09770 | 804 | pfam09770, PAT1, Topoisomerase II-associated prote | 6e-06 | |
| PRK10263 | 1355 | PRK10263, PRK10263, DNA translocase FtsK; Provisio | 8e-06 | |
| pfam04652 | 315 | pfam04652, DUF605, Vta1 like | 1e-05 | |
| pfam07223 | 357 | pfam07223, DUF1421, Protein of unknown function (D | 2e-05 | |
| PRK14086 | 617 | PRK14086, dnaA, chromosomal replication initiation | 2e-05 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 6e-05 | |
| PRK10263 | 1355 | PRK10263, PRK10263, DNA translocase FtsK; Provisio | 1e-04 | |
| cd01273 | 144 | cd01273, PTB_CED-6, Cell death protein 6 homolog ( | 1e-04 | |
| cd00934 | 119 | cd00934, PTB, Phosphotyrosine-binding (PTB) PH-lik | 2e-04 | |
| PRK14950 | 585 | PRK14950, PRK14950, DNA polymerase III subunits ga | 3e-04 | |
| pfam07223 | 357 | pfam07223, DUF1421, Protein of unknown function (D | 4e-04 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 4e-04 | |
| pfam08416 | 131 | pfam08416, PTB, Phosphotyrosine-binding domain | 4e-04 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 5e-04 | |
| pfam09770 | 804 | pfam09770, PAT1, Topoisomerase II-associated prote | 6e-04 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 6e-04 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 6e-04 | |
| pfam07415 | 489 | pfam07415, Herpes_LMP2, Gammaherpesvirus latent me | 7e-04 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 0.002 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 0.002 | |
| PRK14950 | 585 | PRK14950, PRK14950, DNA polymerase III subunits ga | 0.002 | |
| cd01210 | 131 | cd01210, PTB_EPS8, Epidermal growth factor recepto | 0.002 | |
| PRK03427 | 333 | PRK03427, PRK03427, cell division protein ZipA; Pr | 0.002 | |
| TIGR01628 | 562 | TIGR01628, PABP-1234, polyadenylate binding protei | 0.003 |
| >gnl|CDD|214499 smart00064, FYVE, Protein present in Fab1, YOTB, Vac1, and EEA1 | Back alignment and domain information |
|---|
Score = 107 bits (268), Expect = 1e-28
Identities = 32/64 (50%), Positives = 40/64 (62%)
Query: 419 KDHWVPDEAVSKCTACGTDFSAFVRKHHCRNCGDIFCDKCTHGRIALTADANAQPVRVCD 478
+ HW+PDE VS C CG +F+ R+HHCRNCG IFC KC+ + L +PVRVCD
Sbjct: 1 RPHWIPDEEVSNCMGCGKEFNLTKRRHHCRNCGRIFCSKCSSKKAPLPKLGIERPVRVCD 60
Query: 479 RCMV 482
C
Sbjct: 61 DCYE 64
|
The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the PHD finger and the RING finger. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. The FYVE finger functions in the membrane recruitment of cytosolic proteins by binding to phosphatidylinositol 3-phosphate (PI3P), which is prominent on endosomes. The R+HHC+XCG motif is critical for PI3P binding. Length = 68 |
| >gnl|CDD|216454 pfam01363, FYVE, FYVE zinc finger | Back alignment and domain information |
|---|
| >gnl|CDD|238022 cd00065, FYVE, FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1; | Back alignment and domain information |
|---|
| >gnl|CDD|218191 pfam04652, DUF605, Vta1 like | Back alignment and domain information |
|---|
| >gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 | Back alignment and domain information |
|---|
| >gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 | Back alignment and domain information |
|---|
| >gnl|CDD|236669 PRK10263, PRK10263, DNA translocase FtsK; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218191 pfam04652, DUF605, Vta1 like | Back alignment and domain information |
|---|
| >gnl|CDD|219339 pfam07223, DUF1421, Protein of unknown function (DUF1421) | Back alignment and domain information |
|---|
| >gnl|CDD|237605 PRK14086, dnaA, chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236669 PRK10263, PRK10263, DNA translocase FtsK; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|241303 cd01273, PTB_CED-6, Cell death protein 6 homolog (CED-6/GULP1) Phosphotyrosine-binding (PTB) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241236 cd00934, PTB, Phosphotyrosine-binding (PTB) PH-like fold | Back alignment and domain information |
|---|
| >gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219339 pfam07223, DUF1421, Protein of unknown function (DUF1421) | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219831 pfam08416, PTB, Phosphotyrosine-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219404 pfam07415, Herpes_LMP2, Gammaherpesvirus latent membrane protein (LMP2) protein | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|241246 cd01210, PTB_EPS8, Epidermal growth factor receptor kinase substrate (EPS8)-like Phosphotyrosine-binding (PTB) domain | Back alignment and domain information |
|---|
| >gnl|CDD|235124 PRK03427, PRK03427, cell division protein ZipA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 492 | |||
| PF01363 | 69 | FYVE: FYVE zinc finger; InterPro: IPR000306 Zinc f | 99.76 | |
| smart00064 | 68 | FYVE Protein present in Fab1, YOTB, Vac1, and EEA1 | 99.69 | |
| KOG1818 | 634 | consensus Membrane trafficking and cell signaling | 99.66 | |
| KOG1729 | 288 | consensus FYVE finger containing protein [General | 99.64 | |
| PTZ00303 | 1374 | phosphatidylinositol kinase; Provisional | 99.5 | |
| KOG1819 | 990 | consensus FYVE finger-containing proteins [General | 99.44 | |
| cd00065 | 57 | FYVE FYVE domain; Zinc-binding domain; targets pro | 99.43 | |
| KOG1842 | 505 | consensus FYVE finger-containing protein [General | 99.35 | |
| KOG0509 | 600 | consensus Ankyrin repeat and DHHC-type Zn-finger d | 99.1 | |
| PF13857 | 56 | Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A | 98.99 | |
| KOG1841 | 1287 | consensus Smad anchor for receptor activation [Def | 98.96 | |
| KOG4412 | 226 | consensus 26S proteasome regulatory complex, subun | 98.95 | |
| KOG0509 | 600 | consensus Ankyrin repeat and DHHC-type Zn-finger d | 98.85 | |
| PHA02859 | 209 | ankyrin repeat protein; Provisional | 98.8 | |
| KOG4412 | 226 | consensus 26S proteasome regulatory complex, subun | 98.79 | |
| PHA02878 | 477 | ankyrin repeat protein; Provisional | 98.76 | |
| PHA02736 | 154 | Viral ankyrin protein; Provisional | 98.74 | |
| PHA02743 | 166 | Viral ankyrin protein; Provisional | 98.74 | |
| KOG0508 | 615 | consensus Ankyrin repeat protein [General function | 98.72 | |
| KOG0195 | 448 | consensus Integrin-linked kinase [Signal transduct | 98.7 | |
| PHA02791 | 284 | ankyrin-like protein; Provisional | 98.69 | |
| PF12796 | 89 | Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 | 98.68 | |
| PHA02875 | 413 | ankyrin repeat protein; Provisional | 98.68 | |
| PHA02859 | 209 | ankyrin repeat protein; Provisional | 98.68 | |
| PHA02791 | 284 | ankyrin-like protein; Provisional | 98.67 | |
| PHA02741 | 169 | hypothetical protein; Provisional | 98.67 | |
| PHA02884 | 300 | ankyrin repeat protein; Provisional | 98.66 | |
| KOG4177 | 1143 | consensus Ankyrin [Cell wall/membrane/envelope bio | 98.66 | |
| PHA02989 | 494 | ankyrin repeat protein; Provisional | 98.66 | |
| PHA03095 | 471 | ankyrin-like protein; Provisional | 98.64 | |
| PHA02795 | 437 | ankyrin-like protein; Provisional | 98.63 | |
| KOG0510 | 929 | consensus Ankyrin repeat protein [General function | 98.63 | |
| PF12796 | 89 | Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 | 98.61 | |
| KOG0512 | 228 | consensus Fetal globin-inducing factor (contains a | 98.6 | |
| PHA02946 | 446 | ankyin-like protein; Provisional | 98.59 | |
| KOG1409 | 404 | consensus Uncharacterized conserved protein, conta | 98.58 | |
| PHA03095 | 471 | ankyrin-like protein; Provisional | 98.57 | |
| PHA02874 | 434 | ankyrin repeat protein; Provisional | 98.57 | |
| PHA02741 | 169 | hypothetical protein; Provisional | 98.56 | |
| KOG0508 | 615 | consensus Ankyrin repeat protein [General function | 98.54 | |
| PHA02716 | 764 | CPXV016; CPX019; EVM010; Provisional | 98.53 | |
| PHA02874 | 434 | ankyrin repeat protein; Provisional | 98.53 | |
| PHA02798 | 489 | ankyrin-like protein; Provisional | 98.52 | |
| PLN03192 | 823 | Voltage-dependent potassium channel; Provisional | 98.5 | |
| KOG1843 | 473 | consensus Uncharacterized conserved protein [Funct | 98.5 | |
| PHA02875 | 413 | ankyrin repeat protein; Provisional | 98.49 | |
| PHA02946 | 446 | ankyin-like protein; Provisional | 98.49 | |
| PHA02878 | 477 | ankyrin repeat protein; Provisional | 98.48 | |
| PF13637 | 54 | Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A | 98.47 | |
| PHA03100 | 480 | ankyrin repeat protein; Provisional | 98.46 | |
| PHA02730 | 672 | ankyrin-like protein; Provisional | 98.43 | |
| PHA02884 | 300 | ankyrin repeat protein; Provisional | 98.43 | |
| PHA02917 | 661 | ankyrin-like protein; Provisional | 98.42 | |
| PLN03192 | 823 | Voltage-dependent potassium channel; Provisional | 98.41 | |
| PTZ00322 | 664 | 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas | 98.4 | |
| PHA02876 | 682 | ankyrin repeat protein; Provisional | 98.39 | |
| COG0666 | 235 | Arp FOG: Ankyrin repeat [General function predicti | 98.35 | |
| KOG0502 | 296 | consensus Integral membrane ankyrin-repeat protein | 98.34 | |
| PHA02989 | 494 | ankyrin repeat protein; Provisional | 98.33 | |
| PHA03100 | 480 | ankyrin repeat protein; Provisional | 98.33 | |
| PHA02798 | 489 | ankyrin-like protein; Provisional | 98.33 | |
| KOG0514 | 452 | consensus Ankyrin repeat protein [General function | 98.32 | |
| PHA02716 | 764 | CPXV016; CPX019; EVM010; Provisional | 98.29 | |
| TIGR00870 | 743 | trp transient-receptor-potential calcium channel p | 98.29 | |
| PHA02876 | 682 | ankyrin repeat protein; Provisional | 98.29 | |
| PHA02743 | 166 | Viral ankyrin protein; Provisional | 98.28 | |
| PHA02792 | 631 | ankyrin-like protein; Provisional | 98.27 | |
| PHA02736 | 154 | Viral ankyrin protein; Provisional | 98.26 | |
| PHA02917 | 661 | ankyrin-like protein; Provisional | 98.24 | |
| KOG4424 | 623 | consensus Predicted Rho/Rac guanine nucleotide exc | 98.22 | |
| KOG0502 | 296 | consensus Integral membrane ankyrin-repeat protein | 98.19 | |
| KOG0510 | 929 | consensus Ankyrin repeat protein [General function | 98.14 | |
| PF13857 | 56 | Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A | 98.14 | |
| PHA02795 | 437 | ankyrin-like protein; Provisional | 98.08 | |
| KOG0505 | 527 | consensus Myosin phosphatase, regulatory subunit [ | 98.08 | |
| KOG4214 | 117 | consensus Myotrophin and similar proteins [Transcr | 98.06 | |
| KOG1811 | 1141 | consensus Predicted Zn2+-binding protein, contains | 98.03 | |
| COG0666 | 235 | Arp FOG: Ankyrin repeat [General function predicti | 98.02 | |
| KOG0505 | 527 | consensus Myosin phosphatase, regulatory subunit [ | 98.0 | |
| KOG0515 | 752 | consensus p53-interacting protein 53BP/ASPP, conta | 97.99 | |
| KOG1710 | 396 | consensus MYND Zn-finger and ankyrin repeat protei | 97.97 | |
| PHA02730 | 672 | ankyrin-like protein; Provisional | 97.97 | |
| cd00204 | 126 | ANK ankyrin repeats; ankyrin repeats mediate prote | 97.95 | |
| PTZ00322 | 664 | 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas | 97.95 | |
| KOG4177 | 1143 | consensus Ankyrin [Cell wall/membrane/envelope bio | 97.91 | |
| KOG0512 | 228 | consensus Fetal globin-inducing factor (contains a | 97.88 | |
| cd00204 | 126 | ANK ankyrin repeats; ankyrin repeats mediate prote | 97.85 | |
| KOG0783 | 1267 | consensus Uncharacterized conserved protein, conta | 97.79 | |
| KOG0507 | 854 | consensus CASK-interacting adaptor protein (caskin | 97.75 | |
| KOG3676 | 782 | consensus Ca2+-permeable cation channel OSM-9 and | 97.74 | |
| PF13637 | 54 | Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A | 97.71 | |
| KOG0507 | 854 | consensus CASK-interacting adaptor protein (caskin | 97.7 | |
| PF00023 | 33 | Ank: Ankyrin repeat Hereditary spherocytosis; Inte | 97.7 | |
| KOG0514 | 452 | consensus Ankyrin repeat protein [General function | 97.62 | |
| PHA02792 | 631 | ankyrin-like protein; Provisional | 97.59 | |
| KOG0195 | 448 | consensus Integrin-linked kinase [Signal transduct | 97.57 | |
| PF13606 | 30 | Ank_3: Ankyrin repeat | 97.55 | |
| KOG0515 | 752 | consensus p53-interacting protein 53BP/ASPP, conta | 97.5 | |
| TIGR00870 | 743 | trp transient-receptor-potential calcium channel p | 97.46 | |
| KOG0260 | 1605 | consensus RNA polymerase II, large subunit [Transc | 97.32 | |
| KOG0521 | 785 | consensus Putative GTPase activating proteins (GAP | 97.24 | |
| KOG0522 | 560 | consensus Ankyrin repeat protein [General function | 97.24 | |
| PF00023 | 33 | Ank: Ankyrin repeat Hereditary spherocytosis; Inte | 97.08 | |
| KOG4214 | 117 | consensus Myotrophin and similar proteins [Transcr | 97.07 | |
| KOG4369 | 2131 | consensus RTK signaling protein MASK/UNC-44 [Signa | 96.94 | |
| KOG0818 | 669 | consensus GTPase-activating proteins of the GIT fa | 96.75 | |
| KOG0705 | 749 | consensus GTPase-activating protein Centaurin gamm | 96.7 | |
| PF13606 | 30 | Ank_3: Ankyrin repeat | 96.67 | |
| PF02318 | 118 | FYVE_2: FYVE-type zinc finger; InterPro: IPR003315 | 96.65 | |
| KOG3676 | 782 | consensus Ca2+-permeable cation channel OSM-9 and | 96.57 | |
| KOG4369 | 2131 | consensus RTK signaling protein MASK/UNC-44 [Signa | 96.57 | |
| KOG0260 | 1605 | consensus RNA polymerase II, large subunit [Transc | 96.5 | |
| KOG0230 | 1598 | consensus Phosphatidylinositol-4-phosphate 5-kinas | 96.34 | |
| KOG0230 | 1598 | consensus Phosphatidylinositol-4-phosphate 5-kinas | 95.95 | |
| KOG1924 | 1102 | consensus RhoA GTPase effector DIA/Diaphanous [Sig | 95.79 | |
| KOG0506 | 622 | consensus Glutaminase (contains ankyrin repeat) [A | 95.73 | |
| KOG1924 | 1102 | consensus RhoA GTPase effector DIA/Diaphanous [Sig | 95.6 | |
| KOG0705 | 749 | consensus GTPase-activating protein Centaurin gamm | 95.41 | |
| KOG1710 | 396 | consensus MYND Zn-finger and ankyrin repeat protei | 95.3 | |
| KOG0783 | 1267 | consensus Uncharacterized conserved protein, conta | 94.8 | |
| KOG0511 | 516 | consensus Ankyrin repeat protein [General function | 94.77 | |
| KOG0818 | 669 | consensus GTPase-activating proteins of the GIT fa | 94.47 | |
| KOG0782 | 1004 | consensus Predicted diacylglycerol kinase [Signal | 94.21 | |
| KOG0520 | 975 | consensus Uncharacterized conserved protein, conta | 94.18 | |
| KOG1841 | 1287 | consensus Smad anchor for receptor activation [Def | 94.17 | |
| KOG2384 | 223 | consensus Major histocompatibility complex protein | 93.3 | |
| KOG1729 | 288 | consensus FYVE finger containing protein [General | 92.82 | |
| KOG0993 | 542 | consensus Rab5 GTPase effector Rabaptin-5 [Intrace | 92.64 | |
| smart00248 | 30 | ANK ankyrin repeats. Ankyrin repeats are about 33 | 92.51 | |
| KOG0521 | 785 | consensus Putative GTPase activating proteins (GAP | 92.17 | |
| KOG0522 | 560 | consensus Ankyrin repeat protein [General function | 92.11 | |
| KOG0320 | 187 | consensus Predicted E3 ubiquitin ligase [Posttrans | 91.5 | |
| KOG2384 | 223 | consensus Major histocompatibility complex protein | 91.21 | |
| KOG3671 | 569 | consensus Actin regulatory protein (Wiskott-Aldric | 84.08 | |
| KOG2505 | 591 | consensus Ankyrin repeat protein [General function | 82.98 | |
| TIGR00622 | 112 | ssl1 transcription factor ssl1. This family is bas | 82.72 | |
| KOG3576 | 267 | consensus Ovo and related transcription factors [T | 81.65 | |
| PRK00464 | 154 | nrdR transcriptional regulator NrdR; Validated | 80.15 |
| >PF01363 FYVE: FYVE zinc finger; InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
Probab=99.76 E-value=2.1e-19 Score=144.07 Aligned_cols=66 Identities=48% Similarity=1.146 Sum_probs=49.1
Q ss_pred CCcccCcCCccccccCccccCccccccccccCceeccCCCCCcEecc--cCCCCCceecccchHHHHH
Q 011140 420 DHWVPDEAVSKCTACGTDFSAFVRKHHCRNCGDIFCDKCTHGRIALT--ADANAQPVRVCDRCMVGVI 485 (492)
Q Consensus 420 p~WvpD~~v~~C~~C~~~Fs~~~RRHHCR~CG~VfC~kCS~~ri~Lp--~~~s~kpvRVC~~Cy~~L~ 485 (492)
|.|++|+++..|+.|+++|+++.||||||.||+|||+.|+..++.++ .....+++|||+.|++.|+
T Consensus 1 ~~W~~d~~~~~C~~C~~~F~~~~rrhhCr~CG~~vC~~Cs~~~~~~~~~~~~~~~~~RvC~~C~~~~~ 68 (69)
T PF01363_consen 1 PHWVPDSEASNCMICGKKFSLFRRRHHCRNCGRVVCSSCSSQRIPLPTPSSGSGEPVRVCDSCYSKLQ 68 (69)
T ss_dssp --SSSGGG-SB-TTT--B-BSSS-EEE-TTT--EEECCCS-EEEEET--GGTESEEEEE-HHHHHHHH
T ss_pred CCcCCCCCCCcCcCcCCcCCCceeeEccCCCCCEECCchhCCEEcccccccCCCCcCEECHHHHHHhc
Confidence 57999999999999999999999999999999999999999999887 5556789999999999885
|
Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target. The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A .... |
| >smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1 | Back alignment and domain information |
|---|
| >KOG1818 consensus Membrane trafficking and cell signaling protein HRS, contains VHS and FYVE domains [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG1729 consensus FYVE finger containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PTZ00303 phosphatidylinositol kinase; Provisional | Back alignment and domain information |
|---|
| >KOG1819 consensus FYVE finger-containing proteins [General function prediction only] | Back alignment and domain information |
|---|
| >cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1; | Back alignment and domain information |
|---|
| >KOG1842 consensus FYVE finger-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A | Back alignment and domain information |
|---|
| >KOG1841 consensus Smad anchor for receptor activation [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02859 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA02878 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02736 Viral ankyrin protein; Provisional | Back alignment and domain information |
|---|
| >PHA02743 Viral ankyrin protein; Provisional | Back alignment and domain information |
|---|
| >KOG0508 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PHA02791 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain | Back alignment and domain information |
|---|
| >PHA02875 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02859 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02791 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02741 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PHA02884 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >PHA02989 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA03095 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02795 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0510 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain | Back alignment and domain information |
|---|
| >KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] | Back alignment and domain information |
|---|
| >PHA02946 ankyin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown] | Back alignment and domain information |
|---|
| >PHA03095 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02874 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02741 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0508 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02716 CPXV016; CPX019; EVM010; Provisional | Back alignment and domain information |
|---|
| >PHA02874 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02798 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PLN03192 Voltage-dependent potassium channel; Provisional | Back alignment and domain information |
|---|
| >KOG1843 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PHA02875 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02946 ankyin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02878 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A | Back alignment and domain information |
|---|
| >PHA03100 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02730 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02884 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02917 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PLN03192 Voltage-dependent potassium channel; Provisional | Back alignment and domain information |
|---|
| >PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional | Back alignment and domain information |
|---|
| >PHA02876 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >COG0666 Arp FOG: Ankyrin repeat [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02989 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA03100 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02798 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0514 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02716 CPXV016; CPX019; EVM010; Provisional | Back alignment and domain information |
|---|
| >TIGR00870 trp transient-receptor-potential calcium channel protein | Back alignment and domain information |
|---|
| >PHA02876 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02743 Viral ankyrin protein; Provisional | Back alignment and domain information |
|---|
| >PHA02792 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02736 Viral ankyrin protein; Provisional | Back alignment and domain information |
|---|
| >PHA02917 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG4424 consensus Predicted Rho/Rac guanine nucleotide exchange factor/faciogenital dysplasia protein 3 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0510 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A | Back alignment and domain information |
|---|
| >PHA02795 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4214 consensus Myotrophin and similar proteins [Transcription] | Back alignment and domain information |
|---|
| >KOG1811 consensus Predicted Zn2+-binding protein, contains FYVE domain [General function prediction only] | Back alignment and domain information |
|---|
| >COG0666 Arp FOG: Ankyrin repeat [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02730 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional | Back alignment and domain information |
|---|
| >KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] | Back alignment and domain information |
|---|
| >cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] | Back alignment and domain information |
|---|
| >KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A | Back alignment and domain information |
|---|
| >KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature | Back alignment and domain information |
|---|
| >KOG0514 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02792 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13606 Ank_3: Ankyrin repeat | Back alignment and domain information |
|---|
| >KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR00870 trp transient-receptor-potential calcium channel protein | Back alignment and domain information |
|---|
| >KOG0260 consensus RNA polymerase II, large subunit [Transcription] | Back alignment and domain information |
|---|
| >KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0522 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature | Back alignment and domain information |
|---|
| >KOG4214 consensus Myotrophin and similar proteins [Transcription] | Back alignment and domain information |
|---|
| >KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13606 Ank_3: Ankyrin repeat | Back alignment and domain information |
|---|
| >PF02318 FYVE_2: FYVE-type zinc finger; InterPro: IPR003315 This entry represents the zinc-binding domain found in rabphilin Rab3A | Back alignment and domain information |
|---|
| >KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0260 consensus RNA polymerase II, large subunit [Transcription] | Back alignment and domain information |
|---|
| >KOG0230 consensus Phosphatidylinositol-4-phosphate 5-kinase and related FYVE finger-containing proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0230 consensus Phosphatidylinositol-4-phosphate 5-kinase and related FYVE finger-containing proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1924 consensus RhoA GTPase effector DIA/Diaphanous [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1924 consensus RhoA GTPase effector DIA/Diaphanous [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] | Back alignment and domain information |
|---|
| >KOG0511 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] | Back alignment and domain information |
|---|
| >KOG1841 consensus Smad anchor for receptor activation [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1729 consensus FYVE finger containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0993 consensus Rab5 GTPase effector Rabaptin-5 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >smart00248 ANK ankyrin repeats | Back alignment and domain information |
|---|
| >KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0522 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3671 consensus Actin regulatory protein (Wiskott-Aldrich syndrome protein) [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG2505 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00622 ssl1 transcription factor ssl1 | Back alignment and domain information |
|---|
| >KOG3576 consensus Ovo and related transcription factors [Transcription] | Back alignment and domain information |
|---|
| >PRK00464 nrdR transcriptional regulator NrdR; Validated | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 492 | ||||
| 1joc_A | 125 | Eea1 Homodimer Of C-Terminal Fyve Domain Bound To I | 1e-12 | ||
| 1hyi_A | 65 | Solution Structure Of The Eea1 Fyve Domain Complexe | 3e-12 | ||
| 1z2q_A | 84 | High-Resolution Solution Structure Of The Lm5-1 Fyv | 1e-10 | ||
| 2yqm_A | 89 | Solution Structure Of The Fyve Domain In Zinc Finge | 2e-10 | ||
| 2yw8_A | 82 | Crystal Structure Of Human Run And Fyve Domain-Cont | 3e-10 | ||
| 1dvp_A | 220 | Crystal Structure Of The Vhs And Fyve Tandem Domain | 1e-07 | ||
| 3zyq_A | 226 | Crystal Structure Of The Tandem Vhs And Fyve Domain | 6e-07 | ||
| 1vfy_A | 73 | Phosphatidylinositol-3-Phosphate Binding Fyve Domai | 8e-07 | ||
| 3mpx_A | 434 | Crystal Structure Of The Dh And Ph-1 Domains Of Hum | 1e-06 | ||
| 3t7l_A | 90 | Crystal Structure Of The Fyve Domain Of Endofin (Zf | 2e-06 |
| >pdb|1JOC|A Chain A, Eea1 Homodimer Of C-Terminal Fyve Domain Bound To Inositol 1,3-Diphosphate Length = 125 | Back alignment and structure |
|
| >pdb|1HYI|A Chain A, Solution Structure Of The Eea1 Fyve Domain Complexed With Inositol 1,3-Bisphosphate Length = 65 | Back alignment and structure |
| >pdb|1Z2Q|A Chain A, High-Resolution Solution Structure Of The Lm5-1 Fyve Domain From Leishmania Major Length = 84 | Back alignment and structure |
| >pdb|2YQM|A Chain A, Solution Structure Of The Fyve Domain In Zinc Finger Fyve Domain-Containing Protein 12 Length = 89 | Back alignment and structure |
| >pdb|2YW8|A Chain A, Crystal Structure Of Human Run And Fyve Domain-Containing Protein Length = 82 | Back alignment and structure |
| >pdb|1DVP|A Chain A, Crystal Structure Of The Vhs And Fyve Tandem Domains Of Hrs, A Protein Involved In Membrane Trafficking And Signal Transduction Length = 220 | Back alignment and structure |
| >pdb|3ZYQ|A Chain A, Crystal Structure Of The Tandem Vhs And Fyve Domains Of Hepatocyte Growth Factor-Regulated Tyrosine Kinase Substrate (Hgs-Hrs) At 1.48 A Resolution Length = 226 | Back alignment and structure |
| >pdb|1VFY|A Chain A, Phosphatidylinositol-3-Phosphate Binding Fyve Domain Of Vps27p Protein From Saccharomyces Cerevisiae Length = 73 | Back alignment and structure |
| >pdb|3MPX|A Chain A, Crystal Structure Of The Dh And Ph-1 Domains Of Human Fgd5 Length = 434 | Back alignment and structure |
| >pdb|3T7L|A Chain A, Crystal Structure Of The Fyve Domain Of Endofin (Zfyve16) At 1.1a Resolution Length = 90 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >1joc_A EEA1, early endosomal autoantigen 1; FYVE domain, inositol 3-phosphate binding, membrane protein; HET: ITP; 2.20A {Homo sapiens} SCOP: g.50.1.1 h.1.21.1 PDB: 1hyi_A* 1hyj_A Length = 125 | Back alignment and structure |
|---|
Score = 116 bits (292), Expect = 2e-31
Identities = 33/122 (27%), Positives = 51/122 (41%), Gaps = 3/122 (2%)
Query: 359 SNSYTATTLLDIVTAATVQLKEMGGGRSRSSDSLKTAEQTGEQKKGFADWMNLMKPGNEE 418
+N LL+ +++++ L ++ + +K
Sbjct: 1 NNQDERRALLERCLKGEGEIEKLQTKVLELQRKLDNTTAAVQELGRENQSLQ-IKHTQAL 59
Query: 419 KDHWVPDEAVSKCTACGTDFSAFVRKHHCRNCGDIFCDKCTHGRIALTADANAQPVRVCD 478
W D V C ACG FS VR+HHCR CG+IFC +C+ ++ +PVRVCD
Sbjct: 60 NRKWAEDNEVQNCMACGKGFSVTVRRHHCRQCGNIFCAECSAKNALT--PSSKKPVRVCD 117
Query: 479 RC 480
C
Sbjct: 118 AC 119
|
| >1z2q_A LM5-1; membrane protein, FYVE domain, zinc-finger; NMR {Leishmania major} Length = 84 | Back alignment and structure |
|---|
| >1x4u_A Zinc finger, FYVE domain containing 27 isoform B; phosphoinositide binding, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 84 | Back alignment and structure |
|---|
| >2yw8_A RUN and FYVE domain-containing protein 1; structure genomics, structural genomics, NPPSFA; 3.00A {Homo sapiens} PDB: 2yqm_A Length = 82 | Back alignment and structure |
|---|
| >1vfy_A Phosphatidylinositol-3-phosphate binding FYVE domain of protein VPS27; endosome maturation, intracellular trafficking; 1.15A {Saccharomyces cerevisiae} SCOP: g.50.1.1 Length = 73 | Back alignment and structure |
|---|
| >3t7l_A Zinc finger FYVE domain-containing protein 16; structural genomics consortium, SGC, lipid BIND protein, transport protein; 1.09A {Homo sapiens} Length = 90 | Back alignment and structure |
|---|
| >1dvp_A HRS, hepatocyte growth factor-regulated tyrosine kinase substrate; VHS, FYVE, zinc finger, superhelix, transferase; HET: CIT; 2.00A {Drosophila melanogaster} SCOP: a.118.9.2 g.50.1.1 Length = 220 | Back alignment and structure |
|---|
| >1wfk_A Zinc finger, FYVE domain containing 19; riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Mus musculus} SCOP: g.50.1.1 Length = 88 | Back alignment and structure |
|---|
| >3zyq_A Hepatocyte growth factor-regulated tyrosine kinas substrate; signaling; 1.48A {Homo sapiens} PDB: 4avx_A* Length = 226 | Back alignment and structure |
|---|
| >3mpx_A FYVE, rhogef and PH domain-containing protein 5; structural genomics consortium, DH domain, SGC, L binding protein; 2.80A {Homo sapiens} Length = 434 | Back alignment and structure |
|---|
| >1y02_A CARP2, FYVE-ring finger protein sakura; zinc-binding module, phosphoinositide binding, caspase regulation, metal binding protein; 1.80A {Homo sapiens} SCOP: a.140.2.1 g.50.1.1 Length = 120 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >2vrw_B P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP-binding, metal-binding, phosphoprotein, exchange factor, RAC, GTPase, membrane domain; 1.85A {Mus musculus} PDB: 3bji_A 1f5x_A Length = 406 | Back alignment and structure |
|---|
| >1zbd_B Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: g.50.1.1 Length = 134 | Back alignment and structure |
|---|
| >3k1f_M Transcription initiation factor IIB; RNA polymerase II, TFIIB, transcription factor, DNA-binding, DNA-directed RNA polymerase; 4.30A {Saccharomyces cerevisiae} Length = 197 | Back alignment and structure |
|---|
| >2zet_C Melanophilin; complex, GTP-binding protein, GTPase, G-protein, RAB, RAB27B, effector, SLP homology domain, acetylation, lipoprotein, membrane; HET: GTP; 3.00A {Mus musculus} Length = 153 | Back alignment and structure |
|---|
| >3ky9_A Proto-oncogene VAV; calponin homology domain, DBL homology domain, pleckst homology domain, C1 domain, guanine-nucleotide releasing FA metal-binding; 2.73A {Homo sapiens} PDB: 2d86_A Length = 587 | Back alignment and structure |
|---|
| >2ej8_A DCC-interacting protein 13 alpha; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.84A {Homo sapiens} Length = 160 | Back alignment and structure |
|---|
| >3tx7_B Nuclear receptor subfamily 5 group A member 2; LRH-1, beta-catenin, armadillo repeat, nuclear receptor LIGA binding domain, protein binding; HET: P6L; 2.76A {Homo sapiens} Length = 352 | Back alignment and structure |
|---|
| >3tx7_B Nuclear receptor subfamily 5 group A member 2; LRH-1, beta-catenin, armadillo repeat, nuclear receptor LIGA binding domain, protein binding; HET: P6L; 2.76A {Homo sapiens} Length = 352 | Back alignment and structure |
|---|
| >3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 | Back alignment and structure |
|---|
| >3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 | Back alignment and structure |
|---|
| >3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 | Back alignment and structure |
|---|
| >3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 492 | |||
| 1x4u_A | 84 | Zinc finger, FYVE domain containing 27 isoform B; | 99.83 | |
| 1z2q_A | 84 | LM5-1; membrane protein, FYVE domain, zinc-finger; | 99.83 | |
| 2yw8_A | 82 | RUN and FYVE domain-containing protein 1; structur | 99.81 | |
| 1vfy_A | 73 | Phosphatidylinositol-3-phosphate binding FYVE doma | 99.78 | |
| 3t7l_A | 90 | Zinc finger FYVE domain-containing protein 16; str | 99.78 | |
| 3zyq_A | 226 | Hepatocyte growth factor-regulated tyrosine kinas | 99.77 | |
| 1joc_A | 125 | EEA1, early endosomal autoantigen 1; FYVE domain, | 99.75 | |
| 1wfk_A | 88 | Zinc finger, FYVE domain containing 19; riken stru | 99.71 | |
| 1dvp_A | 220 | HRS, hepatocyte growth factor-regulated tyrosine k | 99.7 | |
| 1y02_A | 120 | CARP2, FYVE-ring finger protein sakura; zinc-bindi | 99.64 | |
| 3mpx_A | 434 | FYVE, rhogef and PH domain-containing protein 5; s | 99.6 | |
| 1n0q_A | 93 | 3ANK, 3 ankyrin repeats; structural protein; 1.26A | 99.32 | |
| 4gpm_A | 169 | Engineered protein OR264; de novo protein, structu | 99.3 | |
| 3aaa_C | 123 | Myotrophin, protein V-1; actin capping protein, ba | 99.22 | |
| 4b93_B | 269 | Ankyrin repeat domain-containing protein 27; endoc | 99.2 | |
| 1bi7_B | 156 | P16INK4A, MTS1, multiple tumor suppressor; cyclin | 99.16 | |
| 2l6b_A | 115 | NR1C; ankyrin, consensus, repeat protein, ising mo | 99.16 | |
| 3c5r_A | 137 | BARD-1, BRCA1-associated ring domain protein 1; an | 99.16 | |
| 1d9s_A | 136 | Cyclin-dependent kinase 4 inhibitor B; helix-turn- | 99.15 | |
| 2zgd_A | 110 | 3 repeat synthetic ankyrin; ankyrin repeat, hydrox | 99.12 | |
| 2jab_A | 136 | H10-2-G3; HER2, darpin, ankyrin repeat protein, me | 99.11 | |
| 4gpm_A | 169 | Engineered protein OR264; de novo protein, structu | 99.11 | |
| 3t8k_A | 186 | Uncharacterized protein; structural genomics, PSI- | 99.11 | |
| 1dcq_A | 278 | PYK2-associated protein beta; zinc-binding module, | 99.1 | |
| 1d9s_A | 136 | Cyclin-dependent kinase 4 inhibitor B; helix-turn- | 99.09 | |
| 3deo_A | 183 | Signal recognition particle 43 kDa protein; chloro | 99.07 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 99.07 | |
| 2jab_A | 136 | H10-2-G3; HER2, darpin, ankyrin repeat protein, me | 99.06 | |
| 3c5r_A | 137 | BARD-1, BRCA1-associated ring domain protein 1; an | 99.06 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 99.06 | |
| 3aaa_C | 123 | Myotrophin, protein V-1; actin capping protein, ba | 99.06 | |
| 3twr_A | 165 | Tankyrase-2; ankyrin repeat, protein-protein inter | 99.06 | |
| 1awc_B | 153 | Protein (GA binding protein beta 1); complex (tran | 99.05 | |
| 3f6q_A | 179 | Integrin-linked protein kinase; ILK, integrin-link | 99.04 | |
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 99.03 | |
| 2dzn_A | 228 | Probable 26S proteasome regulatory subunit P28; an | 99.02 | |
| 4hbd_A | 276 | KN motif and ankyrin repeat domain-containing Pro; | 99.02 | |
| 3lvq_E | 497 | ARF-GAP with SH3 domain, ANK repeat and PH domain | 99.02 | |
| 3ui2_A | 244 | Signal recognition particle 43 kDa protein, chlor; | 99.02 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 99.01 | |
| 1ihb_A | 162 | P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit | 99.01 | |
| 3f6q_A | 179 | Integrin-linked protein kinase; ILK, integrin-link | 99.01 | |
| 3jxi_A | 260 | Vanilloid receptor-related osmotically activated p | 99.01 | |
| 3twr_A | 165 | Tankyrase-2; ankyrin repeat, protein-protein inter | 99.01 | |
| 3t8k_A | 186 | Uncharacterized protein; structural genomics, PSI- | 99.0 | |
| 3v30_A | 172 | DNA-binding protein rfxank; structural genomics co | 99.0 | |
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 99.0 | |
| 2etb_A | 256 | Transient receptor potential cation channel subfam | 99.0 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 99.0 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 98.99 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 98.99 | |
| 1awc_B | 153 | Protein (GA binding protein beta 1); complex (tran | 98.98 | |
| 2rfm_A | 192 | Putative ankyrin repeat protein TV1425; ANK repeat | 98.98 | |
| 1ihb_A | 162 | P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit | 98.98 | |
| 3v30_A | 172 | DNA-binding protein rfxank; structural genomics co | 98.97 | |
| 2pnn_A | 273 | Transient receptor potential cation channel subfa | 98.97 | |
| 3v31_A | 167 | Ankyrin repeat family A protein 2; structural geno | 98.96 | |
| 2y1l_E | 169 | Darpin-8.4; hydrolase-inhibitor complex, DEVD darp | 98.96 | |
| 4b93_B | 269 | Ankyrin repeat domain-containing protein 27; endoc | 98.96 | |
| 2rfa_A | 232 | Transient receptor potential cation channel subfa | 98.96 | |
| 1bd8_A | 156 | P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr | 98.95 | |
| 2vge_A | 229 | RELA-associated inhibitor; iaspp, nucleus, apoptos | 98.95 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 98.95 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 98.95 | |
| 1bd8_A | 156 | P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr | 98.94 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 98.94 | |
| 2y1l_E | 169 | Darpin-8.4; hydrolase-inhibitor complex, DEVD darp | 98.94 | |
| 1bi7_B | 156 | P16INK4A, MTS1, multiple tumor suppressor; cyclin | 98.94 | |
| 2b0o_E | 301 | UPLC1; arfgap, structural genomics, structural gen | 98.94 | |
| 1n0r_A | 126 | 4ANK, 4 ankyrin repeats; structural protein; 1.50A | 98.93 | |
| 2l6b_A | 115 | NR1C; ankyrin, consensus, repeat protein, ising mo | 98.93 | |
| 2rfm_A | 192 | Putative ankyrin repeat protein TV1425; ANK repeat | 98.93 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 98.93 | |
| 3v31_A | 167 | Ankyrin repeat family A protein 2; structural geno | 98.92 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 98.91 | |
| 2etb_A | 256 | Transient receptor potential cation channel subfam | 98.9 | |
| 3jue_A | 368 | Arfgap with coiled-coil, ANK repeat and PH domain | 98.9 | |
| 3aji_A | 231 | 26S proteasome non-ATPase regulatory subunit 10; g | 98.89 | |
| 1n0r_A | 126 | 4ANK, 4 ankyrin repeats; structural protein; 1.50A | 98.89 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 98.89 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 98.88 | |
| 2rfa_A | 232 | Transient receptor potential cation channel subfa | 98.88 | |
| 2vge_A | 229 | RELA-associated inhibitor; iaspp, nucleus, apoptos | 98.88 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 98.88 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 98.88 | |
| 3jxi_A | 260 | Vanilloid receptor-related osmotically activated p | 98.87 | |
| 2dzn_A | 228 | Probable 26S proteasome regulatory subunit P28; an | 98.87 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 98.87 | |
| 3deo_A | 183 | Signal recognition particle 43 kDa protein; chloro | 98.87 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 98.87 | |
| 1n0q_A | 93 | 3ANK, 3 ankyrin repeats; structural protein; 1.26A | 98.86 | |
| 3ui2_A | 244 | Signal recognition particle 43 kDa protein, chlor; | 98.85 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 98.84 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 98.84 | |
| 1sw6_A | 327 | Regulatory protein SWI6; transcription regulation, | 98.84 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 98.83 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 98.82 | |
| 2pnn_A | 273 | Transient receptor potential cation channel subfa | 98.82 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 98.81 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 98.81 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 98.81 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 98.79 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 98.79 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 98.79 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 98.77 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 98.75 | |
| 3aji_A | 231 | 26S proteasome non-ATPase regulatory subunit 10; g | 98.75 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 98.75 | |
| 4hbd_A | 276 | KN motif and ankyrin repeat domain-containing Pro; | 98.74 | |
| 1sw6_A | 327 | Regulatory protein SWI6; transcription regulation, | 98.73 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 98.73 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 98.72 | |
| 4g8k_A | 337 | 2-5A-dependent ribonuclease; ankyrin-repeat domain | 98.72 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 98.71 | |
| 2b0o_E | 301 | UPLC1; arfgap, structural genomics, structural gen | 98.69 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 98.67 | |
| 4g8k_A | 337 | 2-5A-dependent ribonuclease; ankyrin-repeat domain | 98.6 | |
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 98.59 | |
| 3lvq_E | 497 | ARF-GAP with SH3 domain, ANK repeat and PH domain | 98.58 | |
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 98.52 | |
| 1dcq_A | 278 | PYK2-associated protein beta; zinc-binding module, | 98.51 | |
| 3jue_A | 368 | Arfgap with coiled-coil, ANK repeat and PH domain | 98.5 | |
| 2zgd_A | 110 | 3 repeat synthetic ankyrin; ankyrin repeat, hydrox | 98.19 | |
| 2aja_A | 376 | Ankyrin repeat family protein; NESG, Q5ZSV0, struc | 98.15 | |
| 2vrw_B | 406 | P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP | 97.88 | |
| 2aja_A | 376 | Ankyrin repeat family protein; NESG, Q5ZSV0, struc | 97.85 | |
| 3ky9_A | 587 | Proto-oncogene VAV; calponin homology domain, DBL | 95.95 | |
| 1zbd_B | 134 | Rabphilin-3A; G protein, effector, RABCDR, synapti | 95.34 | |
| 2zet_C | 153 | Melanophilin; complex, GTP-binding protein, GTPase | 94.98 | |
| 1wfh_A | 64 | Zinc finger (AN1-like) family protein; ZF-AN1 doma | 91.15 | |
| 1wff_A | 85 | Riken cDNA 2810002D23 protein; ZF-AN1 domain, zinc | 90.7 | |
| 1wfl_A | 74 | Zinc finger protein 216; ZF-AN1 domain, zinc bindi | 90.22 | |
| 2csz_A | 76 | Synaptotagmin-like protein 4; exophilin 2, granuph | 89.15 | |
| 1wfp_A | 74 | Zinc finger (AN1-like) family protein; ZF-AN1 doma | 88.91 | |
| 1wg2_A | 64 | Zinc finger (AN1-like) family protein; riken struc | 88.86 | |
| 2e72_A | 49 | POGO transposable element with ZNF domain; zinc fi | 86.21 | |
| 1bor_A | 56 | Transcription factor PML; proto-oncogene, nuclear | 84.05 | |
| 1x4w_A | 67 | Hypothetical protein FLJ13222; ZF-AN1 domain, zinc | 83.77 | |
| 2a20_A | 62 | Regulating synaptic membrane exocytosis protein 2; | 82.9 | |
| 2ecm_A | 55 | Ring finger and CHY zinc finger domain- containing | 80.94 | |
| 1z60_A | 59 | TFIIH basal transcription factor complex P44 subun | 80.57 |
| >1x4u_A Zinc finger, FYVE domain containing 27 isoform B; phosphoinositide binding, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.83 E-value=2.7e-21 Score=160.84 Aligned_cols=71 Identities=24% Similarity=0.591 Sum_probs=64.1
Q ss_pred CCCcccCcCCccccccCccccCccccccccccCceeccCCCCCcEecccCCC------CCceecccchHHHHHHhhh
Q 011140 419 KDHWVPDEAVSKCTACGTDFSAFVRKHHCRNCGDIFCDKCTHGRIALTADAN------AQPVRVCDRCMVGVIDWLI 489 (492)
Q Consensus 419 ~p~WvpD~~v~~C~~C~~~Fs~~~RRHHCR~CG~VfC~kCS~~ri~Lp~~~s------~kpvRVC~~Cy~~L~~r~~ 489 (492)
...|++|+++..|+.|+++|+++.||||||+||+|||.+|+.++++|+..+. .+++|||+.||+.|.+..+
T Consensus 5 ~~~W~pd~~~~~C~~C~~~F~~~~RrHHCR~CG~vfC~~Cs~~~~~l~~~g~~~p~~~~~~~RVC~~C~~~l~~~~~ 81 (84)
T 1x4u_A 5 SSGRYPTNNFGNCTGCSATFSVLKKRRSCSNCGNSFCSRCCSFKVPKSSMGATAPEAQRETVFVCASCNQTLSKSGP 81 (84)
T ss_dssp CCCSCSCCCCSSCSSSCCCCCSSSCCEECSSSCCEECTTTSCEEECSTTTSCCCSSCSSCCEEECHHHHHHHHSCCS
T ss_pred CCccccCCCCCcCcCcCCccccchhhhhhcCCCcEEChhhcCCceecccccccCccccCCccEECHHHHHHHhccCC
Confidence 5789999999999999999999999999999999999999999999887543 3689999999999976544
|
| >1z2q_A LM5-1; membrane protein, FYVE domain, zinc-finger; NMR {Leishmania major} | Back alignment and structure |
|---|
| >2yw8_A RUN and FYVE domain-containing protein 1; structure genomics, structural genomics, NPPSFA; 3.00A {Homo sapiens} PDB: 2yqm_A | Back alignment and structure |
|---|
| >1vfy_A Phosphatidylinositol-3-phosphate binding FYVE domain of protein VPS27; endosome maturation, intracellular trafficking; 1.15A {Saccharomyces cerevisiae} SCOP: g.50.1.1 | Back alignment and structure |
|---|
| >3t7l_A Zinc finger FYVE domain-containing protein 16; structural genomics consortium, SGC, lipid BIND protein, transport protein; 1.09A {Homo sapiens} | Back alignment and structure |
|---|
| >3zyq_A Hepatocyte growth factor-regulated tyrosine kinas substrate; signaling; 1.48A {Homo sapiens} PDB: 4avx_A* | Back alignment and structure |
|---|
| >1joc_A EEA1, early endosomal autoantigen 1; FYVE domain, inositol 3-phosphate binding, membrane protein; HET: ITP; 2.20A {Homo sapiens} SCOP: g.50.1.1 h.1.21.1 PDB: 1hyi_A* 1hyj_A | Back alignment and structure |
|---|
| >1wfk_A Zinc finger, FYVE domain containing 19; riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Mus musculus} SCOP: g.50.1.1 | Back alignment and structure |
|---|
| >1dvp_A HRS, hepatocyte growth factor-regulated tyrosine kinase substrate; VHS, FYVE, zinc finger, superhelix, transferase; HET: CIT; 2.00A {Drosophila melanogaster} SCOP: a.118.9.2 g.50.1.1 | Back alignment and structure |
|---|
| >1y02_A CARP2, FYVE-ring finger protein sakura; zinc-binding module, phosphoinositide binding, caspase regulation, metal binding protein; 1.80A {Homo sapiens} SCOP: a.140.2.1 g.50.1.1 | Back alignment and structure |
|---|
| >3mpx_A FYVE, rhogef and PH domain-containing protein 5; structural genomics consortium, DH domain, SGC, L binding protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A | Back alignment and structure |
|---|
| >4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 | Back alignment and structure |
|---|
| >2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C | Back alignment and structure |
|---|
| >4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} | Back alignment and structure |
|---|
| >1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A | Back alignment and structure |
|---|
| >4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} | Back alignment and structure |
|---|
| >3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A | Back alignment and structure |
|---|
| >3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A | Back alignment and structure |
|---|
| >2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* | Back alignment and structure |
|---|
| >4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A | Back alignment and structure |
|---|
| >2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A | Back alignment and structure |
|---|
| >3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A | Back alignment and structure |
|---|
| >3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* | Back alignment and structure |
|---|
| >1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} | Back alignment and structure |
|---|
| >1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E | Back alignment and structure |
|---|
| >4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} | Back alignment and structure |
|---|
| >3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} | Back alignment and structure |
|---|
| >1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 | Back alignment and structure |
|---|
| >3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A | Back alignment and structure |
|---|
| >2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A | Back alignment and structure |
|---|
| >2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 | Back alignment and structure |
|---|
| >2vrw_B P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP-binding, metal-binding, phosphoprotein, exchange factor, RAC, GTPase, membrane domain; 1.85A {Mus musculus} PDB: 3bji_A 1f5x_A | Back alignment and structure |
|---|
| >2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 | Back alignment and structure |
|---|
| >3ky9_A Proto-oncogene VAV; calponin homology domain, DBL homology domain, pleckst homology domain, C1 domain, guanine-nucleotide releasing FA metal-binding; 2.73A {Homo sapiens} PDB: 2d86_A | Back alignment and structure |
|---|
| >1zbd_B Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: g.50.1.1 | Back alignment and structure |
|---|
| >2zet_C Melanophilin; complex, GTP-binding protein, GTPase, G-protein, RAB, RAB27B, effector, SLP homology domain, acetylation, lipoprotein, membrane; HET: GTP; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >1wfh_A Zinc finger (AN1-like) family protein; ZF-AN1 domain, zinc binding, structural genomics, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: g.80.1.1 | Back alignment and structure |
|---|
| >1wff_A Riken cDNA 2810002D23 protein; ZF-AN1 domain, zinc binding, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.80.1.1 | Back alignment and structure |
|---|
| >1wfl_A Zinc finger protein 216; ZF-AN1 domain, zinc binding, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.80.1.1 | Back alignment and structure |
|---|
| >2csz_A Synaptotagmin-like protein 4; exophilin 2, granuphilin, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wfp_A Zinc finger (AN1-like) family protein; ZF-AN1 domain, zinc binding, structural genomics, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: g.80.1.1 | Back alignment and structure |
|---|
| >1wg2_A Zinc finger (AN1-like) family protein; riken structural genomics/proteomics initiative, RSGI, structural genomics, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.80.1.1 | Back alignment and structure |
|---|
| >2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1x4w_A Hypothetical protein FLJ13222; ZF-AN1 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2a20_A Regulating synaptic membrane exocytosis protein 2; zinc-finger domain, metal binding protein; NMR {Rattus norvegicus} PDB: 2cjs_C | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A | Back alignment and structure |
|---|
| >1z60_A TFIIH basal transcription factor complex P44 subunit; basic transcription factor, zinc binding protein, ring finger; NMR {Homo sapiens} SCOP: g.49.1.2 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 492 | ||||
| d1joca1 | 64 | g.50.1.1 (A:1348-1411) Eea1 {Human (Homo sapiens) | 5e-21 | |
| d1vfya_ | 67 | g.50.1.1 (A:) vps27p protein {Baker's yeast (Sacch | 1e-20 | |
| d1dvpa2 | 72 | g.50.1.1 (A:149-220) Hrs {Fruit fly (Drosophila me | 3e-19 | |
| d1wfka_ | 88 | g.50.1.1 (A:) Zinc finger FYVE domain containing p | 1e-16 | |
| d1y02a2 | 51 | g.50.1.1 (A:20-70) Rififylin (FYVE-RING finger pro | 1e-15 | |
| d1zbdb_ | 124 | g.50.1.1 (B:) Effector domain of rabphilin-3a {Rat | 7e-15 | |
| d2cy5a1 | 129 | b.55.1.2 (A:31-159) EPS8-like protein 1, EPS8L1 {M | 9e-06 | |
| d1oy2a_ | 191 | b.55.1.2 (A:) Shc adaptor protein {Human (Homo sap | 0.001 |
| >d1joca1 g.50.1.1 (A:1348-1411) Eea1 {Human (Homo sapiens) [TaxId: 9606]} Length = 64 | Back information, alignment and structure |
|---|
class: Small proteins fold: FYVE/PHD zinc finger superfamily: FYVE/PHD zinc finger family: FYVE, a phosphatidylinositol-3-phosphate binding domain domain: Eea1 species: Human (Homo sapiens) [TaxId: 9606]
Score = 84.3 bits (208), Expect = 5e-21
Identities = 28/59 (47%), Positives = 35/59 (59%), Gaps = 2/59 (3%)
Query: 422 WVPDEAVSKCTACGTDFSAFVRKHHCRNCGDIFCDKCTHGRIALTADANAQPVRVCDRC 480
W D V C ACG FS VR+HHCR CG+IFC +C+ ++ +PVRVCD C
Sbjct: 2 WAEDNEVQNCMACGKGFSVTVRRHHCRQCGNIFCAECSAKNALT--PSSKKPVRVCDAC 58
|
| >d1vfya_ g.50.1.1 (A:) vps27p protein {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 67 | Back information, alignment and structure |
|---|
| >d1dvpa2 g.50.1.1 (A:149-220) Hrs {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 72 | Back information, alignment and structure |
|---|
| >d1wfka_ g.50.1.1 (A:) Zinc finger FYVE domain containing protein 19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 88 | Back information, alignment and structure |
|---|
| >d1y02a2 g.50.1.1 (A:20-70) Rififylin (FYVE-RING finger protein Sakura) {Human (Homo sapiens) [TaxId: 9606]} Length = 51 | Back information, alignment and structure |
|---|
| >d1zbdb_ g.50.1.1 (B:) Effector domain of rabphilin-3a {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 | Back information, alignment and structure |
|---|
| >d2cy5a1 b.55.1.2 (A:31-159) EPS8-like protein 1, EPS8L1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 129 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 492 | |||
| d1joca1 | 64 | Eea1 {Human (Homo sapiens) [TaxId: 9606]} | 99.79 | |
| d1dvpa2 | 72 | Hrs {Fruit fly (Drosophila melanogaster) [TaxId: 7 | 99.77 | |
| d1vfya_ | 67 | vps27p protein {Baker's yeast (Saccharomyces cerev | 99.75 | |
| d1wfka_ | 88 | Zinc finger FYVE domain containing protein 19 {Mou | 99.67 | |
| d1y02a2 | 51 | Rififylin (FYVE-RING finger protein Sakura) {Human | 99.37 | |
| d1myoa_ | 118 | Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] | 99.31 | |
| d1dcqa1 | 154 | Pyk2-associated protein beta {Mouse (Mus musculus) | 99.21 | |
| d1myoa_ | 118 | Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] | 99.2 | |
| d2fo1e1 | 277 | Lin-12 {Caenorhabditis elegans [TaxId: 6239]} | 99.11 | |
| d1s70b_ | 291 | Myosin phosphatase targeting subunit 1, MYPT1 {Chi | 99.08 | |
| d1ycsb1 | 130 | 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | 99.07 | |
| d1oy3d_ | 255 | Transcription factor inhibitor I-kappa-B-beta, IKB | 99.05 | |
| d1n11a_ | 408 | Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} | 99.01 | |
| d1bi7b_ | 125 | Cell cycle inhibitor p16ink4A {Human (Homo sapiens | 99.0 | |
| d1ycsb1 | 130 | 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | 98.97 | |
| d1zbdb_ | 124 | Effector domain of rabphilin-3a {Rat (Rattus norve | 98.91 | |
| d1ixva_ | 229 | 26S proteasome non-ATPase regulatory subunit 10, g | 98.91 | |
| d1ihba_ | 156 | p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] | 98.9 | |
| d1uoha_ | 223 | 26S proteasome non-ATPase regulatory subunit 10, g | 98.88 | |
| d1ot8a_ | 209 | Neurogenic locus notch receptor domain {Fruit fly | 98.86 | |
| d1n11a_ | 408 | Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} | 98.85 | |
| d1k1aa_ | 228 | bcl-3 {Human (Homo sapiens) [TaxId: 9606]} | 98.85 | |
| d1oy3d_ | 255 | Transcription factor inhibitor I-kappa-B-beta, IKB | 98.84 | |
| d1sw6a_ | 301 | Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch | 98.82 | |
| d1bi7b_ | 125 | Cell cycle inhibitor p16ink4A {Human (Homo sapiens | 98.81 | |
| d1k1aa_ | 228 | bcl-3 {Human (Homo sapiens) [TaxId: 9606]} | 98.79 | |
| d1iknd_ | 221 | I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 | 98.74 | |
| d1wdya_ | 285 | RNase L, 2-5a-dependent ribonuclease {Human (Homo | 98.74 | |
| d1bd8a_ | 156 | Cell cycle inhibitor p19ink4D {Human (Homo sapiens | 98.69 | |
| d1awcb_ | 153 | GA bindinig protein (GABP) beta 1 {Mouse (Mus musc | 98.66 | |
| d1iknd_ | 221 | I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 | 98.63 | |
| d1dcqa1 | 154 | Pyk2-associated protein beta {Mouse (Mus musculus) | 98.62 | |
| d1uoha_ | 223 | 26S proteasome non-ATPase regulatory subunit 10, g | 98.61 | |
| d2fo1e1 | 277 | Lin-12 {Caenorhabditis elegans [TaxId: 6239]} | 98.57 | |
| d1s70b_ | 291 | Myosin phosphatase targeting subunit 1, MYPT1 {Chi | 98.53 | |
| d1wdya_ | 285 | RNase L, 2-5a-dependent ribonuclease {Human (Homo | 98.49 | |
| d1ot8a_ | 209 | Neurogenic locus notch receptor domain {Fruit fly | 98.42 | |
| d1awcb_ | 153 | GA bindinig protein (GABP) beta 1 {Mouse (Mus musc | 98.42 | |
| d2ajaa1 | 346 | Hypothetical protein LPG2416 {Legionella pneumophi | 98.38 | |
| d1sw6a_ | 301 | Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch | 98.32 | |
| d1ixva_ | 229 | 26S proteasome non-ATPase regulatory subunit 10, g | 98.18 | |
| d2ajaa1 | 346 | Hypothetical protein LPG2416 {Legionella pneumophi | 98.05 | |
| d1bd8a_ | 156 | Cell cycle inhibitor p19ink4D {Human (Homo sapiens | 97.95 | |
| d1ihba_ | 156 | p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] | 97.91 | |
| d1wfla_ | 74 | Zinc finger A20 domain containing protein 2 {Mouse | 92.73 | |
| d1wffa_ | 85 | ANUBL1 (AN1, ubiquitin-like, homolog) {Mouse (Mus | 91.88 | |
| d1wfha_ | 64 | Zinc finger A20 and AN1 domains containing protein | 91.18 | |
| d1wfpa_ | 74 | Zinc finger A20 and AN1 domains containing protein | 88.69 | |
| d1z60a1 | 59 | TFIIH p44 subunit cysteine-rich domain {Human (Hom | 80.8 |
| >d1joca1 g.50.1.1 (A:1348-1411) Eea1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Small proteins fold: FYVE/PHD zinc finger superfamily: FYVE/PHD zinc finger family: FYVE, a phosphatidylinositol-3-phosphate binding domain domain: Eea1 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.79 E-value=1.5e-20 Score=147.49 Aligned_cols=63 Identities=44% Similarity=1.073 Sum_probs=58.4
Q ss_pred CcccCcCCccccccCccccCccccccccccCceeccCCCCCcEecccCCCCCceecccchHHHHH
Q 011140 421 HWVPDEAVSKCTACGTDFSAFVRKHHCRNCGDIFCDKCTHGRIALTADANAQPVRVCDRCMVGVI 485 (492)
Q Consensus 421 ~WvpD~~v~~C~~C~~~Fs~~~RRHHCR~CG~VfC~kCS~~ri~Lp~~~s~kpvRVC~~Cy~~L~ 485 (492)
-|++|++++.|+.|++.|+++.||||||+||+|||+.|+.+++.++.. .+++|||+.||+.|.
T Consensus 1 rW~~d~~~~~C~~C~~~F~~~~rrHHCR~CG~v~C~~Cs~~~~~~~~~--~~~~RVC~~C~~~l~ 63 (64)
T d1joca1 1 KWAEDNEVQNCMACGKGFSVTVRRHHCRQCGNIFCAECSAKNALTPSS--KKPVRVCDACFNDLQ 63 (64)
T ss_dssp CCCCGGGCCBCTTTCCBCCSSSCCEECTTTCCEECGGGSCEEECCTTC--SSCEEECHHHHHHTT
T ss_pred CCCCcccCCcCcCcCCcccCCccccchhhhCCeecccccCCceecCCC--CCccEehHHHHHHhc
Confidence 399999999999999999999999999999999999999999988754 479999999999874
|
| >d1dvpa2 g.50.1.1 (A:149-220) Hrs {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1vfya_ g.50.1.1 (A:) vps27p protein {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wfka_ g.50.1.1 (A:) Zinc finger FYVE domain containing protein 19 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1y02a2 g.50.1.1 (A:20-70) Rififylin (FYVE-RING finger protein Sakura) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zbdb_ g.50.1.1 (B:) Effector domain of rabphilin-3a {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} | Back information, alignment and structure |
|---|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} | Back information, alignment and structure |
|---|
| >d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wfla_ g.80.1.1 (A:) Zinc finger A20 domain containing protein 2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wffa_ g.80.1.1 (A:) ANUBL1 (AN1, ubiquitin-like, homolog) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wfha_ g.80.1.1 (A:) Zinc finger A20 and AN1 domains containing protein At2g36320 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1wfpa_ g.80.1.1 (A:) Zinc finger A20 and AN1 domains containing protein At1g12440 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1z60a1 g.49.1.2 (A:328-386) TFIIH p44 subunit cysteine-rich domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|