Citrus Sinensis ID: 011149


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490--
MLAVGFEEDVELILENLPPKRQSMLFSATMPSWVKKLSRKYLDNPLNIDLVGNQDEKLAEGIKLYAISTTATSKRTILSDLITVYAKGGKTIVFTQTKRDADEVSLALTSIIASEALHGDISQHQRERTLNGFRQGKFTVLVATDVAARGLDIPNVDLIIHYELPNDPETFVHRSGRTGRAGKEGTAILMFTSSQRRTVRSLERDVGCKFEFVSPPVVEDVLESSAEQVVATLNGVHPESVEFFTPTAQRLIEEKGTDALAAALAQLSGFSRPPSSRSLINHEQGWVTLQLTRDSAFSRGFMSARSVMGFLSDVYPTAADEIGKIHIIADDRVQGAVFDLPEEIAKELLNKQIPPGNTISKITKLPALQDDGPSSDNYGRFSSRDRFSRGGGSRFSRGGARGGARGGGSMDRRGFRSSRSWGSDDEDGFSSSRGGRSFRSGNNRGSRFSTSSDDDWLIGGSRSSRSSSRDRSFGGACFNCGKSGHRASECPN
ccccccHHHHHHHHHHccccccEEEEEccccHHHHHHHHHHcccccEEEEEEcccccccccEEEEEEEEccccHHHHHHHHHHHccccccEEEEccccHHHHHHHHHHccccccccccccccHHHHHHHHHHHHcccccEEEEccccccccccccccEEEEcccccccccccccccccccccccccEEEEEcccHHHHHHHHHHHHccccEEcccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcHHHHHHHHHHHHccccccccccccccccccccEEEccccccccccccccHHHHHHHHHccccccccccEEEEEcccccEEEEEccHHHHHHHHHHccccccEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
HHccccHHHHHHHHHccccccEEEEEEccccHHHHHHHHHHccccEEEEEEEEccEEEcccEEEEEEEEccHHHHHHHHHHHHHccccccEEEEEccHHHHHHHHHHHHccccHHHHcccccHHHHHHHHHHHHccccEEEEEEcHHHccccccccEEEEEcccccccccEEEEccccccccccEEEEEEEcHHHHHHHHHHHHHHcccEEccccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHccccccccccccccccccccEEEEEEcccccccccHHHHHHHHHHHcccccHHccEEEEEcccEEEEEEEEccHHHHHHHHHHHcccccEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEccccccccccccccccccEEcccccccccccccc
MLAVGFEEDVELILenlppkrqsmLFSATMPSWVKKLSRkyldnplnidlvgnqDEKLAEGIKLYAISTTATSKRTILSDLITVYAKGGKTIVFTQTKRDADEVSLALTSIIASEAlhgdisqhqrertlngfrqgkFTVLVATDVaargldipnvdliihyelpndpetfvhrsgrtgragkegTAILMFTSSQRRTVRslerdvgckfefvsppvveDVLESSAEQVVATLngvhpesvefftPTAQRLIEEKGTDALAAALAQLsgfsrppssrslinheqgWVTLQLTRDSAFSRGFMSARSVMGflsdvyptaadeigKIHIiaddrvqgavfDLPEEIAKELLnkqippgntiskitklpalqddgpssdnygrfssrdrfsrgggsrfsrggarggargggsmdrrgfrssrswgsddedgfsssrggrsfrsgnnrgsrfstssdddwliggsrssrsssrdrsfggacfncgksghrasecpn
MLAVGFEEDVELILEnlppkrqsmLFSATMPSWVKKLSRKYLDNPLNIDLVGNQDEKLAEGIKLYAisttatskrtiLSDLITVYAKGGKTIVFTQTKRDADEVSLALTSIIASEALHGDISQHQRERTLNGFRQGKFTVLVATDVAARGLDIPNVDLIIHYELPNDPETFVHRsgrtgragkegtailmftssqrrtvrslerdvgckfefvSPPVVEDVLESSAEQVVATLNGVHPESVEFFTPTAQRLIEEKGTDALAAALAQLSGFSRPPSSRSLINHEQGWVTLQLTRDSAFSRGFMSARSVMGFLSDVYPTAADEIGKIHIIADDRVQGAVFDLPEEIAKEllnkqippgntISKItklpalqddgpssdnygrfssrdrfsrgggsrfsrggarggargggsmdrrgfrssrswgsddedgfsssrggrsfrsgnnrgsrfstssdddwliggsrssrsssrdrsfggacfncgksghrasecpn
MLAVGFEEDVELILENLPPKRQSMLFSATMPSWVKKLSRKYLDNPLNIDLVGNQDEKLAEGIKLYAISTTATSKRTILSDLITVYAKGGKTIVFTQTKRDADEVSLALTSIIASEALHGDISQHQRERTLNGFRQGKFTVLVATDVAARGLDIPNVDLIIHYELPNDPETFVHRSGRTGRAGKEGTAILMFTSSQRRTVRSLERDVGCKFEFVSPPVVEDVLESSAEQVVATLNGVHPESVEFFTPTAQRLIEEKGTDALAAALAQLSGFSRPPSSRSLINHEQGWVTLQLTRDSAFSRGFMSARSVMGFLSDVYPTAADEIGKIHIIADDRVQGAVFDLPEEIAKELLNKQIPPGNTISKITKLPALQDDGPSSDNYgrfssrdrfsrgggsrfsrggarggargggsmdrrgfrssrswgsddEDgfsssrggrsfrsgnnrgsrfstssDDDWLIggsrssrsssrdrsfggACFNCGKSGHRASECPN
*********VELILEN*******MLFSATMPSWVKKLSRKYLDNPLNIDLVGNQDEKLAEGIKLYAISTTATSKRTILSDLITVYAKGGKTIVFTQTKRDADEVSLALTSIIASEALHGDISQHQRERTLNGFRQGKFTVLVATDVAARGLDIPNVDLIIHYELPNDPETFVH************TAILMFTS**RRTVRSLERDVGCKFEFVSPPVVEDVLESSAEQVVATLNGVHPESVEFFTPTAQRLIEEKGTDALAAALA*************LINHEQGWVTLQLTRDSAFSRGFMSARSVMGFLSDVYPTAADEIGKIHIIADDRVQGAVFDLPEEIAKELLNK*********************************************************************************************************************************************
MLAVGFEEDVELILENLPPKRQSMLFSATMPSWVKKLSRKYLDNPLNIDLVGNQDEKLAEGIKLYAISTTATSKRTILSDLITVYAKGGKTIVFTQTKRDADEVSLALTSIIASEALHGDISQHQRERTLNGFRQGKFTVLVATDVAARGLDIPNVDLIIHYELPNDPETFVHRSGRTGRAGKEGTAILMFTSSQRRTVRSLERDVGCKFEFVSPPVVEDVLESSAEQVVATLNGVHPESVEFFTPTAQRLIEEKGTDALAAAL*******************************AFSRGFMSARSVMGFLSDVYPTAADEIGKIHIIADDRVQGAVFDLPEEIAKELLNKQIPPGNTISK**********************************************************************************************************************CGKSG********
MLAVGFEEDVELILENLPPKRQSMLFSATMPSWVKKLSRKYLDNPLNIDLVGNQDEKLAEGIKLYAISTTATSKRTILSDLITVYAKGGKTIVFTQTKRDADEVSLALTSIIASEALHGDISQHQRERTLNGFRQGKFTVLVATDVAARGLDIPNVDLIIHYELPNDPETFVHRSGRTGRAGKEGTAILMFTSSQRRTVRSLERDVGCKFEFVSPPVVEDVLESSAEQVVATLNGVHPESVEFFTPTAQRLIEEKGTDALAAALAQLSGFSRPPSSRSLINHEQGWVTLQLTRDSAFSRGFMSARSVMGFLSDVYPTAADEIGKIHIIADDRVQGAVFDLPEEIAKELLNKQIPPGNTISKITKLPALQDDGPSSDNYGRFSSRD******************************************************SGNNRGSRFSTSSDDDWLIG*************FGGACFNCGK**********
*LAVGFEEDVELILENLPPKRQSMLFSATMPSWVKKLSRKYLDNPLNIDLVGNQDEKLAEGIKLYAISTTATSKRTILSDLITVYAKGGKTIVFTQTKRDADEVSLALTSIIASEALHGDISQHQRERTLNGFRQGKFTVLVATDVAARGLDIPNVDLIIHYELPNDPETFVHRSGRTGRAGKEGTAILMFTSSQRRTVRSLERDVGCKFEFVSPPVVEDVLESSAEQVVATLNGVHPESVEFFTPTAQRLIEEKGTDALAAALAQLSGFS*************GWVTLQLTRDSAFSRGFMSARSVMGFLSDVYPTAADEIGKIHIIADDRVQGAVFDLPEEIAKELLNKQIPPGNTISKITKLPA*****************************************************************************************************************************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLAVGFEEDVELILENLPPKRQSMLFSATMPSWVKKLSRKYLDNPLNIDLVGNQDEKLAEGIKLYAISTTATSKRTILSDLITVYAKGGKTIVFTQTKRDADEVSLALTSIIASEALHGDISQHQRERTLNGFRQGKFTVLVATDVAARGLDIPNVDLIIHYELPNDPETFVHRSGRTGRAGKEGTAILMFTSSQRRTVRSLERDVGCKFEFVSPPVVEDVLESSAEQVVATLNGVHPESVEFFTPTAQRLIEEKGTDALAAALAQLSGFSRPPSSRSLINHEQGWVTLQLTRDSAFSRGFMSARSVMGFLSDVYPTAADEIGKIHIIADDRVQGAVFDLPEEIAKELLNKQIPPGNTISKITKLPALQDDGPSSDNYGRFSSRDRFSRGGGSRFSRGGARGGARGGGSMDRRGFRSSRSWGSDDEDGFSSSRGGRSFRSGNNRGSRFSTSSDDDWLIGGSRSSRSSSRDRSFGGACFNCGKSGHRASECPN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query492 2.2.26 [Sep-21-2011]
Q8L7S8748 DEAD-box ATP-dependent RN no no 0.786 0.517 0.850 0.0
Q0DM51758 DEAD-box ATP-dependent RN yes no 0.782 0.507 0.815 0.0
Q0D8N0602 DEAD-box ATP-dependent RN no no 0.453 0.370 0.64 4e-81
Q9LUW5616 DEAD-box ATP-dependent RN no no 0.445 0.355 0.643 2e-80
Q0ILZ4628 DEAD-box ATP-dependent RN no no 0.426 0.334 0.638 4e-79
Q9LUW6610 DEAD-box ATP-dependent RN no no 0.445 0.359 0.616 3e-78
Q650T9696 DEAD-box ATP-dependent RN no no 0.727 0.514 0.402 9e-62
Q41382685 DEAD-box ATP-dependent RN N/A no 0.731 0.525 0.384 3e-59
Q9JIK5851 Nucleolar RNA helicase 2 yes no 0.813 0.470 0.354 2e-58
Q9BQ39737 ATP-dependent RNA helicas yes no 0.747 0.499 0.379 2e-57
>sp|Q8L7S8|RH3_ARATH DEAD-box ATP-dependent RNA helicase 3, chloroplastic OS=Arabidopsis thaliana GN=RH3 PE=1 SV=2 Back     alignment and function desciption
 Score =  668 bits (1724), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/387 (85%), Positives = 362/387 (93%)

Query: 1   MLAVGFEEDVELILENLPPKRQSMLFSATMPSWVKKLSRKYLDNPLNIDLVGNQDEKLAE 60
           MLAVGFEE VE ILENLP KRQSMLFSATMP+WVKKL+RKYLDNPLNIDLVG+QDEKLAE
Sbjct: 264 MLAVGFEEAVESILENLPTKRQSMLFSATMPTWVKKLARKYLDNPLNIDLVGDQDEKLAE 323

Query: 61  GIKLYAISTTATSKRTILSDLITVYAKGGKTIVFTQTKRDADEVSLALTSIIASEALHGD 120
           GIKLYAI+TT+TSKRTILSDLITVYAKGGKTIVFTQTKRDADEVSLAL++ IA+EALHGD
Sbjct: 324 GIKLYAIATTSTSKRTILSDLITVYAKGGKTIVFTQTKRDADEVSLALSNSIATEALHGD 383

Query: 121 ISQHQRERTLNGFRQGKFTVLVATDVAARGLDIPNVDLIIHYELPNDPETFVHRSGRTGR 180
           ISQHQRERTLN FRQGKFTVLVATDVA+RGLDIPNVDL+IHYELPNDPETFVHRSGRTGR
Sbjct: 384 ISQHQRERTLNAFRQGKFTVLVATDVASRGLDIPNVDLVIHYELPNDPETFVHRSGRTGR 443

Query: 181 AGKEGTAILMFTSSQRRTVRSLERDVGCKFEFVSPPVVEDVLESSAEQVVATLNGVHPES 240
           AGKEG+AILM TSSQ+RTVRSLERDVGC FEF+SPP V D+LESSA+QVVATLNGVHP+S
Sbjct: 444 AGKEGSAILMHTSSQKRTVRSLERDVGCHFEFISPPTVGDLLESSADQVVATLNGVHPDS 503

Query: 241 VEFFTPTAQRLIEEKGTDALAAALAQLSGFSRPPSSRSLINHEQGWVTLQLTRDSAFSRG 300
           ++FF+ TAQ+L EEKGTDALAAALA LSGFS+PPSSRSL++HE+GWVTLQL RD   +RG
Sbjct: 504 IKFFSATAQKLYEEKGTDALAAALAHLSGFSQPPSSRSLLSHEKGWVTLQLIRDPTNARG 563

Query: 301 FMSARSVMGFLSDVYPTAADEIGKIHIIADDRVQGAVFDLPEEIAKELLNKQIPPGNTIS 360
           F+SARSV GFLSD+Y TAADE+GKI +IADDR+QGAVFDLPEEIAKELL K +P GN++S
Sbjct: 564 FLSARSVTGFLSDLYRTAADEVGKIFLIADDRIQGAVFDLPEEIAKELLEKDVPEGNSLS 623

Query: 361 KITKLPALQDDGPSSDNYGRFSSRDRF 387
            ITKLP LQDDGPSSDNYGRFSSRDR 
Sbjct: 624 MITKLPPLQDDGPSSDNYGRFSSRDRM 650





Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 3
>sp|Q0DM51|RH3_ORYSJ DEAD-box ATP-dependent RNA helicase 3, chloroplastic OS=Oryza sativa subsp. japonica GN=Os03g0827700 PE=2 SV=2 Back     alignment and function description
>sp|Q0D8N0|RH53_ORYSJ DEAD-box ATP-dependent RNA helicase 53 OS=Oryza sativa subsp. japonica GN=Os07g0143700 PE=2 SV=2 Back     alignment and function description
>sp|Q9LUW5|RH53_ARATH DEAD-box ATP-dependent RNA helicase 53 OS=Arabidopsis thaliana GN=RH53 PE=2 SV=1 Back     alignment and function description
>sp|Q0ILZ4|RH9_ORYSJ DEAD-box ATP-dependent RNA helicase 9 OS=Oryza sativa subsp. japonica GN=Os12g0611200 PE=2 SV=1 Back     alignment and function description
>sp|Q9LUW6|RH9_ARATH DEAD-box ATP-dependent RNA helicase 9 OS=Arabidopsis thaliana GN=RH9 PE=2 SV=1 Back     alignment and function description
>sp|Q650T9|RH7_ORYSJ DEAD-box ATP-dependent RNA helicase 7 OS=Oryza sativa subsp. japonica GN=Os09g0520700 PE=2 SV=1 Back     alignment and function description
>sp|Q41382|RH7_SPIOL DEAD-box ATP-dependent RNA helicase 7 OS=Spinacia oleracea GN=RH7 PE=2 SV=1 Back     alignment and function description
>sp|Q9JIK5|DDX21_MOUSE Nucleolar RNA helicase 2 OS=Mus musculus GN=Ddx21 PE=1 SV=3 Back     alignment and function description
>sp|Q9BQ39|DDX50_HUMAN ATP-dependent RNA helicase DDX50 OS=Homo sapiens GN=DDX50 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query492
224124522 775 predicted protein [Populus trichocarpa] 0.969 0.615 0.796 0.0
118489724481 unknown [Populus trichocarpa x Populus d 0.969 0.991 0.798 0.0
225450401 764 PREDICTED: DEAD-box ATP-dependent RNA he 0.973 0.626 0.802 0.0
356505715 771 PREDICTED: DEAD-box ATP-dependent RNA he 0.991 0.632 0.794 0.0
224124506 735 predicted protein [Populus trichocarpa] 0.969 0.648 0.795 0.0
255543078 772 dead box ATP-dependent RNA helicase, put 0.957 0.610 0.758 0.0
356534927 736 PREDICTED: DEAD-box ATP-dependent RNA he 0.957 0.639 0.769 0.0
357511641 753 DEAD-box ATP-dependent RNA helicase [Med 0.965 0.630 0.786 0.0
343172316 782 DEAD-box ATP-dependent RNA helicase, par 0.963 0.606 0.747 0.0
356574052 736 PREDICTED: DEAD-box ATP-dependent RNA he 0.953 0.637 0.761 0.0
>gi|224124522|ref|XP_002330044.1| predicted protein [Populus trichocarpa] gi|222871469|gb|EEF08600.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  766 bits (1979), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/492 (79%), Positives = 423/492 (85%), Gaps = 15/492 (3%)

Query: 1   MLAVGFEEDVELILENLPPKRQSMLFSATMPSWVKKLSRKYLDNPLNIDLVGNQDEKLAE 60
           ML+ GFEEDVE+ILENLP KRQSMLFSATMP+WVKKL+RKYLDNPL IDLVG+Q+EKLAE
Sbjct: 295 MLSFGFEEDVEVILENLPSKRQSMLFSATMPTWVKKLARKYLDNPLQIDLVGDQEEKLAE 354

Query: 61  GIKLYAISTTATSKRTILSDLITVYAKGGKTIVFTQTKRDADEVSLALTSIIASEALHGD 120
           GIKLYA+S TA SKRTILSDL+TVYAKGGKTI+FTQTKRDADEVS+ALT+ IASEALHGD
Sbjct: 355 GIKLYALSATAASKRTILSDLVTVYAKGGKTIIFTQTKRDADEVSMALTNTIASEALHGD 414

Query: 121 ISQHQRERTLNGFRQGKFTVLVATDVAARGLDIPNVDLIIHYELPNDPETFVHRSGRTGR 180
           ISQHQRERTLNGFRQGKFTVLVATDVA+RGLDIPNVDLIIHYELPND ETFVHRSGRTGR
Sbjct: 415 ISQHQRERTLNGFRQGKFTVLVATDVASRGLDIPNVDLIIHYELPNDAETFVHRSGRTGR 474

Query: 181 AGKEGTAILMFTSSQRRTVRSLERDVGCKFEFVSPPVVEDVLESSAEQVVATLNGVHPES 240
           AGKEGTAILMFTSSQRRTVRSLERD GCKFEFVSPP +E+VLESSAEQVVATL+GVHPES
Sbjct: 475 AGKEGTAILMFTSSQRRTVRSLERDAGCKFEFVSPPAIEEVLESSAEQVVATLSGVHPES 534

Query: 241 VEFFTPTAQRLIEEKGTDALAAALAQLSGFSRPPSSRSLINHEQGWVTLQLTRDSAFSRG 300
           VEFFTPTAQ+LIEE+GT+ALAAALA LSGFS+PPSSRSLI+H QGW TLQLTRD  +SRG
Sbjct: 535 VEFFTPTAQKLIEEQGTNALAAALAHLSGFSQPPSSRSLISHAQGWATLQLTRDPTYSRG 594

Query: 301 FMSARSVMGFLSDVYPTAADEIGKIHIIADDRVQGAVFDLPEEIAKELLNKQIPPGNTIS 360
           F+SARSV GFLSDVYP AADE+GKIH+IAD+RVQGAVFDLPEEIAKELLNKQIPPGNTI+
Sbjct: 595 FLSARSVTGFLSDVYPAAADEVGKIHVIADERVQGAVFDLPEEIAKELLNKQIPPGNTIA 654

Query: 361 KITKLPALQDDGPSSDNYGRFSSRDRFSRGGGSRFSRGGARGGARGGGSMDRRGFRSSRS 420
           KITKLPALQDDGP  D YGRFSSRDR                     G          R 
Sbjct: 655 KITKLPALQDDGPPGDFYGRFSSRDR--------------PARGGPRGQRGGFRSSRGRG 700

Query: 421 WGSDDEDGFSSSRGGRSFRSGNNRGSRFSTSSDDDWLIGGSRSSRSSSRDRSFGGACFNC 480
            G D +DG +  RGGRS  S  N  S+ S SS DDWLIGG RSSR  SRDRSFGG+CFNC
Sbjct: 701 SGRDSDDGGTYRRGGRS-NSNENSWSQMSRSSGDDWLIGGRRSSRPPSRDRSFGGSCFNC 759

Query: 481 GKSGHRASECPN 492
           G+SGHRASECPN
Sbjct: 760 GRSGHRASECPN 771




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|118489724|gb|ABK96663.1| unknown [Populus trichocarpa x Populus deltoides] Back     alignment and taxonomy information
>gi|225450401|ref|XP_002278318.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 3, chloroplastic [Vitis vinifera] gi|296089875|emb|CBI39694.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356505715|ref|XP_003521635.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 3, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|224124506|ref|XP_002330040.1| predicted protein [Populus trichocarpa] gi|222871465|gb|EEF08596.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255543078|ref|XP_002512602.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis] gi|223548563|gb|EEF50054.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356534927|ref|XP_003536002.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 3, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|357511641|ref|XP_003626109.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula] gi|87240993|gb|ABD32851.1| Helicase, C-terminal; Zinc finger, CCHC-type; GUCT [Medicago truncatula] gi|355501124|gb|AES82327.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula] Back     alignment and taxonomy information
>gi|343172316|gb|AEL98862.1| DEAD-box ATP-dependent RNA helicase, partial [Silene latifolia] Back     alignment and taxonomy information
>gi|356574052|ref|XP_003555166.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 3, chloroplastic-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query492
TAIR|locus:504955106748 emb1138 "embryo defective 1138 0.768 0.505 0.849 4e-177
TAIR|locus:2087852616 PMH2 "putative mitochondrial R 0.445 0.355 0.643 9.6e-73
TAIR|locus:2087832610 PMH1 "putative mitochondrial R 0.477 0.385 0.595 4.8e-71
ZFIN|ZDB-GENE-031113-10759 ddx21 "DEAD (Asp-Glu-Ala-Asp) 0.747 0.484 0.396 1e-59
UNIPROTKB|F1MMK3737 DDX50 "Uncharacterized protein 0.754 0.503 0.379 3.2e-58
UNIPROTKB|E2QTT0738 DDX50 "Uncharacterized protein 0.754 0.502 0.377 5.1e-58
UNIPROTKB|E2RPT4687 DDX50 "Uncharacterized protein 0.754 0.540 0.377 5.1e-58
UNIPROTKB|Q9BQ39737 DDX50 "ATP-dependent RNA helic 0.754 0.503 0.377 1.1e-57
MGI|MGI:2182303734 Ddx50 "DEAD (Asp-Glu-Ala-Asp) 0.754 0.505 0.372 1.1e-57
TAIR|locus:2167903671 PRH75 [Arabidopsis thaliana (t 0.735 0.539 0.390 5.9e-57
TAIR|locus:504955106 emb1138 "embryo defective 1138" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1652 (586.6 bits), Expect = 4.0e-177, Sum P(2) = 4.0e-177
 Identities = 321/378 (84%), Positives = 354/378 (93%)

Query:     1 MLAVGFEEDVELILENLPPKRQSMLFSATMPSWVKKLSRKYLDNPLNIDLVGNQDEKLAE 60
             MLAVGFEE VE ILENLP KRQSMLFSATMP+WVKKL+RKYLDNPLNIDLVG+QDEKLAE
Sbjct:   264 MLAVGFEEAVESILENLPTKRQSMLFSATMPTWVKKLARKYLDNPLNIDLVGDQDEKLAE 323

Query:    61 GIKLYAISTTATSKRTILSDLITVYAKGGKTIVFTQTKRDADEVSLALTSIIASEALHGD 120
             GIKLYAI+TT+TSKRTILSDLITVYAKGGKTIVFTQTKRDADEVSLAL++ IA+EALHGD
Sbjct:   324 GIKLYAIATTSTSKRTILSDLITVYAKGGKTIVFTQTKRDADEVSLALSNSIATEALHGD 383

Query:   121 ISQHQRERTLNGFRQGKFTVLVATDVAARGLDIPNVDLIIHYELPNDPETFVHRSGRTGR 180
             ISQHQRERTLN FRQGKFTVLVATDVA+RGLDIPNVDL+IHYELPNDPETFVHRSGRTGR
Sbjct:   384 ISQHQRERTLNAFRQGKFTVLVATDVASRGLDIPNVDLVIHYELPNDPETFVHRSGRTGR 443

Query:   181 AGKEGTAILMFTSSQRRTVRSLERDVGCKFEFVSPPVVEDVLESSAEQVVATLNGVHPES 240
             AGKEG+AILM TSSQ+RTVRSLERDVGC FEF+SPP V D+LESSA+QVVATLNGVHP+S
Sbjct:   444 AGKEGSAILMHTSSQKRTVRSLERDVGCHFEFISPPTVGDLLESSADQVVATLNGVHPDS 503

Query:   241 VEFFTPTAQRLIEEKGTDALAAALAQLSGFSRPPSSRSLINHEQGWVTLQLTRDSAFSRG 300
             ++FF+ TAQ+L EEKGTDALAAALA LSGFS+PPSSRSL++HE+GWVTLQL RD   +RG
Sbjct:   504 IKFFSATAQKLYEEKGTDALAAALAHLSGFSQPPSSRSLLSHEKGWVTLQLIRDPTNARG 563

Query:   301 FMSARSVMGFLSDVYPTAADEIGKIHIIADDRVQGAVFDLPEEIAKELLNKQIPPGNTIS 360
             F+SARSV GFLSD+Y TAADE+GKI +IADDR+QGAVFDLPEEIAKELL K +P GN++S
Sbjct:   564 FLSARSVTGFLSDLYRTAADEVGKIFLIADDRIQGAVFDLPEEIAKELLEKDVPEGNSLS 623

Query:   361 KITKLPALQDDGPSSDNY 378
              ITKLP LQDDGPSSDNY
Sbjct:   624 MITKLPPLQDDGPSSDNY 641


GO:0003676 "nucleic acid binding" evidence=IEA
GO:0003723 "RNA binding" evidence=IEA
GO:0004386 "helicase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=IEA
GO:0008026 "ATP-dependent helicase activity" evidence=IEA;ISS
GO:0008270 "zinc ion binding" evidence=IEA
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0009793 "embryo development ending in seed dormancy" evidence=NAS
GO:0009570 "chloroplast stroma" evidence=IDA
GO:0016020 "membrane" evidence=IDA
GO:0009941 "chloroplast envelope" evidence=IDA
TAIR|locus:2087852 PMH2 "putative mitochondrial RNA helicase 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2087832 PMH1 "putative mitochondrial RNA helicase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-031113-10 ddx21 "DEAD (Asp-Glu-Ala-Asp) box polypeptide 21" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1MMK3 DDX50 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2QTT0 DDX50 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E2RPT4 DDX50 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q9BQ39 DDX50 "ATP-dependent RNA helicase DDX50" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:2182303 Ddx50 "DEAD (Asp-Glu-Ala-Asp) box polypeptide 50" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
TAIR|locus:2167903 PRH75 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q0DM51RH3_ORYSJ3, ., 6, ., 4, ., 1, 30.81550.78250.5079yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.4.130.946
3rd Layer3.6.40.963

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query492
COG0513513 COG0513, SrmB, Superfamily II DNA and RNA helicase 6e-64
PRK11776460 PRK11776, PRK11776, ATP-dependent RNA helicase Dbp 3e-49
PRK10590456 PRK10590, PRK10590, ATP-dependent RNA helicase Rhl 4e-40
cd00079131 cd00079, HELICc, Helicase superfamily c-terminal d 5e-39
PTZ00110545 PTZ00110, PTZ00110, helicase; Provisional 1e-38
PRK11634629 PRK11634, PRK11634, ATP-dependent RNA helicase Dea 1e-37
PTZ00424401 PTZ00424, PTZ00424, helicase 45; Provisional 3e-35
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 2e-34
PRK01297475 PRK01297, PRK01297, ATP-dependent RNA helicase Rhl 4e-33
pfam0815297 pfam08152, GUCT, GUCT (NUC152) domain 1e-28
PRK04837423 PRK04837, PRK04837, ATP-dependent RNA helicase Rhl 2e-28
pfam0027178 pfam00271, Helicase_C, Helicase conserved C-termin 2e-27
PRK04537572 PRK04537, PRK04537, ATP-dependent RNA helicase Rhl 1e-26
smart0049082 smart00490, HELICc, helicase superfamily c-termina 2e-25
PLN00206518 PLN00206, PLN00206, DEAD-box ATP-dependent RNA hel 2e-19
cd1293874 cd12938, GUCT_Hera, RNA-binding GUCT-like domain f 5e-19
COG1111542 COG1111, MPH1, ERCC4-like helicases [DNA replicati 1e-15
PRK13766773 PRK13766, PRK13766, Hef nuclease; Provisional 6e-15
COG1061442 COG1061, SSL2, DNA or RNA helicases of superfamily 4e-14
cd00268203 cd00268, DEADc, DEAD-box helicases 2e-13
COG0514590 COG0514, RecQ, Superfamily II DNA helicase [DNA re 1e-12
TIGR01389591 TIGR01389, recQ, ATP-dependent DNA helicase RecQ 6e-11
TIGR00614470 TIGR00614, recQ_fam, ATP-dependent DNA helicase, R 1e-09
cd1293786 cd12937, GUCT_RH7_like, RNA-binding GUCT domain fo 6e-09
COG1201 814 COG1201, Lhr, Lhr-like helicases [General function 9e-09
TIGR01587358 TIGR01587, cas3_core, CRISPR-associated helicase C 1e-08
TIGR00631655 TIGR00631, uvrb, excinuclease ABC, B subunit 6e-08
COG0556663 COG0556, UvrB, Helicase subunit of the DNA excisio 9e-08
pfam00270169 pfam00270, DEAD, DEAD/DEAH box helicase 1e-07
TIGR00580926 TIGR00580, mfd, transcription-repair coupling fact 2e-07
COG11971139 COG1197, Mfd, Transcription-repair coupling factor 8e-07
COG1202830 COG1202, COG1202, Superfamily II helicase, archaea 9e-07
pfam0009818 pfam00098, zf-CCHC, Zinc knuckle 1e-06
smart00487201 smart00487, DEXDc, DEAD-like helicases superfamily 1e-06
TIGR00643630 TIGR00643, recG, ATP-dependent DNA helicase RecG 2e-06
cd09639353 cd09639, Cas3_I, CRISPR/Cas system-associated prot 2e-06
smart0034317 smart00343, ZnF_C2HC, zinc finger 3e-06
COG1205 851 COG1205, COG1205, Distinct helicase family with a 7e-06
COG1200677 COG1200, RecG, RecG-like helicase [DNA replication 9e-06
PRK106891147 PRK10689, PRK10689, transcription-repair coupling 1e-05
PRK11057607 PRK11057, PRK11057, ATP-dependent DNA helicase Rec 2e-05
PTZ00368148 PTZ00368, PTZ00368, universal minicircle sequence 2e-04
PRK09751 1490 PRK09751, PRK09751, putative ATP-dependent helicas 2e-04
PRK05580679 PRK05580, PRK05580, primosome assembly protein Pri 6e-04
COG4098441 COG4098, comFA, Superfamily II DNA/RNA helicase re 6e-04
PRK05298652 PRK05298, PRK05298, excinuclease ABC subunit B; Pr 0.001
PRK10917681 PRK10917, PRK10917, ATP-dependent DNA helicase Rec 0.001
TIGR03817742 TIGR03817, DECH_helic, helicase/secretion neighbor 0.001
COG5082 190 COG5082, AIR1, Arginine methyltransferase-interact 0.002
PLN03137 1195 PLN03137, PLN03137, ATP-dependent DNA helicase; Q4 0.002
TIGR04121 803 TIGR04121, DEXH_lig_assoc, DEXH box helicase, DNA 0.004
PRK00254720 PRK00254, PRK00254, ski2-like helicase; Provisiona 0.004
>gnl|CDD|223587 COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
 Score =  215 bits (549), Expect = 6e-64
 Identities = 100/289 (34%), Positives = 157/289 (54%), Gaps = 12/289 (4%)

Query: 1   MLAVGFEEDVELILENLPPKRQSMLFSATMPSWVKKLSRKYLDNPLNIDLVGNQDEKLAE 60
           ML +GF +D+E IL+ LPP RQ++LFSATMP  +++L+R+YL++P+ I++   + E+  +
Sbjct: 186 MLDMGFIDDIEKILKALPPDRQTLLFSATMPDDIRELARRYLNDPVEIEVSVEKLERTLK 245

Query: 61  GIKLYAIST-TATSKRTILSDLITVYAKGGKTIVFTQTKRDADEVSLALTSI-IASEALH 118
            IK + +   +   K  +L  L+    +G + IVF +TKR  +E++ +L        ALH
Sbjct: 246 KIKQFYLEVESEEEKLELLLKLLKDEDEG-RVIVFVRTKRLVEELAESLRKRGFKVAALH 304

Query: 119 GDISQHQRERTLNGFRQGKFTVLVATDVAARGLDIPNVDLIIHYELPNDPETFVHRSGRT 178
           GD+ Q +R+R L  F+ G+  VLVATDVAARGLDIP+V  +I+Y+LP DPE +VHR GRT
Sbjct: 305 GDLPQEERDRALEKFKDGELRVLVATDVAARGLDIPDVSHVINYDLPLDPEDYVHRIGRT 364

Query: 179 GRAGKEGTAILMFTSS-QRRTVRSLERDVGCKFE-FVSPPVVEDVLESSAEQVVATLNGV 236
           GRAG++G AI   T   + + ++ +E+ +  K    V  P+ E       +     L   
Sbjct: 365 GRAGRKGVAISFVTEEEEVKKLKRIEKRLERKLPSAVLLPLDEPEDAKLLKTTRPGLEEE 424

Query: 237 HPESVE-------FFTPTAQRLIEEKGTDALAAALAQLSGFSRPPSSRS 278
              S E                +    +  LA    ++ G     +   
Sbjct: 425 SDISDEIKKLKSSKKALLRGLGVRFTLSKLLANLGKEIPGAGDAVTIDP 473


Length = 513

>gnl|CDD|236977 PRK11776, PRK11776, ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>gnl|CDD|236722 PRK10590, PRK10590, ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>gnl|CDD|238034 cd00079, HELICc, Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>gnl|CDD|240273 PTZ00110, PTZ00110, helicase; Provisional Back     alignment and domain information
>gnl|CDD|236941 PRK11634, PRK11634, ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>gnl|CDD|185609 PTZ00424, PTZ00424, helicase 45; Provisional Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|203861 pfam08152, GUCT, GUCT (NUC152) domain Back     alignment and domain information
>gnl|CDD|235314 PRK04837, PRK04837, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|201125 pfam00271, Helicase_C, Helicase conserved C-terminal domain Back     alignment and domain information
>gnl|CDD|235307 PRK04537, PRK04537, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|197757 smart00490, HELICc, helicase superfamily c-terminal domain Back     alignment and domain information
>gnl|CDD|215103 PLN00206, PLN00206, DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>gnl|CDD|240595 cd12938, GUCT_Hera, RNA-binding GUCT-like domain found in Thermus thermophilus heat resistant RNA-dependent ATPase (Hera) and similar proteins Back     alignment and domain information
>gnl|CDD|224036 COG1111, MPH1, ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|237496 PRK13766, PRK13766, Hef nuclease; Provisional Back     alignment and domain information
>gnl|CDD|223989 COG1061, SSL2, DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|238167 cd00268, DEADc, DEAD-box helicases Back     alignment and domain information
>gnl|CDD|223588 COG0514, RecQ, Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|130456 TIGR01389, recQ, ATP-dependent DNA helicase RecQ Back     alignment and domain information
>gnl|CDD|129701 TIGR00614, recQ_fam, ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>gnl|CDD|240594 cd12937, GUCT_RH7_like, RNA-binding GUCT domain found in plant DEAD-box ATP-dependent RNA helicase 7 (RH7) and similar proteins Back     alignment and domain information
>gnl|CDD|224122 COG1201, Lhr, Lhr-like helicases [General function prediction only] Back     alignment and domain information
>gnl|CDD|233483 TIGR01587, cas3_core, CRISPR-associated helicase Cas3 Back     alignment and domain information
>gnl|CDD|233063 TIGR00631, uvrb, excinuclease ABC, B subunit Back     alignment and domain information
>gnl|CDD|223630 COG0556, UvrB, Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|215832 pfam00270, DEAD, DEAD/DEAH box helicase Back     alignment and domain information
>gnl|CDD|233032 TIGR00580, mfd, transcription-repair coupling factor (mfd) Back     alignment and domain information
>gnl|CDD|224118 COG1197, Mfd, Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>gnl|CDD|224123 COG1202, COG1202, Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>gnl|CDD|189387 pfam00098, zf-CCHC, Zinc knuckle Back     alignment and domain information
>gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|233069 TIGR00643, recG, ATP-dependent DNA helicase RecG Back     alignment and domain information
>gnl|CDD|187770 cd09639, Cas3_I, CRISPR/Cas system-associated protein Cas3 Back     alignment and domain information
>gnl|CDD|197667 smart00343, ZnF_C2HC, zinc finger Back     alignment and domain information
>gnl|CDD|224126 COG1205, COG1205, Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>gnl|CDD|224121 COG1200, RecG, RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>gnl|CDD|182649 PRK10689, PRK10689, transcription-repair coupling factor; Provisional Back     alignment and domain information
>gnl|CDD|182933 PRK11057, PRK11057, ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>gnl|CDD|173561 PTZ00368, PTZ00368, universal minicircle sequence binding protein (UMSBP); Provisional Back     alignment and domain information
>gnl|CDD|137505 PRK09751, PRK09751, putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>gnl|CDD|235514 PRK05580, PRK05580, primosome assembly protein PriA; Validated Back     alignment and domain information
>gnl|CDD|226583 COG4098, comFA, Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|235395 PRK05298, PRK05298, excinuclease ABC subunit B; Provisional Back     alignment and domain information
>gnl|CDD|236794 PRK10917, PRK10917, ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>gnl|CDD|234365 TIGR03817, DECH_helic, helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>gnl|CDD|227414 COG5082, AIR1, Arginine methyltransferase-interacting protein, contains RING Zn-finger [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|215597 PLN03137, PLN03137, ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>gnl|CDD|234478 TIGR04121, DEXH_lig_assoc, DEXH box helicase, DNA ligase-associated Back     alignment and domain information
>gnl|CDD|234702 PRK00254, PRK00254, ski2-like helicase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 492
PRK11634629 ATP-dependent RNA helicase DeaD; Provisional 100.0
KOG0331519 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0328400 consensus Predicted ATP-dependent RNA helicase FAL 100.0
COG0513513 SrmB Superfamily II DNA and RNA helicases [DNA rep 100.0
KOG0342543 consensus ATP-dependent RNA helicase pitchoune [RN 100.0
KOG0330476 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0333673 consensus U5 snRNP-like RNA helicase subunit [RNA 100.0
PRK11776460 ATP-dependent RNA helicase DbpA; Provisional 100.0
KOG0343758 consensus RNA Helicase [RNA processing and modific 100.0
KOG0345567 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0336629 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0326459 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0340442 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0338691 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0341610 consensus DEAD-box protein abstrakt [RNA processin 100.0
KOG0327397 consensus Translation initiation factor 4F, helica 100.0
PTZ00110545 helicase; Provisional 100.0
PRK10590456 ATP-dependent RNA helicase RhlE; Provisional 100.0
KOG0335482 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0332477 consensus ATP-dependent RNA helicase [RNA processi 100.0
PRK04537572 ATP-dependent RNA helicase RhlB; Provisional 100.0
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 100.0
PLN00206518 DEAD-box ATP-dependent RNA helicase; Provisional 100.0
PRK11192434 ATP-dependent RNA helicase SrmB; Provisional 100.0
KOG0346569 consensus RNA helicase [RNA processing and modific 100.0
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 99.98
KOG0339731 consensus ATP-dependent RNA helicase [RNA processi 99.97
KOG0348708 consensus ATP-dependent RNA helicase [RNA processi 99.97
PTZ00424401 helicase 45; Provisional 99.97
KOG0334997 consensus RNA helicase [RNA processing and modific 99.97
KOG0347731 consensus RNA helicase [RNA processing and modific 99.97
TIGR03817742 DECH_helic helicase/secretion neighborhood putativ 99.96
KOG0337529 consensus ATP-dependent RNA helicase [RNA processi 99.96
KOG4284 980 consensus DEAD box protein [Transcription] 99.95
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 99.95
TIGR00614470 recQ_fam ATP-dependent DNA helicase, RecQ family. 99.95
KOG0344593 consensus ATP-dependent RNA helicase [RNA processi 99.95
PHA02653675 RNA helicase NPH-II; Provisional 99.94
PRK11057607 ATP-dependent DNA helicase RecQ; Provisional 99.94
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 99.94
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 99.93
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 99.93
TIGR01389591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 99.92
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 99.91
KOG0350620 consensus DEAD-box ATP-dependent RNA helicase [RNA 99.91
TIGR00580926 mfd transcription-repair coupling factor (mfd). Al 99.9
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 99.9
PRK13767 876 ATP-dependent helicase; Provisional 99.9
COG0514590 RecQ Superfamily II DNA helicase [DNA replication, 99.9
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 99.89
PRK106891147 transcription-repair coupling factor; Provisional 99.89
KOG0329387 consensus ATP-dependent RNA helicase [RNA processi 99.88
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 99.87
PRK02362737 ski2-like helicase; Provisional 99.87
PRK12898656 secA preprotein translocase subunit SecA; Reviewed 99.87
PRK00254720 ski2-like helicase; Provisional 99.86
PRK04914956 ATP-dependent helicase HepA; Validated 99.86
PRK10917681 ATP-dependent DNA helicase RecG; Provisional 99.86
KOG0349725 consensus Putative DEAD-box RNA helicase DDX1 [RNA 99.85
TIGR00643630 recG ATP-dependent DNA helicase RecG. 99.84
PRK09401 1176 reverse gyrase; Reviewed 99.81
PRK01172674 ski2-like helicase; Provisional 99.81
PRK09200790 preprotein translocase subunit SecA; Reviewed 99.81
PRK05298652 excinuclease ABC subunit B; Provisional 99.8
TIGR00631655 uvrb excinuclease ABC, B subunit. This family is b 99.78
COG1201 814 Lhr Lhr-like helicases [General function predictio 99.78
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. 99.78
PRK14701 1638 reverse gyrase; Provisional 99.78
KOG0351941 consensus ATP-dependent DNA helicase [Replication, 99.77
COG1111542 MPH1 ERCC4-like helicases [DNA replication, recomb 99.77
PHA02558501 uvsW UvsW helicase; Provisional 99.77
TIGR03714762 secA2 accessory Sec system translocase SecA2. Memb 99.76
cd00079131 HELICc Helicase superfamily c-terminal domain; ass 99.75
TIGR00963745 secA preprotein translocase, SecA subunit. The pro 99.75
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 99.74
COG1202830 Superfamily II helicase, archaea-specific [General 99.71
PRK12906796 secA preprotein translocase subunit SecA; Reviewed 99.71
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombi 99.71
PF0027178 Helicase_C: Helicase conserved C-terminal domain; 99.69
KOG0922674 consensus DEAH-box RNA helicase [RNA processing an 99.69
KOG0352641 consensus ATP-dependent DNA helicase [Replication, 99.69
TIGR00603732 rad25 DNA repair helicase rad25. All proteins in t 99.68
PRK09694878 helicase Cas3; Provisional 99.68
PRK129001025 secA preprotein translocase subunit SecA; Reviewed 99.67
PRK13766773 Hef nuclease; Provisional 99.65
KOG0923902 consensus mRNA splicing factor ATP-dependent RNA h 99.65
KOG0354746 consensus DEAD-box like helicase [General function 99.64
COG1204766 Superfamily II helicase [General function predicti 99.63
COG1200677 RecG RecG-like helicase [DNA replication, recombin 99.62
TIGR00595505 priA primosomal protein N'. All proteins in this f 99.57
COG0556663 UvrB Helicase subunit of the DNA excision repair c 99.57
KOG0353695 consensus ATP-dependent DNA helicase [General func 99.54
PRK05580679 primosome assembly protein PriA; Validated 99.54
COG4098441 comFA Superfamily II DNA/RNA helicase required for 99.54
KOG09241042 consensus mRNA splicing factor ATP-dependent RNA h 99.54
smart0049082 HELICc helicase superfamily c-terminal domain. 99.53
KOG0920924 consensus ATP-dependent RNA helicase A [RNA proces 99.5
COG1205 851 Distinct helicase family with a unique C-terminal 99.5
KOG09501008 consensus DNA polymerase theta/eta, DEAD-box super 99.49
KOG0925699 consensus mRNA splicing factor ATP-dependent RNA h 99.46
COG1203733 CRISPR-associated helicase Cas3 [Defense mechanism 99.45
KOG0947 1248 consensus Cytoplasmic exosomal RNA helicase SKI2, 99.44
COG11971139 Mfd Transcription-repair coupling factor (superfam 99.44
PRK12904830 preprotein translocase subunit SecA; Reviewed 99.44
KOG0951 1674 consensus RNA helicase BRR2, DEAD-box superfamily 99.39
KOG0952 1230 consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup 99.39
PRK13104896 secA preprotein translocase subunit SecA; Reviewed 99.39
KOG41501034 consensus Predicted ATP-dependent RNA helicase [RN 99.38
PRK13107908 preprotein translocase subunit SecA; Reviewed 99.36
KOG0926 1172 consensus DEAH-box RNA helicase [RNA processing an 99.35
KOG0331519 consensus ATP-dependent RNA helicase [RNA processi 99.33
PLN03142 1033 Probable chromatin-remodeling complex ATPase chain 99.27
KOG0948 1041 consensus Nuclear exosomal RNA helicase MTR4, DEAD 99.26
PRK10590456 ATP-dependent RNA helicase RhlE; Provisional 99.24
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Trans 99.22
KOG0921 1282 consensus Dosage compensation complex, subunit MLE 99.14
PRK114481123 hsdR type I restriction enzyme EcoKI subunit R; Pr 99.13
PF0815297 GUCT: GUCT (NUC152) domain; InterPro: IPR012562 Th 99.07
COG0513513 SrmB Superfamily II DNA and RNA helicases [DNA rep 99.04
KOG0339731 consensus ATP-dependent RNA helicase [RNA processi 99.04
COG4581 1041 Superfamily II RNA helicase [DNA replication, reco 99.02
PRK04537572 ATP-dependent RNA helicase RhlB; Provisional 98.9
KOG0341610 consensus DEAD-box protein abstrakt [RNA processin 98.87
KOG0953700 consensus Mitochondrial RNA helicase SUV3, DEAD-bo 98.85
PRK12903925 secA preprotein translocase subunit SecA; Reviewed 98.84
COG1198730 PriA Primosomal protein N' (replication factor Y) 98.83
KOG0336629 consensus ATP-dependent RNA helicase [RNA processi 98.82
PRK12326764 preprotein translocase subunit SecA; Reviewed 98.78
PF0009818 zf-CCHC: Zinc knuckle; InterPro: IPR001878 Zinc fi 98.75
KOG0330476 consensus ATP-dependent RNA helicase [RNA processi 98.72
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 98.7
KOG0338691 consensus ATP-dependent RNA helicase [RNA processi 98.67
TIGR01407850 dinG_rel DnaQ family exonuclease/DinG family helic 98.66
PRK12899970 secA preprotein translocase subunit SecA; Reviewed 98.64
PF06862442 DUF1253: Protein of unknown function (DUF1253); In 98.6
KOG0335482 consensus ATP-dependent RNA helicase [RNA processi 98.6
KOG0385971 consensus Chromatin remodeling complex WSTF-ISWI, 98.59
PRK129011112 secA preprotein translocase subunit SecA; Reviewed 98.58
PRK13103913 secA preprotein translocase subunit SecA; Reviewed 98.58
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 98.55
PF0388074 DbpA: DbpA RNA binding domain ; InterPro: IPR00558 98.53
PRK11776460 ATP-dependent RNA helicase DbpA; Provisional 98.47
KOG0384 1373 consensus Chromodomain-helicase DNA-binding protei 98.45
KOG0390776 consensus DNA repair protein, SNF2 family [Replica 98.38
PRK11192434 ATP-dependent RNA helicase SrmB; Provisional 98.36
CHL00122870 secA preprotein translocase subunit SecA; Validate 98.35
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 98.34
KOG0333673 consensus U5 snRNP-like RNA helicase subunit [RNA 98.32
KOG0387923 consensus Transcription-coupled repair protein CSB 98.32
KOG0347731 consensus RNA helicase [RNA processing and modific 98.27
KOG03921549 consensus SNF2 family DNA-dependent ATPase domain- 98.22
PRK08074928 bifunctional ATP-dependent DNA helicase/DNA polyme 98.21
KOG0391 1958 consensus SNF2 family DNA-dependent ATPase [Genera 98.21
PTZ00110545 helicase; Provisional 98.18
PTZ00368148 universal minicircle sequence binding protein (UMS 98.18
PTZ00368148 universal minicircle sequence binding protein (UMS 98.15
KOG09491330 consensus Predicted helicase, DEAD-box superfamily 98.14
COG5082190 AIR1 Arginine methyltransferase-interacting protei 98.11
PRK12902939 secA preprotein translocase subunit SecA; Reviewed 98.05
KOG1000689 consensus Chromatin remodeling protein HARP/SMARCA 98.05
PRK07246820 bifunctional ATP-dependent DNA helicase/DNA polyme 98.04
KOG0345567 consensus ATP-dependent RNA helicase [RNA processi 98.01
PRK11747697 dinG ATP-dependent DNA helicase DinG; Provisional 97.98
COG1199654 DinG Rad3-related DNA helicases [Transcription / D 97.94
TIGR00348667 hsdR type I site-specific deoxyribonuclease, HsdR 97.91
COG4096875 HsdR Type I site-specific restriction-modification 97.91
COG0553866 HepA Superfamily II DNA/RNA helicases, SNF2 family 97.9
TIGR025621110 cas3_yersinia CRISPR-associated helicase Cas3. The 97.9
KOG0334 997 consensus RNA helicase [RNA processing and modific 97.89
KOG1123776 consensus RNA polymerase II transcription initiati 97.86
KOG1002791 consensus Nucleotide excision repair protein RAD16 97.85
KOG0340442 consensus ATP-dependent RNA helicase [RNA processi 97.82
PF13307167 Helicase_C_2: Helicase C-terminal domain; PDB: 4A1 97.78
KOG0389941 consensus SNF2 family DNA-dependent ATPase [Chroma 97.75
KOG03881185 consensus SNF2 family DNA-dependent ATPase [Replic 97.74
KOG03861157 consensus Chromatin remodeling complex SWI/SNF, co 97.73
TIGR00580926 mfd transcription-repair coupling factor (mfd). Al 97.66
TIGR03117636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 97.64
PRK106891147 transcription-repair coupling factor; Provisional 97.54
TIGR00614470 recQ_fam ATP-dependent DNA helicase, RecQ family. 97.53
PF1369632 zf-CCHC_2: Zinc knuckle 97.53
KOG3973465 consensus Uncharacterized conserved glycine-rich p 97.52
PRK10917681 ATP-dependent DNA helicase RecG; Provisional 97.48
TIGR00604705 rad3 DNA repair helicase (rad3). All proteins in t 97.45
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 97.44
KOG4400261 consensus E3 ubiquitin ligase interacting with arg 97.43
KOG10151567 consensus Transcription regulator XNP/ATRX, DEAD-b 97.39
KOG09211282 consensus Dosage compensation complex, subunit MLE 97.39
PLN00206518 DEAD-box ATP-dependent RNA helicase; Provisional 97.39
TIGR00596 814 rad1 DNA repair protein (rad1). This family is bas 97.34
KOG0328400 consensus Predicted ATP-dependent RNA helicase FAL 97.34
KOG4284 980 consensus DEAD box protein [Transcription] 97.25
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 97.23
COG0653822 SecA Preprotein translocase subunit SecA (ATPase, 97.2
PF1391742 zf-CCHC_3: Zinc knuckle 97.13
KOG09511674 consensus RNA helicase BRR2, DEAD-box superfamily 97.08
KOG0342543 consensus ATP-dependent RNA helicase pitchoune [RN 97.01
COG4889 1518 Predicted helicase [General function prediction on 96.97
PRK14873665 primosome assembly protein PriA; Provisional 96.96
PF1478736 zf-CCHC_5: GAG-polyprotein viral zinc-finger; PDB: 96.92
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 96.92
KOG0337529 consensus ATP-dependent RNA helicase [RNA processi 96.85
smart0034326 ZnF_C2HC zinc finger. 96.8
PF13871278 Helicase_C_4: Helicase_C-like 96.77
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 96.73
COG5082190 AIR1 Arginine methyltransferase-interacting protei 96.72
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 96.67
PTZ00424401 helicase 45; Provisional 96.67
KOG0326459 consensus ATP-dependent RNA helicase [RNA processi 96.64
KOG0343 758 consensus RNA Helicase [RNA processing and modific 96.63
KOG0109 346 consensus RNA-binding protein LARK, contains RRM a 96.5
PRK05580679 primosome assembly protein PriA; Validated 96.5
TIGR00595505 priA primosomal protein N'. All proteins in this f 96.46
KOG4439901 consensus RNA polymerase II transcription terminat 96.4
KOG0329387 consensus ATP-dependent RNA helicase [RNA processi 96.35
PF02399 824 Herpes_ori_bp: Origin of replication binding prote 96.33
KOG0348708 consensus ATP-dependent RNA helicase [RNA processi 96.29
PRK14873665 primosome assembly protein PriA; Provisional 96.25
TIGR00643630 recG ATP-dependent DNA helicase RecG. 96.23
KOG0346569 consensus RNA helicase [RNA processing and modific 96.14
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 96.11
KOG4400261 consensus E3 ubiquitin ligase interacting with arg 96.05
KOG0344593 consensus ATP-dependent RNA helicase [RNA processi 96.03
KOG2340698 consensus Uncharacterized conserved protein [Funct 95.8
KOG0350620 consensus DEAD-box ATP-dependent RNA helicase [RNA 95.72
PRK09401 1176 reverse gyrase; Reviewed 95.63
COG1200677 RecG RecG-like helicase [DNA replication, recombin 95.45
PF0009818 zf-CCHC: Zinc knuckle; InterPro: IPR001878 Zinc fi 95.34
KOG0332477 consensus ATP-dependent RNA helicase [RNA processi 95.28
smart00492141 HELICc3 helicase superfamily c-terminal domain. 95.11
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 94.98
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 94.97
PRK13767 876 ATP-dependent helicase; Provisional 94.86
COG1198730 PriA Primosomal protein N' (replication factor Y) 94.63
smart00491142 HELICc2 helicase superfamily c-terminal domain. 94.52
KOG0327397 consensus Translation initiation factor 4F, helica 94.15
KOG0701 1606 consensus dsRNA-specific nuclease Dicer and relate 93.99
KOG3973465 consensus Uncharacterized conserved glycine-rich p 93.93
COG1111542 MPH1 ERCC4-like helicases [DNA replication, recomb 93.78
KOG1016 1387 consensus Predicted DNA helicase, DEAD-box superfa 93.65
PRK14701 1638 reverse gyrase; Provisional 93.57
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 93.41
KOG0119 554 consensus Splicing factor 1/branch point binding p 93.31
PHA02653675 RNA helicase NPH-II; Provisional 93.15
PF1439249 zf-CCHC_4: Zinc knuckle 92.86
PF1528840 zf-CCHC_6: Zinc knuckle 92.46
COG11971139 Mfd Transcription-repair coupling factor (superfam 92.1
COG5222 427 Uncharacterized conserved protein, contains RING Z 90.71
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 89.46
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 89.18
KOG15131300 consensus Nuclear helicase MOP-3/SNO (DEAD-box sup 88.43
KOG1001674 consensus Helicase-like transcription factor HLTF/ 88.29
PRK13766 773 Hef nuclease; Provisional 87.9
KOG0107195 consensus Alternative splicing factor SRp20/9G8 (R 86.17
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 85.72
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 85.07
PF12683275 DUF3798: Protein of unknown function (DUF3798); In 84.89
PF10593239 Z1: Z1 domain; InterPro: IPR018310 This entry repr 84.45
KOG0107195 consensus Alternative splicing factor SRp20/9G8 (R 82.56
COG1205 851 Distinct helicase family with a unique C-terminal 81.36
smart00487201 DEXDc DEAD-like helicases superfamily. 80.35
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
Probab=100.00  E-value=7.2e-52  Score=444.10  Aligned_cols=344  Identities=29%  Similarity=0.470  Sum_probs=298.6

Q ss_pred             CCCCChHHHHHHHHHhCCCCCcEEEEeeeCChHHHHHHHHHcCCCceEEeecccccccccceEEEEEEcCcccHHHHHHH
Q 011149            1 MLAVGFEEDVELILENLPPKRQSMLFSATMPSWVKKLSRKYLDNPLNIDLVGNQDEKLAEGIKLYAISTTATSKRTILSD   80 (492)
Q Consensus         1 mL~~GF~~~l~~Il~~~~~~~q~ll~SAT~p~~i~~~~~~~~~~~~~i~~~~~~~~~~~~~i~~~~~~~~~~~k~~~l~~   80 (492)
                      ||+|||.++++.|+..+|...|+++||||+|+.+..++++|+.+|..|.+..  .......+.+.++.+....|.+.|..
T Consensus       161 ml~~gf~~di~~Il~~lp~~~q~llfSAT~p~~i~~i~~~~l~~~~~i~i~~--~~~~~~~i~q~~~~v~~~~k~~~L~~  238 (629)
T PRK11634        161 MLRMGFIEDVETIMAQIPEGHQTALFSATMPEAIRRITRRFMKEPQEVRIQS--SVTTRPDISQSYWTVWGMRKNEALVR  238 (629)
T ss_pred             HhhcccHHHHHHHHHhCCCCCeEEEEEccCChhHHHHHHHHcCCCeEEEccC--ccccCCceEEEEEEechhhHHHHHHH
Confidence            7899999999999999999999999999999999999999999998887653  23345667788888877788888888


Q ss_pred             HHHHHccCCeEEEEeCChHHHHHHHHHHHc-ccceeeecCCCCHHHHHHHHhhhcCCCeEEEEecccccccCCCCCcCEE
Q 011149           81 LITVYAKGGKTIVFTQTKRDADEVSLALTS-IIASEALHGDISQHQRERTLNGFRQGKFTVLVATDVAARGLDIPNVDLI  159 (492)
Q Consensus        81 ll~~~~~~~~~iVF~~t~~~~~~l~~~l~~-~~~~~~lhg~~~~~~r~~~~~~F~~g~~~iLVaT~~~~~Gidi~~v~~V  159 (492)
                      ++... ...++||||+|+..++.|++.|.. .+.+..+||+|++.+|++++++|++|+++|||||+++++|||+|+|++|
T Consensus       239 ~L~~~-~~~~~IVF~~tk~~a~~l~~~L~~~g~~~~~lhgd~~q~~R~~il~~Fr~G~~~ILVATdv~arGIDip~V~~V  317 (629)
T PRK11634        239 FLEAE-DFDAAIIFVRTKNATLEVAEALERNGYNSAALNGDMNQALREQTLERLKDGRLDILIATDVAARGLDVERISLV  317 (629)
T ss_pred             HHHhc-CCCCEEEEeccHHHHHHHHHHHHhCCCCEEEeeCCCCHHHHHHHHHHHhCCCCCEEEEcchHhcCCCcccCCEE
Confidence            88764 457899999999999999999985 7899999999999999999999999999999999999999999999999


Q ss_pred             EecCCCCChhHHHHHhhhcccCCCCCeEEEecChhhHHHHHHHHHHhCCCceecCCCCHHHHHHHHHHHHHHHhccCC-c
Q 011149          160 IHYELPNDPETFVHRSGRTGRAGKEGTAILMFTSSQRRTVRSLERDVGCKFEFVSPPVVEDVLESSAEQVVATLNGVH-P  238 (492)
Q Consensus       160 I~~~~P~~~~~y~qr~GR~gR~g~~g~~i~l~~~~e~~~~~~l~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~l~~~~-~  238 (492)
                      ||||+|.++++|+||+|||||+|+.|.+++|+.+.|...++.|++.++..+++..+|..+++.+.....+...+.... .
T Consensus       318 I~~d~P~~~e~yvqRiGRtGRaGr~G~ai~~v~~~e~~~l~~ie~~~~~~i~~~~~p~~~~~~~~~~~~~~~~~~~~~~~  397 (629)
T PRK11634        318 VNYDIPMDSESYVHRIGRTGRAGRAGRALLFVENRERRLLRNIERTMKLTIPEVELPNAELLGKRRLEKFAAKVQQQLES  397 (629)
T ss_pred             EEeCCCCCHHHHHHHhccccCCCCcceEEEEechHHHHHHHHHHHHhCCCcceecCCcHHHHHHHHHHHHHHHHHHHhhh
Confidence            999999999999999999999999999999999999999999999999999999999998888887777777665432 3


Q ss_pred             cchhhhHHHHHHHHhh-----hCHHHHHHHHHHHcCCCCC------C-----C---Ccc-----------------c--c
Q 011149          239 ESVEFFTPTAQRLIEE-----KGTDALAAALAQLSGFSRP------P-----S---SRS-----------------L--I  280 (492)
Q Consensus       239 ~~~~~f~~~a~~l~~~-----~~~~~l~~al~~~~~~~~~------~-----~---~~~-----------------l--~  280 (492)
                      +.++.|.+.+++++++     .+.+.++++|+.+.--..+      +     +   .+.                 .  .
T Consensus       398 ~~~~~~~~~~~~l~~~~~~~~~~~~~~a~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  477 (629)
T PRK11634        398 SDLDQYRALLAKIQPTAEGEELDLETLAAALLKMAQGERPLILPPDAPMRPKREFRDRDDRGPRDRNDRGPRGDREDRPR  477 (629)
T ss_pred             hhHHHHHHHHHHHHhhhccccCCHHHHHHHHHHHHcCCCccccccccccccccccccccccccccccccccccccccccc
Confidence            4577788888888864     6789999999998632111      0     0   000                 0  0


Q ss_pred             c---CCCCeEEEEEeecCccccCCCChhHHHHHHhhhCCCCcCccccEEEeecCccceeEeecCHHHHHHHHhhcCC
Q 011149          281 N---HEQGWVTLQLTRDSAFSRGFMSARSVMGFLSDVYPTAADEIGKIHIIADDRVQGAVFDLPEEIAKELLNKQIP  354 (492)
Q Consensus       281 ~---~~~~~~~~~~~~~~~~~~~~~~~~~i~~~i~~~~~~~~~~ig~i~~~~~~~~~gs~fdv~~~~a~~~i~~~~~  354 (492)
                      .   ...+|++++++.++   ++++.|++|+++|++..++...+||+|+|++++    ||||||++.++++++.+..
T Consensus       478 ~~~~~~~~~~~~~~~~g~---~~~~~~~~~~~~i~~~~~~~~~~ig~i~i~~~~----s~v~~~~~~~~~~~~~~~~  547 (629)
T PRK11634        478 RERRDVGDMQLYRIEVGR---DDGVEVRHIVGAIANEGDISSRYIGNIKLFASH----STIELPKGMPGEVLQHFTR  547 (629)
T ss_pred             cccccCCCCEEEEEeccc---ccCCCHHHHHHHHHhhcCCChhhCCcEEEeCCc----eEEEcChhhHHHHHHHhcc
Confidence            0   12268999999998   899999999999999999999999999999998    8999999999999997654



>KOG0331 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0328 consensus Predicted ATP-dependent RNA helicase FAL1, involved in rRNA maturation, DEAD-box superfamily [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0342 consensus ATP-dependent RNA helicase pitchoune [RNA processing and modification] Back     alignment and domain information
>KOG0330 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0333 consensus U5 snRNP-like RNA helicase subunit [RNA processing and modification] Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>KOG0343 consensus RNA Helicase [RNA processing and modification] Back     alignment and domain information
>KOG0345 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0336 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0326 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0340 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0338 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0341 consensus DEAD-box protein abstrakt [RNA processing and modification] Back     alignment and domain information
>KOG0327 consensus Translation initiation factor 4F, helicase subunit (eIF-4A) and related helicases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>KOG0335 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0332 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>KOG0346 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0339 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0348 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>KOG0334 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0347 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>KOG0337 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG4284 consensus DEAD box protein [Transcription] Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>KOG0344 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>KOG0350 consensus DEAD-box ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>KOG0329 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>KOG0349 consensus Putative DEAD-box RNA helicase DDX1 [RNA processing and modification] Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>KOG0351 consensus ATP-dependent DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins Back     alignment and domain information
>KOG0922 consensus DEAH-box RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0352 consensus ATP-dependent DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>KOG0923 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0354 consensus DEAD-box like helicase [General function prediction only] Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0353 consensus ATP-dependent DNA helicase [General function prediction only] Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0924 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>smart00490 HELICc helicase superfamily c-terminal domain Back     alignment and domain information
>KOG0920 consensus ATP-dependent RNA helicase A [RNA processing and modification] Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>KOG0950 consensus DNA polymerase theta/eta, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>KOG0925 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>KOG0947 consensus Cytoplasmic exosomal RNA helicase SKI2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG4150 consensus Predicted ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0926 consensus DEAH-box RNA helicase [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0331 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>KOG0948 consensus Nuclear exosomal RNA helicase MTR4, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0921 consensus Dosage compensation complex, subunit MLE [Transcription] Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>PF08152 GUCT: GUCT (NUC152) domain; InterPro: IPR012562 This is the C-terminal domain found in the RNA helicase II / Gu protein family [] Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0339 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0341 consensus DEAD-box protein abstrakt [RNA processing and modification] Back     alignment and domain information
>KOG0953 consensus Mitochondrial RNA helicase SUV3, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PRK12903 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0336 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK12326 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PF00098 zf-CCHC: Zinc knuckle; InterPro: IPR001878 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG0330 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0338 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ] Back     alignment and domain information
>KOG0335 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0385 consensus Chromatin remodeling complex WSTF-ISWI, small subunit [Transcription] Back     alignment and domain information
>PRK12901 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK13103 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>PF03880 DbpA: DbpA RNA binding domain ; InterPro: IPR005580 This RNA binding domain is found at the C terminus of a number of DEAD helicase proteins [] Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>KOG0384 consensus Chromodomain-helicase DNA-binding protein [Transcription] Back     alignment and domain information
>KOG0390 consensus DNA repair protein, SNF2 family [Replication, recombination and repair] Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>CHL00122 secA preprotein translocase subunit SecA; Validated Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0333 consensus U5 snRNP-like RNA helicase subunit [RNA processing and modification] Back     alignment and domain information
>KOG0387 consensus Transcription-coupled repair protein CSB/RAD26 (contains SNF2 family DNA-dependent ATPase domain) [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0347 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0392 consensus SNF2 family DNA-dependent ATPase domain-containing protein [Transcription] Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>KOG0391 consensus SNF2 family DNA-dependent ATPase [General function prediction only] Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>PTZ00368 universal minicircle sequence binding protein (UMSBP); Provisional Back     alignment and domain information
>PTZ00368 universal minicircle sequence binding protein (UMSBP); Provisional Back     alignment and domain information
>KOG0949 consensus Predicted helicase, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>COG5082 AIR1 Arginine methyltransferase-interacting protein, contains RING Zn-finger [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK12902 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG1000 consensus Chromatin remodeling protein HARP/SMARCAL1, DEAD-box superfamily [Chromatin structure and dynamics] Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>KOG0345 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3 Back     alignment and domain information
>KOG0334 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG1123 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 3'-5' helicase subunit SSL2 [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>KOG0340 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PF13307 Helicase_C_2: Helicase C-terminal domain; PDB: 4A15_A 2VSF_A 3CRV_A 3CRW_1 2VL7_A Back     alignment and domain information
>KOG0389 consensus SNF2 family DNA-dependent ATPase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0388 consensus SNF2 family DNA-dependent ATPase [Replication, recombination and repair] Back     alignment and domain information
>KOG0386 consensus Chromatin remodeling complex SWI/SNF, component SWI2 and related ATPases (DNA/RNA helicase superfamily) [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>PF13696 zf-CCHC_2: Zinc knuckle Back     alignment and domain information
>KOG3973 consensus Uncharacterized conserved glycine-rich protein [Function unknown] Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG4400 consensus E3 ubiquitin ligase interacting with arginine methyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1015 consensus Transcription regulator XNP/ATRX, DEAD-box superfamily [Transcription] Back     alignment and domain information
>KOG0921 consensus Dosage compensation complex, subunit MLE [Transcription] Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>TIGR00596 rad1 DNA repair protein (rad1) Back     alignment and domain information
>KOG0328 consensus Predicted ATP-dependent RNA helicase FAL1, involved in rRNA maturation, DEAD-box superfamily [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG4284 consensus DEAD box protein [Transcription] Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion] Back     alignment and domain information
>PF13917 zf-CCHC_3: Zinc knuckle Back     alignment and domain information
>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0342 consensus ATP-dependent RNA helicase pitchoune [RNA processing and modification] Back     alignment and domain information
>COG4889 Predicted helicase [General function prediction only] Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>PF14787 zf-CCHC_5: GAG-polyprotein viral zinc-finger; PDB: 1CL4_A 1DSV_A Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>KOG0337 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>smart00343 ZnF_C2HC zinc finger Back     alignment and domain information
>PF13871 Helicase_C_4: Helicase_C-like Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>COG5082 AIR1 Arginine methyltransferase-interacting protein, contains RING Zn-finger [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>KOG0326 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0343 consensus RNA Helicase [RNA processing and modification] Back     alignment and domain information
>KOG0109 consensus RNA-binding protein LARK, contains RRM and retroviral-type Zn-finger domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>KOG4439 consensus RNA polymerase II transcription termination factor TTF2/lodestar, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0329 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein Back     alignment and domain information
>KOG0348 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>KOG0346 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>KOG4400 consensus E3 ubiquitin ligase interacting with arginine methyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0344 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG2340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0350 consensus DEAD-box ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PF00098 zf-CCHC: Zinc knuckle; InterPro: IPR001878 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG0332 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>smart00492 HELICc3 helicase superfamily c-terminal domain Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>smart00491 HELICc2 helicase superfamily c-terminal domain Back     alignment and domain information
>KOG0327 consensus Translation initiation factor 4F, helicase subunit (eIF-4A) and related helicases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0701 consensus dsRNA-specific nuclease Dicer and related ribonucleases [RNA processing and modification] Back     alignment and domain information
>KOG3973 consensus Uncharacterized conserved glycine-rich protein [Function unknown] Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1016 consensus Predicted DNA helicase, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>KOG0119 consensus Splicing factor 1/branch point binding protein (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>PF14392 zf-CCHC_4: Zinc knuckle Back     alignment and domain information
>PF15288 zf-CCHC_6: Zinc knuckle Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>KOG1513 consensus Nuclear helicase MOP-3/SNO (DEAD-box superfamily) [Transcription; Signal transduction mechanisms] Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>KOG0107 consensus Alternative splicing factor SRp20/9G8 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>PF12683 DUF3798: Protein of unknown function (DUF3798); InterPro: IPR024258 This entry represents functionally uncharacterised proteins that are found in bacteria Back     alignment and domain information
>PF10593 Z1: Z1 domain; InterPro: IPR018310 This entry represents the Z1 domain of unknown function that is found in a group of putative endonucleases Back     alignment and domain information
>KOG0107 consensus Alternative splicing factor SRp20/9G8 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query492
3i32_A300 Dimeric Structure Of A Hera Helicase Fragment Inclu 7e-38
3eaq_A212 Novel Dimerization Motif In The Dead Box Rna Helica 5e-34
2i4i_A417 Crystal Structure Of Human Dead-Box Rna Helicase Dd 3e-33
2hxy_A391 Crystal Structure Of Human Apo-Eif4aiii Length = 39 6e-32
2hyi_C413 Structure Of The Human Exon Junction Complex With A 7e-32
2j0u_B374 The Crystal Structure Of Eif4aiii-Barentsz Complex 1e-31
2j0q_A410 The Crystal Structure Of The Exon Junction Complex 1e-31
2xb2_A411 Crystal Structure Of The Core Mago-Y14-Eif4aiii-Bar 1e-31
2j0u_A374 The Crystal Structure Of Eif4aiii-Barentsz Complex 2e-31
1hv8_A367 Crystal Structure Of A Dead Box Protein From The Hy 9e-31
2db3_A434 Structural Basis For Rna Unwinding By The Dead-Box 1e-29
1s2m_A400 Crystal Structure Of The Dead Box Protein Dhh1p Len 3e-26
3pew_A395 S. Cerevisiae Dbp5 L327v Bound To Rna And Adp Bef3 8e-25
3pey_A395 S. Cerevisiae Dbp5 Bound To Rna And Adp Bef3 Length 2e-24
2vso_A395 Crystal Structure Of A Translation Initiation Compl 4e-24
3eiq_A414 Crystal Structure Of Pdcd4-eif4a Length = 414 9e-24
2jgn_A185 Ddx3 Helicase Domain Length = 185 9e-24
2zu6_A388 Crystal Structure Of The Eif4a-Pdcd4 Complex Length 1e-23
2z0m_A337 Crystal Structure Of Hypothetical Atp-Dependent Rna 3e-23
2hjv_A163 Structure Of The Second Domain (Residues 207-368) O 2e-22
1fuu_A394 Yeast Initiation Factor 4a Length = 394 1e-21
3fho_B508 Structure Of S. Pombe Dbp5 Length = 508 2e-21
1xti_A391 Structure Of Wildtype Human Uap56 Length = 391 2e-20
1xtj_A386 Structure Of Human Uap56 In Complex With Adp Length 3e-20
1xtk_A390 Structure Of Decd To Dead Mutation Of Human Uap56 L 3e-20
3fmp_B479 Crystal Structure Of The Nucleoporin Nup214 In Comp 7e-20
3fht_A412 Crystal Structure Of Human Dbp5 In Complex With Amp 8e-20
2kbf_A187 Solution Structure Of Carboxyl-Terminal Domain Of D 8e-20
3g0h_A424 Human Dead-box Rna Helicase Ddx19, In Complex With 9e-20
3ews_A445 Human Dead-Box Rna-Helicase Ddx19 In Complex With A 9e-20
3peu_A188 S. Cerevisiae Dbp5 L327v C-Terminal Domain Bound To 2e-19
3gfp_A189 Structure Of The C-Terminal Domain Of The Dead-Box 3e-19
3sqw_A579 Structure Of Mss116p (Nte Deletion) Bound To Ssrna 4e-18
3i5x_A563 Structure Of Mss116p Bound To Ssrna And Amp-Pnp Len 5e-18
3sqx_A512 Structure Of Mss116p (Nte And C-Tail Double Deletio 5e-18
2p6n_A191 Human Dead-box Rna Helicase Ddx41, Helicase Domain 2e-17
2wax_A193 Structure Of The Human Ddx6 C-Terminal Domain In Co 4e-16
2yjt_D170 Crystal Structure Of E. Coli Dead-Box Protein Srmb 1e-15
2rb4_A175 Crystal Structure Of The Helicase Domain Of Human D 3e-15
4db4_A256 Mss116p Dead-Box Helicase Domain 2 Bound To A Chima 4e-15
4db2_C257 Mss116p Dead-Box Helicase Domain 2 Bound To An Rna 4e-15
4db2_A257 Mss116p Dead-Box Helicase Domain 2 Bound To An Rna 4e-15
1fuk_A165 Crystal Structure Of The Carboxy Terminal Domain Of 7e-13
2gxq_A207 Hera N-Terminal Domain In Complex With Amp, Crystal 2e-12
3mwj_A207 Q28e Mutant Of Hera N-Terminal Reca-Like Domain, Ap 2e-12
1t5i_A172 Crystal Structure Of The C-Terminal Domain Of Uap56 9e-12
1wp9_A494 Crystal Structure Of Pyrococcus Furiosus Hef Helica 5e-09
2v1x_A591 Crystal Structure Of Human Recq-Like Dna Helicase L 2e-08
1oyy_A523 Structure Of The Recq Catalytic Core Bound To Atp-G 3e-08
1oyw_A523 Structure Of The Recq Catalytic Core Length = 523 6e-08
1gm5_A780 Structure Of Recg Bound To Three-Way Dna Junction L 1e-06
4gl2_A699 Structural Basis For Dsrna Duplex Backbone Recognit 3e-06
2eyq_A1151 Crystal Structure Of Escherichia Coli Transcription 5e-06
2fwr_A472 Structure Of Archaeoglobus Fulgidis Xpb Length = 47 1e-05
2pl3_A236 Human Dead-Box Rna Helicase Ddx10, Dead Domain In C 1e-05
2fzl_A219 Structure Of C-Terminal Domain Of Archaeoglobus Ful 2e-05
1qva_A223 Yeast Initiation Factor 4a N-Terminal Domain Length 4e-05
1qde_A224 Crystal Structure Of The Atpase Domain Of Translati 4e-05
3v4r_A667 Crystal Structure Of A Uvrb Dimer-Dna Complex Lengt 9e-05
2d7d_A661 Structural Insights Into The Cryptic Dna Dependent 9e-05
1d9x_A658 Crystal Structure Of The Dna Repair Protein Uvrb Le 1e-04
2fdc_A658 Structural Basis Of Dna Damage Recognition And Proc 1e-04
1d9z_A657 Crystal Structure Of The Dna Repair Protein Uvrb In 1e-04
1t5l_A658 Crystal Structure Of The Dna Repair Protein Uvrb Po 1e-04
4i1s_A243 Melanoma Differentiation Associated Protein-5 Helic 1e-04
3uwx_B683 Crystal Structure Of Uvra-Uvrb Complex Length = 683 1e-04
1d2m_A665 Uvrb Protein Of Thermus Thermophilus Hb8; A Nucleot 3e-04
1c4o_A664 Crystal Structure Of The Dna Nucleotide Excision Re 3e-04
3ber_A249 Human Dead-Box Rna-Helicase Ddx47, Conserved Domain 3e-04
4a4d_A253 Crystal Structure Of The N-Terminal Domain Of The H 4e-04
3fe2_A242 Human Dead-Box Rna Helicase Ddx5 (P68), Conserved D 4e-04
3ly5_A262 Ddx18 Dead-Domain Length = 262 5e-04
2p6r_A702 Crystal Structure Of Superfamily 2 Helicase Hel308 6e-04
>pdb|3I32|A Chain A, Dimeric Structure Of A Hera Helicase Fragment Including The C-Terminal Reca Domain, The Dimerization Domain, And The Rna Binding Domain Length = 300 Back     alignment and structure

Iteration: 1

Score = 155 bits (391), Expect = 7e-38, Method: Compositional matrix adjust. Identities = 114/289 (39%), Positives = 168/289 (58%), Gaps = 17/289 (5%) Query: 66 AISTTATSKRTILSDLITVYAKGGKTIVFTQTKRDADEVSLALTSI-IASEALHGDISQH 124 A+ + +LSDL+ V A + +VFT+TK + +E++ L + ++ALHGD+SQ Sbjct: 7 AVPAPVRGRLEVLSDLLYV-ASPDRAMVFTRTKAETEEIAQGLLRLGHPAQALHGDMSQG 65 Query: 125 QRERTLNGFRQGKFTVLVATDVAARGLDIPNVDLIIHYELPNDPETFVHRSGRTGRAGKE 184 +RER + FRQG+ VLVATDVAARGLDIP VDL++HY +P+ E + HRSGRTGRAG+ Sbjct: 66 ERERVMGAFRQGEVRVLVATDVAARGLDIPQVDLVVHYRMPDRAEAYQHRSGRTGRAGRG 125 Query: 185 GTAILMFTSSQRRTVRSLERDVGCKFEFVSPPVVEDVLESSAEQVVATLNGVHPESVEFF 244 G +L++ +RR V +LER VG +F+ V+PP E+VLE+ ++A L V + + Sbjct: 126 GRVVLLYGPRERRDVEALERAVGRRFKRVNPPTPEEVLEAKWRHLLARLARVPEKDYRLY 185 Query: 245 TPTAQRLIEEKGTDALAAALAQLSGFSRPPSSRSLINHEQGWVT-------LQLTRDSAF 297 A RL E + +AA LA L G + + RSL+ E+GW T L L R A Sbjct: 186 QDFAGRLFAEGRVEVVAALLALLLGGAP--AERSLLTGEEGWRTYKATGPRLSLPRLVAL 243 Query: 298 SRG-----FMSARSVMGFLSDVYPTAADEIGKIHIIADDRVQGAVFDLP 341 +G A + GF D+ P A E+ + + RV+G + ++P Sbjct: 244 LKGQGLEVGKVAEAEGGFYVDLRPEARPEVAGLRLEPARRVEG-LLEIP 291
>pdb|3EAQ|A Chain A, Novel Dimerization Motif In The Dead Box Rna Helicase Hera Form 2, Complete Dimer, Symmetric Length = 212 Back     alignment and structure
>pdb|2I4I|A Chain A, Crystal Structure Of Human Dead-Box Rna Helicase Ddx3x Length = 417 Back     alignment and structure
>pdb|2HXY|A Chain A, Crystal Structure Of Human Apo-Eif4aiii Length = 391 Back     alignment and structure
>pdb|2HYI|C Chain C, Structure Of The Human Exon Junction Complex With A Trapped Dead-Box Helicase Bound To Rna Length = 413 Back     alignment and structure
>pdb|2J0U|B Chain B, The Crystal Structure Of Eif4aiii-Barentsz Complex At 3.0 A Resolution Length = 374 Back     alignment and structure
>pdb|2J0Q|A Chain A, The Crystal Structure Of The Exon Junction Complex At 3.2 A Resolution Length = 410 Back     alignment and structure
>pdb|2XB2|A Chain A, Crystal Structure Of The Core Mago-Y14-Eif4aiii-Barentsz- Upf3b Assembly Shows How The Ejc Is Bridged To The Nmd Machinery Length = 411 Back     alignment and structure
>pdb|2J0U|A Chain A, The Crystal Structure Of Eif4aiii-Barentsz Complex At 3.0 A Resolution Length = 374 Back     alignment and structure
>pdb|1HV8|A Chain A, Crystal Structure Of A Dead Box Protein From The Hyperthermophile Methanococcus Jannaschii Length = 367 Back     alignment and structure
>pdb|2DB3|A Chain A, Structural Basis For Rna Unwinding By The Dead-Box Protein Drosophila Vasa Length = 434 Back     alignment and structure
>pdb|1S2M|A Chain A, Crystal Structure Of The Dead Box Protein Dhh1p Length = 400 Back     alignment and structure
>pdb|3PEW|A Chain A, S. Cerevisiae Dbp5 L327v Bound To Rna And Adp Bef3 Length = 395 Back     alignment and structure
>pdb|3PEY|A Chain A, S. Cerevisiae Dbp5 Bound To Rna And Adp Bef3 Length = 395 Back     alignment and structure
>pdb|2VSO|A Chain A, Crystal Structure Of A Translation Initiation Complex Length = 395 Back     alignment and structure
>pdb|3EIQ|A Chain A, Crystal Structure Of Pdcd4-eif4a Length = 414 Back     alignment and structure
>pdb|2JGN|A Chain A, Ddx3 Helicase Domain Length = 185 Back     alignment and structure
>pdb|2ZU6|A Chain A, Crystal Structure Of The Eif4a-Pdcd4 Complex Length = 388 Back     alignment and structure
>pdb|2Z0M|A Chain A, Crystal Structure Of Hypothetical Atp-Dependent Rna Helicase From Sulfolobus Tokodaii Length = 337 Back     alignment and structure
>pdb|2HJV|A Chain A, Structure Of The Second Domain (Residues 207-368) Of The Bacillus Subtilis Yxin Protein Length = 163 Back     alignment and structure
>pdb|1FUU|A Chain A, Yeast Initiation Factor 4a Length = 394 Back     alignment and structure
>pdb|1XTI|A Chain A, Structure Of Wildtype Human Uap56 Length = 391 Back     alignment and structure
>pdb|1XTJ|A Chain A, Structure Of Human Uap56 In Complex With Adp Length = 386 Back     alignment and structure
>pdb|1XTK|A Chain A, Structure Of Decd To Dead Mutation Of Human Uap56 Length = 390 Back     alignment and structure
>pdb|3FMP|B Chain B, Crystal Structure Of The Nucleoporin Nup214 In Complex With The Dead- Box Helicase Ddx19 Length = 479 Back     alignment and structure
>pdb|3FHT|A Chain A, Crystal Structure Of Human Dbp5 In Complex With Amppnp And Rna Length = 412 Back     alignment and structure
>pdb|2KBF|A Chain A, Solution Structure Of Carboxyl-Terminal Domain Of Dbp5p Length = 187 Back     alignment and structure
>pdb|3G0H|A Chain A, Human Dead-box Rna Helicase Ddx19, In Complex With An Atp-analogue And Rna Length = 424 Back     alignment and structure
>pdb|3EWS|A Chain A, Human Dead-Box Rna-Helicase Ddx19 In Complex With Adp Length = 445 Back     alignment and structure
>pdb|3PEU|A Chain A, S. Cerevisiae Dbp5 L327v C-Terminal Domain Bound To Gle1 H337r And Ip6 Length = 188 Back     alignment and structure
>pdb|3GFP|A Chain A, Structure Of The C-Terminal Domain Of The Dead-Box Protein Dbp5 Length = 189 Back     alignment and structure
>pdb|3SQW|A Chain A, Structure Of Mss116p (Nte Deletion) Bound To Ssrna And Amp-Pnp Length = 579 Back     alignment and structure
>pdb|3I5X|A Chain A, Structure Of Mss116p Bound To Ssrna And Amp-Pnp Length = 563 Back     alignment and structure
>pdb|3SQX|A Chain A, Structure Of Mss116p (Nte And C-Tail Double Deletion) Bound To Ssrna And Amp-Pnp Length = 512 Back     alignment and structure
>pdb|2P6N|A Chain A, Human Dead-box Rna Helicase Ddx41, Helicase Domain Length = 191 Back     alignment and structure
>pdb|2WAX|A Chain A, Structure Of The Human Ddx6 C-Terminal Domain In Complex With An Edc3-Fdf Peptide Length = 193 Back     alignment and structure
>pdb|2YJT|D Chain D, Crystal Structure Of E. Coli Dead-Box Protein Srmb Bound To Regulator Of Ribonuclease Activity A (Rraa) Length = 170 Back     alignment and structure
>pdb|2RB4|A Chain A, Crystal Structure Of The Helicase Domain Of Human Ddx25 Rna Helicase Length = 175 Back     alignment and structure
>pdb|4DB4|A Chain A, Mss116p Dead-Box Helicase Domain 2 Bound To A Chimaeric Rna-Dna Duplex Length = 256 Back     alignment and structure
>pdb|4DB2|C Chain C, Mss116p Dead-Box Helicase Domain 2 Bound To An Rna Duplex Length = 257 Back     alignment and structure
>pdb|4DB2|A Chain A, Mss116p Dead-Box Helicase Domain 2 Bound To An Rna Duplex Length = 257 Back     alignment and structure
>pdb|1FUK|A Chain A, Crystal Structure Of The Carboxy Terminal Domain Of Yeast Eif4a Length = 165 Back     alignment and structure
>pdb|2GXQ|A Chain A, Hera N-Terminal Domain In Complex With Amp, Crystal Form 1 Length = 207 Back     alignment and structure
>pdb|3MWJ|A Chain A, Q28e Mutant Of Hera N-Terminal Reca-Like Domain, Apo Form Length = 207 Back     alignment and structure
>pdb|1T5I|A Chain A, Crystal Structure Of The C-Terminal Domain Of Uap56 Length = 172 Back     alignment and structure
>pdb|1WP9|A Chain A, Crystal Structure Of Pyrococcus Furiosus Hef Helicase Domain Length = 494 Back     alignment and structure
>pdb|2V1X|A Chain A, Crystal Structure Of Human Recq-Like Dna Helicase Length = 591 Back     alignment and structure
>pdb|1OYY|A Chain A, Structure Of The Recq Catalytic Core Bound To Atp-Gamma-S Length = 523 Back     alignment and structure
>pdb|1OYW|A Chain A, Structure Of The Recq Catalytic Core Length = 523 Back     alignment and structure
>pdb|1GM5|A Chain A, Structure Of Recg Bound To Three-Way Dna Junction Length = 780 Back     alignment and structure
>pdb|4GL2|A Chain A, Structural Basis For Dsrna Duplex Backbone Recognition By Mda5 Length = 699 Back     alignment and structure
>pdb|2EYQ|A Chain A, Crystal Structure Of Escherichia Coli Transcription-Repair Coupling Factor Length = 1151 Back     alignment and structure
>pdb|2FWR|A Chain A, Structure Of Archaeoglobus Fulgidis Xpb Length = 472 Back     alignment and structure
>pdb|2PL3|A Chain A, Human Dead-Box Rna Helicase Ddx10, Dead Domain In Complex With Adp Length = 236 Back     alignment and structure
>pdb|2FZL|A Chain A, Structure Of C-Terminal Domain Of Archaeoglobus Fulgidus Xpb Length = 219 Back     alignment and structure
>pdb|1QVA|A Chain A, Yeast Initiation Factor 4a N-Terminal Domain Length = 223 Back     alignment and structure
>pdb|1QDE|A Chain A, Crystal Structure Of The Atpase Domain Of Translation Initiation Factor 4a From Saccharomyces Cerevisiae-The Prototype Of The Dead Box Protein Family Length = 224 Back     alignment and structure
>pdb|3V4R|A Chain A, Crystal Structure Of A Uvrb Dimer-Dna Complex Length = 667 Back     alignment and structure
>pdb|2D7D|A Chain A, Structural Insights Into The Cryptic Dna Dependent Atp-Ase Activity Of Uvrb Length = 661 Back     alignment and structure
>pdb|1D9X|A Chain A, Crystal Structure Of The Dna Repair Protein Uvrb Length = 658 Back     alignment and structure
>pdb|2FDC|A Chain A, Structural Basis Of Dna Damage Recognition And Processing By Uvrb: Crystal Structure Of A UvrbDNA COMPLEX Length = 658 Back     alignment and structure
>pdb|1D9Z|A Chain A, Crystal Structure Of The Dna Repair Protein Uvrb In Complex With Atp Length = 657 Back     alignment and structure
>pdb|1T5L|A Chain A, Crystal Structure Of The Dna Repair Protein Uvrb Point Mutant Y96a Revealing A Novel Fold For Domain 2 Length = 658 Back     alignment and structure
>pdb|4I1S|A Chain A, Melanoma Differentiation Associated Protein-5 Helicase Domain Complex With Inhibitor Non-structural Protein V Length = 243 Back     alignment and structure
>pdb|3UWX|B Chain B, Crystal Structure Of Uvra-Uvrb Complex Length = 683 Back     alignment and structure
>pdb|1D2M|A Chain A, Uvrb Protein Of Thermus Thermophilus Hb8; A Nucleotide Excision Repair Enzyme Length = 665 Back     alignment and structure
>pdb|1C4O|A Chain A, Crystal Structure Of The Dna Nucleotide Excision Repair Enzyme Uvrb From Thermus Thermophilus Length = 664 Back     alignment and structure
>pdb|3BER|A Chain A, Human Dead-Box Rna-Helicase Ddx47, Conserved Domain I In Complex With Amp Length = 249 Back     alignment and structure
>pdb|4A4D|A Chain A, Crystal Structure Of The N-Terminal Domain Of The Human Dead-Box Rna Helicase Ddx5 (P68) Length = 253 Back     alignment and structure
>pdb|3FE2|A Chain A, Human Dead-Box Rna Helicase Ddx5 (P68), Conserved Domain I In Complex With Adp Length = 242 Back     alignment and structure
>pdb|3LY5|A Chain A, Ddx18 Dead-Domain Length = 262 Back     alignment and structure
>pdb|2P6R|A Chain A, Crystal Structure Of Superfamily 2 Helicase Hel308 In Complex With Unwound Dna Length = 702 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query492
3i32_A300 Heat resistant RNA dependent ATPase; RNA helicase, 100.0
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 100.0
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 100.0
3sqw_A579 ATP-dependent RNA helicase MSS116, mitochondrial; 99.97
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 99.97
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 99.97
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 99.97
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 99.97
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 99.97
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 99.97
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 99.97
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 99.96
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 99.96
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 99.96
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 99.96
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 99.96
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 99.96
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 99.96
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 99.95
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 99.95
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 99.95
2v1x_A591 ATP-dependent DNA helicase Q1; DNA strand annealin 99.95
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 99.94
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 99.94
1oyw_A523 RECQ helicase, ATP-dependent DNA helicase; winged 99.94
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 99.89
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 99.93
1tf5_A844 Preprotein translocase SECA subunit; ATPase, helic 99.92
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 99.9
2xau_A773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 99.9
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 99.89
2whx_A618 Serine protease/ntpase/helicase NS3; transcription 99.89
3o8b_A666 HCV NS3 protease/helicase; ntpase, RNA, translocat 99.88
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 99.88
2p6r_A702 Afuhel308 helicase; protein-DNA complex, SF2 helic 99.88
2fsf_A853 Preprotein translocase SECA subunit; ATPase, DNA-R 99.88
1yks_A440 Genome polyprotein [contains: flavivirin protease 99.87
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 99.87
2zj8_A720 DNA helicase, putative SKI2-type helicase; RECA fo 99.87
2d7d_A661 Uvrabc system protein B; helicase, protein-DNA-ADP 99.87
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 99.87
2ykg_A696 Probable ATP-dependent RNA helicase DDX58; hydrola 99.87
1nkt_A922 Preprotein translocase SECA 1 subunit; preprotein 99.87
2va8_A715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 99.87
2wv9_A673 Flavivirin protease NS2B regulatory subunit, FLAV 99.86
1c4o_A664 DNA nucleotide excision repair enzyme UVRB; uvrabc 99.86
3jux_A822 Protein translocase subunit SECA; protein transloc 99.85
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 99.85
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 99.85
2z83_A459 Helicase/nucleoside triphosphatase; hydrolase, mem 99.84
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 99.84
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 99.84
2eyq_A1151 TRCF, transcription-repair coupling factor; MFD, S 99.84
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 99.83
3dmq_A968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 99.83
3rc3_A677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 99.83
4gl2_A699 Interferon-induced helicase C domain-containing P; 99.82
4a2w_A936 RIG-I, retinoic acid inducible protein I; hydrolas 99.81
1gm5_A780 RECG; helicase, replication restart; HET: DNA ADP; 99.81
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 99.81
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 99.8
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 99.77
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 99.76
1z5z_A271 Helicase of the SNF2/RAD54 family; hydrolase, reco 99.76
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 99.76
3h1t_A590 Type I site-specific restriction-modification syst 99.73
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 99.62
1z3i_X644 Similar to RAD54-like; recombination ATPase helica 99.59
3mwy_W800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 99.54
2w00_A1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 99.47
2a51_A39 Nucleocapsid protein; sivlhoest, structure, NCP8, 98.98
1cl4_A60 Protein (GAG polyprotein); nucleocapsid protein, R 98.92
2bl6_A37 Nucleocapsid protein P11; lentivirus, polyprotein, 98.91
2ec7_A49 GAG polyprotein (PR55GAG); nucleocapsid protein, H 98.84
2cqf_A63 RNA-binding protein LIN-28; CCHC zinc-finger, stru 98.79
2e29_A92 ATP-dependent RNA helicase DDX50; ATP binding, hyd 98.76
1a1t_A55 Nucleocapsid protein; stem-loop RNA, viral protein 98.74
2ihx_A61 Nucleocapsid (NC) protein; protein-RNA complex, vi 98.73
1dsq_A26 Nucleic acid binding protein P14; CCHC type zinc f 98.73
2li8_A74 Protein LIN-28 homolog A; zinc finger, micro RNA, 98.71
3nyb_B83 Protein AIR2; polya RNA polymerase, zinc knuckle p 98.69
1a6b_B40 Momulv, zinc finger protein NCP10; nucleocapsid pr 98.68
2lli_A124 Protein AIR2; RNA surveillance, RNA degradation, R 98.63
3ts2_A148 Protein LIN-28 homolog A; microrna biogenesis, pro 98.58
2ipc_A997 Preprotein translocase SECA subunit; nucleotide bi 98.51
1u6p_A56 GAG polyprotein; MLV, A-minor K-turn, stem loop, b 98.47
2vl7_A540 XPD; helicase, unknown function; 2.25A {Sulfolobus 98.45
1nc8_A29 Nucleocapsid protein; HIV-2, RNA recognition, zinc 98.29
2g0c_A76 ATP-dependent RNA helicase DBPA; RNA recognition m 98.2
2lli_A124 Protein AIR2; RNA surveillance, RNA degradation, R 98.16
2li8_A74 Protein LIN-28 homolog A; zinc finger, micro RNA, 98.11
2ysa_A55 Retinoblastoma-binding protein 6; zinc finger, CCH 98.1
4a15_A620 XPD helicase, ATP-dependent DNA helicase TA0057; h 97.89
2a51_A39 Nucleocapsid protein; sivlhoest, structure, NCP8, 97.74
2bl6_A37 Nucleocapsid protein P11; lentivirus, polyprotein, 97.71
2cqf_A63 RNA-binding protein LIN-28; CCHC zinc-finger, stru 97.61
2ec7_A49 GAG polyprotein (PR55GAG); nucleocapsid protein, H 97.61
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 97.59
2ihx_A61 Nucleocapsid (NC) protein; protein-RNA complex, vi 97.57
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 97.53
1a1t_A55 Nucleocapsid protein; stem-loop RNA, viral protein 97.4
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 97.35
3hgt_A328 HDA1 complex subunit 3; RECA-like domain, SWI2/SNF 97.25
3ts2_A148 Protein LIN-28 homolog A; microrna biogenesis, pro 97.24
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 97.24
3i31_A88 Heat resistant RNA dependent ATPase; RNA helicase, 97.08
3crv_A551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 97.05
2v1x_A591 ATP-dependent DNA helicase Q1; DNA strand annealin 96.74
3sqw_A579 ATP-dependent RNA helicase MSS116, mitochondrial; 96.69
1oyw_A523 RECQ helicase, ATP-dependent DNA helicase; winged 96.65
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 96.46
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 96.4
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 96.3
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 96.22
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 96.19
1gm5_A780 RECG; helicase, replication restart; HET: DNA ADP; 96.15
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 96.13
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 95.94
1dsq_A26 Nucleic acid binding protein P14; CCHC type zinc f 95.9
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 95.89
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 95.72
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 95.46
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 95.15
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 94.9
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 94.88
1a6b_B40 Momulv, zinc finger protein NCP10; nucleocapsid pr 94.85
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 94.23
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 94.18
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 94.17
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 94.12
2eyq_A1151 TRCF, transcription-repair coupling factor; MFD, S 93.85
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 93.79
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 93.23
3nyb_B83 Protein AIR2; polya RNA polymerase, zinc knuckle p 93.17
1u6p_A56 GAG polyprotein; MLV, A-minor K-turn, stem loop, b 93.1
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 92.95
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 92.86
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 92.61
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 92.51
3bor_A237 Human initiation factor 4A-II; translation initiat 92.26
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 91.84
1nc8_A29 Nucleocapsid protein; HIV-2, RNA recognition, zinc 91.67
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 91.44
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 91.23
2ysa_A55 Retinoblastoma-binding protein 6; zinc finger, CCH 89.87
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 89.28
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 89.32
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 88.94
2hqh_E26 Restin; beta/BETA structure, zinc finger motif, st 88.58
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 87.02
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 86.56
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 86.51
1cl4_A60 Protein (GAG polyprotein); nucleocapsid protein, R 85.81
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 84.76
2pk2_A358 Cyclin-T1, protein TAT; TAR, twinning, transcripti 80.49
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
Probab=100.00  E-value=3.5e-43  Score=345.59  Aligned_cols=289  Identities=38%  Similarity=0.588  Sum_probs=250.5

Q ss_pred             ceEEEEEEcCcccHHHHHHHHHHHHccCCeEEEEeCChHHHHHHHHHHHc-ccceeeecCCCCHHHHHHHHhhhcCCCeE
Q 011149           61 GIKLYAISTTATSKRTILSDLITVYAKGGKTIVFTQTKRDADEVSLALTS-IIASEALHGDISQHQRERTLNGFRQGKFT  139 (492)
Q Consensus        61 ~i~~~~~~~~~~~k~~~l~~ll~~~~~~~~~iVF~~t~~~~~~l~~~l~~-~~~~~~lhg~~~~~~r~~~~~~F~~g~~~  139 (492)
                      .++++++.++...|.++|.++++... ..++||||+|++.++.+++.|.. .+.+..+||+|++.+|+.+++.|++|+++
T Consensus         2 ~v~~~~i~~~~~~K~~~L~~ll~~~~-~~~~LVF~~t~~~~~~l~~~L~~~g~~~~~lhg~l~~~~r~~~~~~f~~g~~~   80 (300)
T 3i32_A            2 TYEEEAVPAPVRGRLEVLSDLLYVAS-PDRAMVFTRTKAETEEIAQGLLRLGHPAQALHGDMSQGERERVMGAFRQGEVR   80 (300)
T ss_dssp             CSEEEEEECCSSSHHHHHHHHHHHHC-CSSEEEECSSHHHHHHHHHHHHTTTCCEEEECSCCCTHHHHHHHHHHHHTSCC
T ss_pred             ceEEEEEECCHHHHHHHHHHHHHhcC-CCCEEEEECCHHHHHHHHHHHHhCCCCEEEEeCCCCHHHHHHHHHHhhcCCce
Confidence            46788999999999999999998774 78999999999999999999985 78999999999999999999999999999


Q ss_pred             EEEecccccccCCCCCcCEEEecCCCCChhHHHHHhhhcccCCCCCeEEEecChhhHHHHHHHHHHhCCCceecCCCCHH
Q 011149          140 VLVATDVAARGLDIPNVDLIIHYELPNDPETFVHRSGRTGRAGKEGTAILMFTSSQRRTVRSLERDVGCKFEFVSPPVVE  219 (492)
Q Consensus       140 iLVaT~~~~~Gidi~~v~~VI~~~~P~~~~~y~qr~GR~gR~g~~g~~i~l~~~~e~~~~~~l~~~~~~~~~~~~~p~~~  219 (492)
                      |||||+++++|||+|++++||+|++|++.+.|+||+||+||.|++|.|++|+++.+...++.+++.++.+++.+.+|+.+
T Consensus        81 vLVaT~va~~Gidi~~v~~VI~~d~p~s~~~y~Qr~GRagR~g~~G~~i~l~~~~e~~~~~~ie~~~~~~~~~~~~~~~~  160 (300)
T 3i32_A           81 VLVATDVAARGLDIPQVDLVVHYRMPDRAEAYQHRSGRTGRAGRGGRVVLLYGPRERRDVEALERAVGRRFKRVNPPTPE  160 (300)
T ss_dssp             EEEECSTTTCSTTCCCCSEEEESSCCSSTTHHHHHHTCCC-----CEEEEEECSSTHHHHHHHHHHHTCCCEECCCCCHH
T ss_pred             EEEEechhhcCccccceeEEEEcCCCCCHHHHHHHccCcCcCCCCceEEEEeChHHHHHHHHHHHHhCCcceEeCCCCHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHhccCCccchhhhHHHHHHHHhhhCHHHHHHHHHHHcCCCCCCCCcccccCCCCeEEEEEeecCcccc
Q 011149          220 DVLESSAEQVVATLNGVHPESVEFFTPTAQRLIEEKGTDALAAALAQLSGFSRPPSSRSLINHEQGWVTLQLTRDSAFSR  299 (492)
Q Consensus       220 ~~~~~~~~~~~~~l~~~~~~~~~~f~~~a~~l~~~~~~~~l~~al~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~  299 (492)
                      ++.+.....++..+..+..+.+..|.+.+++++++...+.+++||+++.+.+.  ..+++++...+|++++++.++.   
T Consensus       161 ei~~~~~~~~~~~l~~~~~~~~~~f~~~~~~l~~~~~~e~laaal~~l~~~~~--~~~~l~~~~~~~~~~~~~~g~~---  235 (300)
T 3i32_A          161 EVLEAKWRHLLARLARVPEKDYRLYQDFAGRLFAEGRVEVVAALLALLLGGAP--AERSLLTGEEGWRTYKATGPRL---  235 (300)
T ss_dssp             HHHHHHHHHHHHHHTTSCHHHHHTTHHHHHHHHHHTCHHHHHHHHHHHHTCCC--CCBCTTTCCBSCBCEEEECTTC---
T ss_pred             HHHHHHHHHHHHHHHhcchhhHHHHHHHHHHHHhcCcHHHHHHHHHHHhcCCc--CccccccCCCCcEEEEEecCCC---
Confidence            99999999999999888778889999999999999999999999999987765  6788888889999999999872   


Q ss_pred             CCCChhHHHHHHhhhCCCCcCccccEEEeecCccceeEeecCHHHHHHHHhhcCCCCCceeeeccCCCCCCCC
Q 011149          300 GFMSARSVMGFLSDVYPTAADEIGKIHIIADDRVQGAVFDLPEEIAKELLNKQIPPGNTISKITKLPALQDDG  372 (492)
Q Consensus       300 ~~~~~~~i~~~i~~~~~~~~~~ig~i~~~~~~~~~gs~fdv~~~~a~~~i~~~~~~~i~~~~~~~lp~~~~~~  372 (492)
                      ..  |++|+ .|... +.   +||+|.+.+++    +|||||++.++      ...++.+++++++|++++.+
T Consensus       236 ~~--~~~~~-~i~~~-~~---~ig~i~~~~~~----~~~dvp~~~~~------~~~~~~~~~~~~~p~~~~~~  291 (300)
T 3i32_A          236 SL--PRLVA-LLKGQ-GL---EVGKVAEAEGG----FYVDLRPEARP------EVAGLRLEPARRVEGLLEIP  291 (300)
T ss_dssp             CH--HHHHH-HHHHT-TC---CCCCEEEETTE----EEECBCSSCCC------CCTTCEEEEC----------
T ss_pred             CC--cHHHH-HHHhc-CC---eECcEEEeCCE----EEEEeCHHHcC------cCCCcEEEecccCCCCccCC
Confidence            22  99997 55553 33   89999997765    89999999887      23678999999999999875



>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>2a51_A Nucleocapsid protein; sivlhoest, structure, NCP8, viral protein, metal binding protein; NMR {Synthetic} Back     alignment and structure
>1cl4_A Protein (GAG polyprotein); nucleocapsid protein, RNA binding protein, retrovirus, viral protein; NMR {Mason-pfizer monkey virus} SCOP: g.40.1.1 PDB: 1dsv_A Back     alignment and structure
>2bl6_A Nucleocapsid protein P11; lentivirus, polyprotein, core protein, retrovirus zinc finger-like domains; NMR {Equine infectious anemia virus} Back     alignment and structure
>2ec7_A GAG polyprotein (PR55GAG); nucleocapsid protein, HIV-2, RNA recognition, zinc finger, viral protein; NMR {Human immunodeficiency virus type 2} SCOP: g.40.1.1 Back     alignment and structure
>2cqf_A RNA-binding protein LIN-28; CCHC zinc-finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2e29_A ATP-dependent RNA helicase DDX50; ATP binding, hydrolase, nuclear protein, nucleotide-binding, RNA-binding, GUCT domain, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.5 Back     alignment and structure
>1a1t_A Nucleocapsid protein; stem-loop RNA, viral protein/RNA complex; NMR {Human immunodeficiency virus 1} SCOP: g.40.1.1 PDB: 1mfs_A 1f6u_A* 1aaf_A 2l4l_A 2exf_A 2jzw_A* 1bj6_A* 1esk_A 1q3y_A 1q3z_A 2e1x_A 2iwj_A Back     alignment and structure
>2ihx_A Nucleocapsid (NC) protein; protein-RNA complex, viral protein/RNA complex; NMR {Rous sarcoma virus} Back     alignment and structure
>1dsq_A Nucleic acid binding protein P14; CCHC type zinc finger, virus/viral protein; NMR {Mouse mammary tumor virus} SCOP: g.40.1.1 Back     alignment and structure
>2li8_A Protein LIN-28 homolog A; zinc finger, micro RNA, transcription-RNA complex; NMR {Homo sapiens} Back     alignment and structure
>3nyb_B Protein AIR2; polya RNA polymerase, zinc knuckle protein, RNA surveillance binds to TRF4P/AIR2P heterodimer; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1a6b_B Momulv, zinc finger protein NCP10; nucleocapsid protein, intercalation, nucleic acid, retrovirus, viral protein/DNA complex; HET: DNA; NMR {Synthetic} SCOP: g.40.1.1 Back     alignment and structure
>2lli_A Protein AIR2; RNA surveillance, RNA degradation, RNA binding, exosome, RNA protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3ts2_A Protein LIN-28 homolog A; microrna biogenesis, protein-RNA complex, PRE-element, CCHC knuckle; HET: GMP; 2.01A {Mus musculus} PDB: 3trz_A* 3ts0_A* Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure
>1u6p_A GAG polyprotein; MLV, A-minor K-turn, stem loop, bulge, G-U mismatch, G-A MIS U mismatch, A-C mismatch, zinc finger, NC, viral protein-RN; HET: AP7; NMR {Moloney murine leukemia virus} SCOP: g.40.1.1 PDB: 1wwd_A 1wwe_A 1wwf_A 1wwg_A Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>1nc8_A Nucleocapsid protein; HIV-2, RNA recognition, zinc finger, viral protein; NMR {Human immunodeficiency virus 2} SCOP: g.40.1.1 PDB: 2di2_A Back     alignment and structure
>2g0c_A ATP-dependent RNA helicase DBPA; RNA recognition motif, hydrolase; 1.70A {Bacillus subtilis} PDB: 3moj_B Back     alignment and structure
>2lli_A Protein AIR2; RNA surveillance, RNA degradation, RNA binding, exosome, RNA protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2li8_A Protein LIN-28 homolog A; zinc finger, micro RNA, transcription-RNA complex; NMR {Homo sapiens} Back     alignment and structure
>2ysa_A Retinoblastoma-binding protein 6; zinc finger, CCHC, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>2a51_A Nucleocapsid protein; sivlhoest, structure, NCP8, viral protein, metal binding protein; NMR {Synthetic} Back     alignment and structure
>2bl6_A Nucleocapsid protein P11; lentivirus, polyprotein, core protein, retrovirus zinc finger-like domains; NMR {Equine infectious anemia virus} Back     alignment and structure
>2cqf_A RNA-binding protein LIN-28; CCHC zinc-finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ec7_A GAG polyprotein (PR55GAG); nucleocapsid protein, HIV-2, RNA recognition, zinc finger, viral protein; NMR {Human immunodeficiency virus type 2} SCOP: g.40.1.1 Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>2ihx_A Nucleocapsid (NC) protein; protein-RNA complex, viral protein/RNA complex; NMR {Rous sarcoma virus} Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>1a1t_A Nucleocapsid protein; stem-loop RNA, viral protein/RNA complex; NMR {Human immunodeficiency virus 1} SCOP: g.40.1.1 PDB: 1mfs_A 1f6u_A* 1aaf_A 2l4l_A 2exf_A 2jzw_A* 1bj6_A* 1esk_A 1q3y_A 1q3z_A 2e1x_A 2iwj_A Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>3hgt_A HDA1 complex subunit 3; RECA-like domain, SWI2/SNF2 helical domain, chromatin regulator, coiled coil, nucleus, repressor, transcription; 2.20A {Saccharomyces cerevisiae} PDB: 3hgq_A Back     alignment and structure
>3ts2_A Protein LIN-28 homolog A; microrna biogenesis, protein-RNA complex, PRE-element, CCHC knuckle; HET: GMP; 2.01A {Mus musculus} PDB: 3trz_A* 3ts0_A* Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>3i31_A Heat resistant RNA dependent ATPase; RNA helicase, RNA recognition motif, ATP-binding, helicase, nucleotide-binding; 1.80A {Thermus thermophilus} Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>1a6b_B Momulv, zinc finger protein NCP10; nucleocapsid protein, intercalation, nucleic acid, retrovirus, viral protein/DNA complex; HET: DNA; NMR {Synthetic} SCOP: g.40.1.1 Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>3nyb_B Protein AIR2; polya RNA polymerase, zinc knuckle protein, RNA surveillance binds to TRF4P/AIR2P heterodimer; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1u6p_A GAG polyprotein; MLV, A-minor K-turn, stem loop, bulge, G-U mismatch, G-A MIS U mismatch, A-C mismatch, zinc finger, NC, viral protein-RN; HET: AP7; NMR {Moloney murine leukemia virus} SCOP: g.40.1.1 PDB: 1wwd_A 1wwe_A 1wwf_A 1wwg_A Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>1nc8_A Nucleocapsid protein; HIV-2, RNA recognition, zinc finger, viral protein; NMR {Human immunodeficiency virus 2} SCOP: g.40.1.1 PDB: 2di2_A Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>2ysa_A Retinoblastoma-binding protein 6; zinc finger, CCHC, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>2hqh_E Restin; beta/BETA structure, zinc finger motif, structural protein, binding; 1.80A {Homo sapiens} Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1cl4_A Protein (GAG polyprotein); nucleocapsid protein, RNA binding protein, retrovirus, viral protein; NMR {Mason-pfizer monkey virus} SCOP: g.40.1.1 PDB: 1dsv_A Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2pk2_A Cyclin-T1, protein TAT; TAR, twinning, transcription regulation P- TEFB, cell cycle; 2.67A {Homo sapiens} SCOP: a.74.1.1 a.74.1.1 PDB: 2w2h_C Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 492
d1a1va2299 c.37.1.14 (A:326-624) HCV helicase domain {Human h 8e-34
d1gkub2248 c.37.1.16 (B:251-498) Helicase-like "domain" of re 6e-29
d1fuka_162 c.37.1.19 (A:) Initiation factor 4a {Baker's yeast 8e-26
d1wp9a2286 c.37.1.19 (A:201-486) putative ATP-dependent RNA h 1e-24
d2j0sa2168 c.37.1.19 (A:244-411) Probable ATP-dependent RNA h 3e-24
d1hv8a2155 c.37.1.19 (A:211-365) Putative DEAD box RNA helica 3e-24
d2fwra1200 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Ar 2e-22
d2rb4a1168 c.37.1.19 (A:307-474) ATP-dependent RNA helicase D 2e-19
d1jr6a_138 c.37.1.14 (A:) HCV helicase domain {Human hepatiti 1e-18
d2bmfa2305 c.37.1.14 (A:178-482) Dengue virus helicase {Dengu 2e-18
d1t5la2181 c.37.1.19 (A:415-595) Nucleotide excision repair e 2e-16
d1s2ma2171 c.37.1.19 (A:252-422) Putative ATP-dependent RNA h 3e-16
d2p6ra4201 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglob 5e-16
d2j0sa1222 c.37.1.19 (A:22-243) Probable ATP-dependent RNA he 1e-15
d1qdea_212 c.37.1.19 (A:) Initiation factor 4a {Baker's yeast 1e-15
d1c4oa2174 c.37.1.19 (A:410-583) Nucleotide excision repair e 2e-15
d2g9na1218 c.37.1.19 (A:21-238) Initiation factor 4a {Human ( 8e-15
d1oywa3200 c.37.1.19 (A:207-406) RecQ helicase domain {Escher 1e-14
d1q0ua_209 c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR 1e-14
d1veca_206 c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Huma 2e-14
d1t6na_207 c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP5 2e-14
d1s2ma1206 c.37.1.19 (A:46-251) Putative ATP-dependent RNA he 2e-14
d1hv8a1208 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase 3e-14
d1t5ia_168 c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP5 6e-14
d1wrba1238 c.37.1.19 (A:164-401) putative ATP-dependent RNA h 3e-12
d2eyqa5211 c.37.1.19 (A:779-989) Transcription-repair couplin 3e-12
d1gkub1237 c.37.1.16 (B:1-250) Helicase-like "domain" of reve 7e-08
d1gm5a4206 c.37.1.19 (A:550-755) RecG helicase domain {Thermo 8e-08
d1yksa2299 c.37.1.14 (A:325-623) YFV helicase domain {Yellow 5e-06
d2exfa142 g.40.1.1 (A:12-53) HIV nucleocapsid {Human immunod 1e-05
d2exfa142 g.40.1.1 (A:12-53) HIV nucleocapsid {Human immunod 0.002
d1oywa2206 c.37.1.19 (A:1-206) RecQ helicase domain {Escheric 8e-05
d2e29a185 d.58.7.5 (A:8-92) ATP-dependent RNA helicase DDX50 3e-04
d1wp9a1200 c.37.1.19 (A:1-200) putative ATP-dependent RNA hel 0.001
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 299 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RNA helicase
domain: HCV helicase domain
species: Human hepatitis C virus (HCV), different isolates [TaxId: 11103]
 Score =  127 bits (320), Expect = 8e-34
 Identities = 37/180 (20%), Positives = 62/180 (34%), Gaps = 21/180 (11%)

Query: 62  IKLYAISTTATSKRTILSDLITVYAKGGKTIVFTQTKRDADEVSLALTSI-IASEALHGD 120
           I+  A+STT          +     KGG+ ++F  +K+  DE++  L ++ I + A +  
Sbjct: 11  IEEVALSTTG-EIPFYGKAIPLEVIKGGRHLIFCHSKKKCDELAAKLVALGINAVAYYRG 69

Query: 121 ISQHQR----------ERTLNGFRQGKFTVLVATDVAARG---LDIPNVDLIIHYELPND 167
           +                  L     G F  ++  +          +     I    LP D
Sbjct: 70  LDVSVIPTSGDVVVVATDALMTGFTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTLPQD 129

Query: 168 PETFVHRSGRTGRAGKEGTAILMFTSSQRR-TVRSLE----RDVGCKFEFVSPPVVEDVL 222
             +   R GRTGR GK G    +    +      S       D GC +  ++P      L
Sbjct: 130 AVSRTQRRGRTGR-GKPGIYRFVAPGERPSGMFDSSVLCECYDAGCAWYELTPAETTVRL 188


>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 248 Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 162 Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 286 Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Length = 168 Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 155 Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 200 Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 138 Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Length = 181 Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 171 Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 201 Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Length = 222 Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 212 Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Length = 174 Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Length = 218 Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Length = 200 Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Length = 209 Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Length = 206 Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Length = 207 Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 206 Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 208 Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Length = 168 Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Length = 238 Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Length = 211 Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 237 Back     information, alignment and structure
>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Length = 206 Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Length = 299 Back     information, alignment and structure
>d2exfa1 g.40.1.1 (A:12-53) HIV nucleocapsid {Human immunodeficiency virus type 1, different isolates [TaxId: 11676]} Length = 42 Back     information, alignment and structure
>d2exfa1 g.40.1.1 (A:12-53) HIV nucleocapsid {Human immunodeficiency virus type 1, different isolates [TaxId: 11676]} Length = 42 Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Length = 206 Back     information, alignment and structure
>d2e29a1 d.58.7.5 (A:8-92) ATP-dependent RNA helicase DDX50 {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 200 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query492
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.98
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.98
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 99.97
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 99.97
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 99.97
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.96
d1oywa3200 RecQ helicase domain {Escherichia coli [TaxId: 562 99.96
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 99.93
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 99.93
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 99.89
d2p6ra4201 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.82
d1wp9a2286 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.82
d1gm5a4206 RecG helicase domain {Thermotoga maritima [TaxId: 99.8
d1gkub2248 Helicase-like "domain" of reverse gyrase {Archaeon 99.79
d1a1va2299 HCV helicase domain {Human hepatitis C virus (HCV) 99.76
d2fwra1200 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.75
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 99.72
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 99.57
d1z3ix1346 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 99.45
d1z5za1244 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 99.42
d1yksa2299 YFV helicase domain {Yellow fever virus [TaxId: 11 99.37
d1tf5a4175 Translocation ATPase SecA, nucleotide-binding doma 99.22
d2exfa142 HIV nucleocapsid {Human immunodeficiency virus typ 98.98
d1nkta4219 Translocation ATPase SecA, nucleotide-binding doma 98.54
d2e29a185 ATP-dependent RNA helicase DDX50 {Human (Homo sapi 98.41
d1nc8a_29 HIV nucleocapsid {Human immunodeficiency virus typ 98.2
d2exfa142 HIV nucleocapsid {Human immunodeficiency virus typ 97.74
d1dsqa_26 Nucleic acid binding protein p14 {Mouse mammary tu 97.7
d1a6bb_40 Zinc finger protein ncp10 {Moloney murine leukemia 97.6
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 97.38
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 96.89
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 96.11
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 95.5
d1dsva_31 Nucleic acid binding protein p14 {Mouse mammary tu 95.27
d1cl4a_32 Nucleocapsid protein from mason-pfizer monkey viru 95.22
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 95.2
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 93.91
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 92.79
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 92.59
d1nc8a_29 HIV nucleocapsid {Human immunodeficiency virus typ 92.11
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 92.01
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 91.93
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 89.97
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 84.52
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Probable ATP-dependent RNA helicase DDX48
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.98  E-value=4.2e-32  Score=242.14  Aligned_cols=159  Identities=35%  Similarity=0.583  Sum_probs=147.5

Q ss_pred             ccccceEEEEEEcCcc-cHHHHHHHHHHHHccCCeEEEEeCChHHHHHHHHHHHc-ccceeeecCCCCHHHHHHHHhhhc
Q 011149           57 KLAEGIKLYAISTTAT-SKRTILSDLITVYAKGGKTIVFTQTKRDADEVSLALTS-IIASEALHGDISQHQRERTLNGFR  134 (492)
Q Consensus        57 ~~~~~i~~~~~~~~~~-~k~~~l~~ll~~~~~~~~~iVF~~t~~~~~~l~~~l~~-~~~~~~lhg~~~~~~r~~~~~~F~  134 (492)
                      .+.++|+|+|+.++.. .|+..|..+++.+ ...++||||++++.|+.++..|.. .+.+..+||++++.+|.++++.|+
T Consensus         3 ~tl~~i~q~~v~v~~~~~K~~~L~~ll~~~-~~~k~iiF~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~r~~~~~~fk   81 (168)
T d2j0sa2           3 LTLEGIKQFFVAVEREEWKFDTLCDLYDTL-TITQAVIFCNTKRKVDWLTEKMREANFTVSSMHGDMPQKERESIMKEFR   81 (168)
T ss_dssp             CSCTTEEEEEEEESSTTHHHHHHHHHHHHH-TSSEEEEECSSHHHHHHHHHHHHHTTCCCEEECTTSCHHHHHHHHHHHH
T ss_pred             CCCCCcEEEEEEecChHHHHHHHHHHHHhC-CCCceEEEeeeHHHHHHHHHHhhhcccchhhhhhhhhHHHHHHHHHHHh
Confidence            4568899999988765 5999999999876 457999999999999999999985 789999999999999999999999


Q ss_pred             CCCeEEEEecccccccCCCCCcCEEEecCCCCChhHHHHHhhhcccCCCCCeEEEecChhhHHHHHHHHHHhCCCceecC
Q 011149          135 QGKFTVLVATDVAARGLDIPNVDLIIHYELPNDPETFVHRSGRTGRAGKEGTAILMFTSSQRRTVRSLERDVGCKFEFVS  214 (492)
Q Consensus       135 ~g~~~iLVaT~~~~~Gidi~~v~~VI~~~~P~~~~~y~qr~GR~gR~g~~g~~i~l~~~~e~~~~~~l~~~~~~~~~~~~  214 (492)
                      +|+.+||||||+++||||+|+|++|||||+|++++.|+||+||+||.|++|.+++|+.+.|...++.|++.++.++++++
T Consensus        82 ~g~~~iLv~Td~~~rGiDi~~v~~VIn~d~P~~~~~yihR~GR~gR~g~~G~~i~~~~~~d~~~~~~i~~~~~~~i~e~p  161 (168)
T d2j0sa2          82 SGASRVLISTDVWARGLDVPQVSLIINYDLPNNRELYIHRIGRSGRYGRKGVAINFVKNDDIRILRDIEQYYSTQIDEMP  161 (168)
T ss_dssp             HTSSCEEEECGGGSSSCCCTTEEEEEESSCCSSHHHHHHHHTTSSGGGCCEEEEEEEEGGGHHHHHHHHHHTTCCCEECC
T ss_pred             cCCccEEeccchhcccccccCcceEEEecCCcCHHHHHhhhccccccCCCcEEEEEECHHHHHHHHHHHHHHcCcCCCCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999998888765


Q ss_pred             CC
Q 011149          215 PP  216 (492)
Q Consensus       215 ~p  216 (492)
                      ..
T Consensus       162 ~~  163 (168)
T d2j0sa2         162 MN  163 (168)
T ss_dssp             SC
T ss_pred             cC
Confidence            43



>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2exfa1 g.40.1.1 (A:12-53) HIV nucleocapsid {Human immunodeficiency virus type 1, different isolates [TaxId: 11676]} Back     information, alignment and structure
>d1nkta4 c.37.1.19 (A:397-615) Translocation ATPase SecA, nucleotide-binding domains {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2e29a1 d.58.7.5 (A:8-92) ATP-dependent RNA helicase DDX50 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nc8a_ g.40.1.1 (A:) HIV nucleocapsid {Human immunodeficiency virus type 2 [TaxId: 11709]} Back     information, alignment and structure
>d2exfa1 g.40.1.1 (A:12-53) HIV nucleocapsid {Human immunodeficiency virus type 1, different isolates [TaxId: 11676]} Back     information, alignment and structure
>d1dsqa_ g.40.1.1 (A:) Nucleic acid binding protein p14 {Mouse mammary tumor virus [TaxId: 11757]} Back     information, alignment and structure
>d1a6bb_ g.40.1.1 (B:) Zinc finger protein ncp10 {Moloney murine leukemia virus, MoMLV [TaxId: 11801]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1dsva_ g.40.1.1 (A:) Nucleic acid binding protein p14 {Mouse mammary tumor virus [TaxId: 11757]} Back     information, alignment and structure
>d1cl4a_ g.40.1.1 (A:) Nucleocapsid protein from mason-pfizer monkey virus (MPMV) {Mason-pfizer monkey virus [TaxId: 11855]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nc8a_ g.40.1.1 (A:) HIV nucleocapsid {Human immunodeficiency virus type 2 [TaxId: 11709]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure