Citrus Sinensis ID: 011192


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-
MSSQDSVSTVYKCMMRGAADYLVKPVRRNELRNLWQHVWRRQSSMVSGNETQDESVGQQKIEATSENDAASNHSSGYMACIQSKGEFIEKGSDEQSSCTKPDFEAESAHVEDMPDLSRQLWGKSLQNDVKMQNHEARVNYGQKSLVPVTEAQGSEVAACKEANTRAHFDEDTELETHRSDVILTSEVCNVPVNSPRQVIDFMSAFNNHKPPSNNGASRFDSSPQLDLSLRRTHPDGFENQVERKFILRHSNASAFTRYTNKPSEPQHSSLSGVCNQQKEFETDSEKNFSNILTACNSYTPAATLSTQRSVNSLATGHSKQSELAVSYPQQRPCPVPVSVKVNSTNQAMHKLDHKLDSLEDLGHISPATDQSASSSFCNGAVSRLNSMGYGSACGSNSNLDQVTAGRAAAESKNEEGLFPSNGNLRSIQREAALNKFRLKRKDRCYDKKVRYESRKKLAEQRPRVKGQFVRQVHSETLPLESENHSGNISDG
ccccccHHHHHHHHHHcccHHHcccccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccHHHcccccccccccccccccHHHHHHcccccccccHHHHHHcccccccccccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHcccccccEEEccccccccccccccccccccc
ccccccHHHHHHHHHHcHHHHEccHHcHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccHHHcccccccccccccccccccccccccccEEEcEcccccccccccccccccccccccHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHcccccEEEHHHHHHHHHHccccccEEEEEEccccccccccccccccccc
MSSQDSVSTVYKCMMRGAADYLVKPVRRNELRNLWQHVWRRqssmvsgnetqdesvgqqkieatsendaasnhssgyMACIQSKGEfiekgsdeqssctkpdfeaesahvedmpdlSRQLWGKSLQNDVKMQNHEARVNYGQKSLVPVTEAQGSEVAACKeantrahfdedtelethrsdviltsevcnvpvnsprQVIDFMSAfnnhkppsnngasrfdsspqldlslrrthpdgfenQVERKFILRHsnasaftrytnkpsepqhsslsgvcnqqkefetdsekNFSNILTAcnsytpaatlstqrsvnslatghskqselavsypqqrpcpvpvsvkvnstnqamhkldhkldsledlghispatdqsasssfCNGAVSRLnsmgygsacgsnsnldqvTAGRAAaeskneeglfpsngnlRSIQREAALNKFRLkrkdrcydkKVRYESRKKLAeqrprvkgqfvrqvhsetlplesenhsgnisdg
MSSQDSVSTVYKCMMRGAADYLVKPVRRNELRNLWQHVWRrqssmvsgnetqdesVGQQKIEATsendaasnhSSGYMACIQSKGEFIEKGSDEQSSCTKPDFEAESAHVEDMPDLSRQLWGKSLQNDVKMQNHEARVNYGQKSLVPVTEAQGSEVAACKEAntrahfdedtelethrsdviltsevcnvpvNSPRQVIDFMSAFNNHKPPSNNGASRFDSSPQLDLSLRRTHPDGFENQVERKFILRHSNASAFTRYTNKPSEPQHSSLSGVCNQQKEFETDSEKNFSNILTACNSYTPAATLSTQRSVNSLATGHSKQSELAVSYPQQRPCPVPVSVKVNSTNQAMHKLDHKLDSLEDLGHISPATDQSASSSFCNGAVSRLNSMGYGSACGSNSNLDQVTAGRAAAEskneeglfpsngnlrsIQREAALnkfrlkrkdrcydkkvryesrkklaeqrprvkgqfvrqvhsetlplesenhsgnisdg
MSSQDSVSTVYKCMMRGAADYLVKPVRRNELRNLWQHVWRRQSSMVSGNETQDESVGQQKIEATSENDAASNHSSGYMACIQSKGEFIEKGSDEQSSCTKPDFEAESAHVEDMPDLSRQLWGKSLQNDVKMQNHEARVNYGQKSLVPVTEAQGSEVAACKEANTRAHFDEDTELETHRSDVILTSEVCNVPVNSPRQVIDFMSAFNNHKPPSNNGASRFDSSPQLDLSLRRTHPDGFENQVERKFILRHSNASAFTRYTNKPSEPQHSSLSGVCNQQKEFETDSEKNFSNILTACNSYTPAATLSTQRSVNSLATGHSKQSELAVSYPQQRPCPVPVSVKVNSTNQAMHKLDHKLDSLEDLGHISPATDQSASSSFCNGAVSRLNSMGYGSACGSNSNLDQVTAGRAAAESKNEEGLFPSNGNLRSIQREAALNKFRLKRKDRCYDKKVRYESRKKLAEQRPRVKGQFVRQVHSETLPLESENHSGNISDG
********TVYKCMMRGAADYLVKPVRRNELRNLWQHVWR******************************************************************************************************************************************SDVILTSEVCNVPVNSPRQVIDFM******************************************FI*******************************************NILTACNSY*************************************************************************************************************************************************CY**********************************************
**********YKCMMRGAADYLVKPVRRNELRNLWQHVW***********************************************************************************************************************************************************************************************************************************************************************************************YPQQ****************************************************RLNSMGYGSACGSNSNLDQVTAGRAAAESKNEEGLFPSNGNLRSIQREAALN*FRLKRKDRCYDKKVRYESRKKLAEQRPRVKG*************************
********TVYKCMMRGAADYLVKPVRRNELRNLWQHVWRRQS*****************************HSSGYMACIQSKGEFIE**********************DMPDLSRQLWGKSLQNDVKMQNHEARVNYGQKSLVPVTEAQGSEVAACKEANTRAHFDEDTELETHRSDVILTSEVCNVPVNSPRQVIDFMSAFNNHKPPSNNGASRFDSSPQLDLSLRRTHPDGFENQVERKFILRHSNASAFTRYT******************KEFETDSEKNFSNILTACNSYTPAATLS************************QRPCPVPVSVKVNSTNQAMHKLDHKLDSLEDLGHISP*********FCNGAVSRLNSMGYGSACGSNSNLDQ************EEGLFPSNGNLRSIQREAALNKFRLKRKDRCYDKKVRYESRKKLAEQRPRVKGQFVRQVHSETLP*************
*****SVSTVYKCMMRGAADYLVKPVRRNELRNLWQHVWRRQS************************************************************************************************************************************************************************************QLDL*L**T***************************************************************************************************************************************************************************************************QREAALNKFRLKRKDRCYDKKVRYESRKKLAEQRPRVKGQFVRQVHS*****************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSQDSVSTVYKCMMRGAADYLVKPVRRNELRNLWQHVWRRQSSMVSGNETQDESVGQQKIEATSENDAASNHSSGYMACIQSKGEFIEKGSDEQSSCTKPDFEAESAHVEDMPDLSRQLWGKSLQNDVKMQNHEARVNYGQKSLVPVTEAQGSEVAACKEANTRAHFDEDTELETHRSDVILTSEVCNVPVNSPRQVIDFMSAFNNHKPPSNNGASRFDSSPQLDLSLRRTHPDGFENQVERKFILRHSNASAFTRYTNKPSEPQHSSLSGVCNQQKEFETDSEKNFSNILTACNSYTPAATLSTQRSVNSLATGHSKQSELAVSYPQQRPCPVPVSVKxxxxxxxxxxxxxxxxxxxxxGHISPATDQSASSSFCNGAVSRLNSMGYGSACGSNSNLDQVTAGRAAAESKNEEGLFPSNGNLRSIQREAALNKFRLKRKDRCYDKKVRYESRKKLAEQRPRVKGQFVRQVHSETLPLESENHSGNISDG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query491 2.2.26 [Sep-21-2011]
Q6LA42558 Two-component response re no no 0.820 0.722 0.353 4e-57
Q689G6623 Two-component response re yes no 0.201 0.158 0.566 8e-22
Q8L500468 Two-component response re no no 0.419 0.440 0.345 7e-20
Q9LVG4495 Two-component response re no no 0.091 0.090 0.75 1e-15
Q93WK5727 Two-component response re no no 0.120 0.081 0.650 7e-15
A2YQ93742 Two-component response re N/A no 0.515 0.340 0.287 2e-14
Q689G9518 Two-component response re no no 0.099 0.094 0.755 2e-14
Q0D3B6742 Two-component response re no no 0.515 0.340 0.284 4e-14
Q10N34 767 Two-component response re no no 0.083 0.053 0.707 2e-13
A2XFB7 767 Two-component response re N/A no 0.083 0.053 0.707 2e-13
>sp|Q6LA42|APRR5_ARATH Two-component response regulator-like APRR5 OS=Arabidopsis thaliana GN=APRR5 PE=1 SV=2 Back     alignment and function desciption
 Score =  222 bits (566), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 178/503 (35%), Positives = 244/503 (48%), Gaps = 100/503 (19%)

Query: 1   MSSQDSVSTVYKCMMRGAADYLVKPVRRNELRNLWQHVWRRQSSMVSGNETQDESVGQQK 60
           MS+QDSV+TVYKCM++GAADYLVKP+RRNELRNLWQHVWRRQ+S+   +   +ESVGQQK
Sbjct: 131 MSTQDSVNTVYKCMLKGAADYLVKPLRRNELRNLWQHVWRRQTSLAPDSFPWNESVGQQK 190

Query: 61  IEATSENDAASNHSSGYMACIQSKGEFIEKGSDEQSSCTKPDFEAESAHVEDMPDLSRQL 120
            E  S N++        ++           G D QSSCT+P+ E ESA            
Sbjct: 191 AEGASANNSNGKRDDHVVSG---------NGGDAQSSCTRPEMEGESA------------ 229

Query: 121 WGKSLQNDVKMQNHEARVNYGQKSLVPVTEAQGSEVAACKEANTRAHFDEDTELETHRSD 180
                  DV++   +A                                    ++E  +S 
Sbjct: 230 -------DVEVSARDA-----------------------------------VQMECAKSQ 247

Query: 181 VILTSEVCNVPVNSPRQVIDFMSAFNNHKPPSNN--GASRFDSSPQLDLSLRRTHPDGFE 238
              T  + N   +   + IDFM A        N     ++++S  +LDLSLRR  P+  E
Sbjct: 248 FNETRLLANELQSKQAEAIDFMGASFRRTGRRNREESVAQYESRIELDLSLRR--PNASE 305

Query: 239 NQVE-RKFILRHSNASAFTRYTNKPSEPQHSSLSGVCNQQKEFETDSEKNFSNILTACNS 297
           NQ    +  L  S+ASAFTRY ++P + Q S+   V +Q+K      + N   ++   N+
Sbjct: 306 NQSSGDRPSLHPSSASAFTRYVHRPLQTQCSASPVVTDQRKNVAASQDDNIV-LMNQYNT 364

Query: 298 YTPAATLSTQRSVNSLATGHSKQ----SELAVSYPQQ--RPCPVPVS-VKVNSTNQAM-- 348
             P    + +R+  S  TG        S    S+P Q   P P P++ ++    N A   
Sbjct: 365 SEPPPN-APRRNDTSFYTGADSPGPPFSNQLNSWPGQSSYPTPTPINNIQFRDPNTAYTS 423

Query: 349 ------------HKLDHKLDSLEDLGHISPATDQSASSSFCNGAVSRLNSMGYGSACGSN 396
                           H+  S+    +  P   Q    S        ++S    SA G++
Sbjct: 424 AMAPASLSPSPSSVSPHEYSSMFHPFNSKPEGLQDRDCSMDVDERRYVSSATEHSAIGNH 483

Query: 397 SNLDQVTAGRAAAESKNEEGLFPSNGNLR-SIQREAALNKFRLKRKDRCYDKKVRYESRK 455
             +DQ+       E KNE+G   S G ++ S+QREAAL KFR+KRKDRCY+KKVRYESRK
Sbjct: 484 --IDQLI------EKKNEDGYSLSVGKIQQSLQREAALTKFRMKRKDRCYEKKVRYESRK 535

Query: 456 KLAEQRPRVKGQFVRQVHSETLP 478
           KLAEQRPR+KGQFVRQV S   P
Sbjct: 536 KLAEQRPRIKGQFVRQVQSTQAP 558




Controls photoperiodic flowering response. Seems to be one of the component of the circadian clock. Expression of several members of the ARR-like family is controlled by circadian rhythm. The particular coordinated sequential expression of APRR9, APRR7, APRR5, APRR3 and APPR1 result to circadian waves that may be at the basis of the endogenous circadian clock.
Arabidopsis thaliana (taxid: 3702)
>sp|Q689G6|PRR95_ORYSJ Two-component response regulator-like PRR95 OS=Oryza sativa subsp. japonica GN=PRR95 PE=2 SV=1 Back     alignment and function description
>sp|Q8L500|APRR9_ARATH Two-component response regulator-like APRR9 OS=Arabidopsis thaliana GN=APRR9 PE=2 SV=2 Back     alignment and function description
>sp|Q9LVG4|APRR3_ARATH Two-component response regulator-like APRR3 OS=Arabidopsis thaliana GN=APRR3 PE=1 SV=1 Back     alignment and function description
>sp|Q93WK5|APRR7_ARATH Two-component response regulator-like APRR7 OS=Arabidopsis thaliana GN=APRR7 PE=2 SV=1 Back     alignment and function description
>sp|A2YQ93|PRR37_ORYSI Two-component response regulator-like PRR37 OS=Oryza sativa subsp. indica GN=PRR37 PE=2 SV=2 Back     alignment and function description
>sp|Q689G9|PRR1_ORYSJ Two-component response regulator-like PRR1 OS=Oryza sativa subsp. japonica GN=PRR1 PE=2 SV=2 Back     alignment and function description
>sp|Q0D3B6|PRR37_ORYSJ Two-component response regulator-like PRR37 OS=Oryza sativa subsp. japonica GN=PRR37 PE=2 SV=1 Back     alignment and function description
>sp|Q10N34|PRR73_ORYSJ Two-component response regulator-like PRR73 OS=Oryza sativa subsp. japonica GN=PRR73 PE=2 SV=1 Back     alignment and function description
>sp|A2XFB7|PRR73_ORYSI Two-component response regulator-like PRR73 OS=Oryza sativa subsp. indica GN=PRR73 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query491
302143985 747 unnamed protein product [Vitis vinifera] 0.995 0.654 0.569 1e-144
157399680 698 pseudo-response regulator 5 [Castanea sa 0.985 0.693 0.522 1e-142
224132554 687 pseudo response regulator [Populus trich 0.975 0.697 0.508 1e-132
356518667 700 PREDICTED: two-component response regula 0.953 0.668 0.472 1e-115
356509155 655 PREDICTED: two-component response regula 0.934 0.700 0.460 1e-107
357464211 685 Two-component response regulator-like PR 0.953 0.683 0.434 1e-96
449497396 696 PREDICTED: two-component response regula 0.959 0.676 0.412 8e-92
224132558477 response regulator [Populus trichocarpa] 0.784 0.807 0.467 9e-92
449456441 696 PREDICTED: two-component response regula 0.959 0.676 0.410 2e-90
359490833 688 PREDICTED: two-component response regula 0.690 0.492 0.531 3e-89
>gi|302143985|emb|CBI23090.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  520 bits (1338), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 286/502 (56%), Positives = 340/502 (67%), Gaps = 13/502 (2%)

Query: 1   MSSQDSVSTVYKCMMRGAADYLVKPVRRNELRNLWQHVWRRQSSMVSGNETQDESVGQQK 60
           MSS  S++TVYKCM+RGAAD+LVKPVRRNEL+NLWQHVWRRQSS VSGN  QDESV QQK
Sbjct: 121 MSSHGSINTVYKCMLRGAADFLVKPVRRNELKNLWQHVWRRQSSTVSGNGPQDESVAQQK 180

Query: 61  IEATSENDAASNHSSGYMACIQSKGEFIEKGSDEQSSCTKPDFEAESAHVEDMPDLSRQL 120
           +EATSEN+  SNHSS ++ACIQ   E + K SD QSSC+KPD EAESA++E M D S   
Sbjct: 181 VEATSENNPTSNHSSDHVACIQKNKEALNKVSDAQSSCSKPDLEAESAYMETMQDFSNPT 240

Query: 121 WGKSLQNDVKMQNHEARVNYGQKSLVPVTEAQGSEVAACKEANTRAHFDEDTELETHRSD 180
           W +SL +D KMQ +E     G K L+   EA G+  AAC++ NT     E  E E     
Sbjct: 241 WSRSLVSDTKMQKNEECAKLGPKFLMHNKEAGGTLEAACRDVNTMTQ-PEAVEPENDGQG 299

Query: 181 VILTSEVCN---VPVNSPRQVIDFMSAFNNHKP------PSNNGASRFDSSPQLDLSLRR 231
               SE C    +  +S R+ ID +  F+N K        SNNG  + DS PQLDLSLRR
Sbjct: 300 ANAPSEACGNNAILGSSSREAIDLIGVFDNSKKCTYGNSSSNNGTKKSDSIPQLDLSLRR 359

Query: 232 THPDGFENQV-ERKFILRHSNASAFTRYTNKPSEPQHSSLSGVCNQQKEFETDSEKNFSN 290
           +HP   ENQV + +  L HSN SAF+RY N+  +P H   +GV NQQK F  DS+K  S 
Sbjct: 360 SHPSSPENQVADERHTLNHSNGSAFSRYINRSLQPPHLPSTGVFNQQKNFGADSDKRLSQ 419

Query: 291 ILTACNSYTPAATLSTQRSVNSLATGHSKQSELAVSYPQQRPCPVPVSVKV-NSTNQAMH 349
           ++T  NS   + TLSTQRSV SLAT  S + E+A+  PQQR  P PV     NST+Q  H
Sbjct: 420 LVTGYNSDITSPTLSTQRSVISLATSPSGRVEIALCGPQQRAFPAPVPQNANNSTSQTNH 479

Query: 350 KLDHKLDSLEDLGHISPATDQSASSSFCNGAVSRLNSMGYGSACGSNSNLDQVTAGRAAA 409
           K +HKLDSLE  GH SPATDQ++SSSF NG  S LNS G GS CGSN N + V   +AAA
Sbjct: 480 KPEHKLDSLEGQGHFSPATDQNSSSSFGNGGASNLNSFGCGSICGSNGNANTVAVVQAAA 539

Query: 410 ESKNEEGLFPSNGN-LRSIQREAALNKFRLKRKDRCYDKKVRYESRKKLAEQRPRVKGQF 468
           E KNEEG+F   G+  RSIQREAAL KFRLKRKDRC++KKVRYESRKKLAEQRPRVKGQF
Sbjct: 540 EGKNEEGIFSHEGHSQRSIQREAALTKFRLKRKDRCFEKKVRYESRKKLAEQRPRVKGQF 599

Query: 469 VRQVHSETLPLESENHSGNISD 490
           VRQVH+   P E + + G+  D
Sbjct: 600 VRQVHTIPPPAEPDTYYGSSFD 621




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|157399680|gb|ABV53464.1| pseudo-response regulator 5 [Castanea sativa] Back     alignment and taxonomy information
>gi|224132554|ref|XP_002321349.1| pseudo response regulator [Populus trichocarpa] gi|222868345|gb|EEF05476.1| pseudo response regulator [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356518667|ref|XP_003528000.1| PREDICTED: two-component response regulator-like PRR95-like [Glycine max] Back     alignment and taxonomy information
>gi|356509155|ref|XP_003523317.1| PREDICTED: two-component response regulator-like APRR9-like [Glycine max] Back     alignment and taxonomy information
>gi|357464211|ref|XP_003602387.1| Two-component response regulator-like PRR73 [Medicago truncatula] gi|355491435|gb|AES72638.1| Two-component response regulator-like PRR73 [Medicago truncatula] Back     alignment and taxonomy information
>gi|449497396|ref|XP_004160390.1| PREDICTED: two-component response regulator-like PRR95-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224132558|ref|XP_002321351.1| response regulator [Populus trichocarpa] gi|222868347|gb|EEF05478.1| response regulator [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449456441|ref|XP_004145958.1| PREDICTED: two-component response regulator-like PRR95-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|359490833|ref|XP_003634174.1| PREDICTED: two-component response regulator-like APRR5-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query491
TAIR|locus:2044376468 PRR9 "pseudo-response regulato 0.162 0.170 0.621 6.1e-39
TAIR|locus:2151206727 PRR7 "pseudo-response regulato 0.221 0.149 0.467 2.4e-32
TAIR|locus:2163198618 TOC1 "TIMING OF CAB EXPRESSION 0.128 0.101 0.539 1.3e-21
TAIR|locus:2062749183 AT2G46670 "AT2G46670" [Arabido 0.162 0.437 0.621 3.5e-20
TAIR|locus:2143206373 CO "CONSTANS" [Arabidopsis tha 0.105 0.139 0.471 4.7e-07
TAIR|locus:2093668690 RR1 "response regulator 1" [Ar 0.334 0.237 0.301 5.1e-07
TAIR|locus:2074587347 COL2 "CONSTANS-like 2" [Arabid 0.105 0.149 0.461 7e-07
TAIR|locus:2172545355 COL5 "CONSTANS-like 5" [Arabid 0.260 0.360 0.326 3.5e-06
TAIR|locus:2130095664 RR2 "response regulator 2" [Ar 0.205 0.152 0.357 4.5e-06
TAIR|locus:2007482195 AT1G07050 "AT1G07050" [Arabido 0.095 0.241 0.446 6.2e-06
TAIR|locus:2044376 PRR9 "pseudo-response regulator 9" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 227 (85.0 bits), Expect = 6.1e-39, Sum P(3) = 6.1e-39
 Identities = 51/82 (62%), Positives = 62/82 (75%)

Query:   394 GSNSNLDQVTAGRAAAESKNEEGLFPSNGNLRSIQREAALNKFRLKRKDRCYDKKVRYES 453
             GS S  + + AG++++  K +E         RS QREAAL KFRLKRKDRC+DKKVRY+S
Sbjct:   384 GSQSTNEGI-AGQSSSTEKPKEEESAKQRWSRS-QREAALMKFRLKRKDRCFDKKVRYQS 441

Query:   454 RKKLAEQRPRVKGQFVRQVHSE 475
             RKKLAEQRPRVKGQFVR V+S+
Sbjct:   442 RKKLAEQRPRVKGQFVRTVNSD 463


GO:0000156 "phosphorelay response regulator activity" evidence=IEA;ISS
GO:0000160 "phosphorelay signal transduction system" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA;TAS
GO:0007623 "circadian rhythm" evidence=IMP;TAS
GO:0005515 "protein binding" evidence=IPI
GO:0009266 "response to temperature stimulus" evidence=IGI
GO:0010017 "red or far-red light signaling pathway" evidence=IMP
GO:0003677 "DNA binding" evidence=IPI
GO:0045892 "negative regulation of transcription, DNA-dependent" evidence=IDA
TAIR|locus:2151206 PRR7 "pseudo-response regulator 7" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2163198 TOC1 "TIMING OF CAB EXPRESSION 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2062749 AT2G46670 "AT2G46670" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2143206 CO "CONSTANS" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2093668 RR1 "response regulator 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2074587 COL2 "CONSTANS-like 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2172545 COL5 "CONSTANS-like 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2130095 RR2 "response regulator 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2007482 AT1G07050 "AT1G07050" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
PtpRR3
response regulator (687 aa)
(Populus trichocarpa)
Predicted Functional Partners:
ETR7
ethylene receptor 7 (769 aa)
       0.681
gw1.I.396.1
histidine phosphotransfer protein (117 aa)
       0.679
fgenesh4_pg.C_scaffold_697000003
histidine phosphotransfer protein (146 aa)
       0.679
fgenesh4_pg.C_LG_XIV000773
histidine phosphotransfer protein (139 aa)
       0.679
fgenesh4_pg.C_LG_X002318
histidine phosphotransfer protein (159 aa)
       0.679
fgenesh4_pg.C_LG_VI001633
histidine phosphotransfer protein (147 aa)
       0.679
fgenesh4_pg.C_LG_IX000220
histidine phosphotransfer protein (245 aa)
       0.679
fgenesh4_pg.C_LG_I003334
histidine phosphotransfer protein (147 aa)
       0.679
eugene3.00440046
histidine phosphotransfer protein (192 aa)
       0.679
eugene3.00180254
hypothetical protein (137 aa)
       0.679

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query491
pfam0620345 pfam06203, CCT, CCT motif 4e-19
cd00156113 cd00156, REC, Signal receiver domain; originally t 5e-04
pfam00072111 pfam00072, Response_reg, Response regulator receiv 0.004
>gnl|CDD|203407 pfam06203, CCT, CCT motif Back     alignment and domain information
 Score = 80.3 bits (199), Expect = 4e-19
 Identities = 28/43 (65%), Positives = 36/43 (83%)

Query: 429 REAALNKFRLKRKDRCYDKKVRYESRKKLAEQRPRVKGQFVRQ 471
           REAAL +++ KRK R +DKK+RY SRK +AE RPRVKG+FV+Q
Sbjct: 1   REAALLRYKEKRKTRKFDKKIRYASRKAVAESRPRVKGRFVKQ 43


This short motif is found in a number of plant proteins. It is rich in basic amino acids and has been called a CCT motif after Co, Col and Toc1. The CCT motif is about 45 amino acids long and contains a putative nuclear localisation signal within the second half of the CCT motif. Toc1 mutants have been identified in this region. Length = 45

>gnl|CDD|238088 cd00156, REC, Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; contains a phosphoacceptor site that is phosphorylated by histidine kinase homologs; usually found N-terminal to a DNA binding effector domain; forms homodimers Back     alignment and domain information
>gnl|CDD|200976 pfam00072, Response_reg, Response regulator receiver domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 491
PF0620345 CCT: CCT motif; InterPro: IPR010402 The CCT (CONST 99.74
COG4753475 Response regulator containing CheY-like receiver d 98.3
COG4566202 TtrR Response regulator [Signal transduction mecha 97.62
COG4565224 CitB Response regulator of citrate/malate metaboli 97.55
COG2204464 AtoC Response regulator containing CheY-like recei 97.49
COG0745229 OmpR Response regulators consisting of a CheY-like 97.28
PRK09581457 pleD response regulator PleD; Reviewed 96.96
COG4567182 Response regulator consisting of a CheY-like recei 96.85
PLN03029222 type-a response regulator protein; Provisional 96.73
PRK10046225 dpiA two-component response regulator DpiA; Provis 96.44
PRK10529225 DNA-binding transcriptional activator KdpE; Provis 96.39
PRK10643222 DNA-binding transcriptional regulator BasR; Provis 96.28
TIGR03787227 marine_sort_RR proteobacterial dedicated sortase s 96.28
PRK10766221 DNA-binding transcriptional regulator TorR; Provis 96.26
PRK10336219 DNA-binding transcriptional regulator QseB; Provis 96.19
PRK10161229 transcriptional regulator PhoB; Provisional 96.15
PRK11173237 two-component response regulator; Provisional 96.12
PRK09836227 DNA-binding transcriptional activator CusR; Provis 96.1
PRK10816223 DNA-binding transcriptional regulator PhoP; Provis 96.08
CHL00148240 orf27 Ycf27; Reviewed 96.0
PRK10430239 DNA-binding transcriptional activator DcuR; Provis 95.91
TIGR02154226 PhoB phosphate regulon transcriptional regulatory 95.87
TIGR02915445 PEP_resp_reg putative PEP-CTERM system response re 95.86
PF0942527 CCT_2: Divergent CCT motif; InterPro: IPR018467 Th 95.8
PRK10955232 DNA-binding transcriptional regulator CpxR; Provis 95.79
PRK10693303 response regulator of RpoS; Provisional 95.78
PRK09468239 ompR osmolarity response regulator; Provisional 95.78
PRK10610129 chemotaxis regulatory protein CheY; Provisional 95.76
PRK10360196 DNA-binding transcriptional activator UhpA; Provis 95.65
PRK11517223 transcriptional regulatory protein YedW; Provision 95.64
TIGR01387218 cztR_silR_copR heavy metal response regulator. Mem 95.58
PRK11083228 DNA-binding response regulator CreB; Provisional 95.54
PRK09958204 DNA-binding transcriptional activator EvgA; Provis 95.47
PRK10840216 transcriptional regulator RcsB; Provisional 95.42
TIGR02875262 spore_0_A sporulation transcription factor Spo0A. 95.34
KOG1601340 consensus GATA-4/5/6 transcription factors [Transc 95.33
PRK10701240 DNA-binding transcriptional regulator RstA; Provis 95.31
PRK13856241 two-component response regulator VirG; Provisional 95.28
PRK09935210 transcriptional regulator FimZ; Provisional 95.17
PRK11697238 putative two-component response-regulatory protein 95.1
PRK15479221 transcriptional regulatory protein TctD; Provision 95.02
PRK14084246 two-component response regulator; Provisional 94.88
PRK10710240 DNA-binding transcriptional regulator BaeR; Provis 94.58
PRK11475207 DNA-binding transcriptional activator BglJ; Provis 94.48
PRK10365441 transcriptional regulatory protein ZraR; Provision 94.24
PRK10923469 glnG nitrogen regulation protein NR(I); Provisiona 94.24
COG2197211 CitB Response regulator containing a CheY-like rec 94.19
PRK09483217 response regulator; Provisional 94.14
PRK11361457 acetoacetate metabolism regulatory protein AtoC; P 93.98
PRK15115444 response regulator GlrR; Provisional 93.97
COG0784130 CheY FOG: CheY-like receiver [Signal transduction 93.66
PRK09581457 pleD response regulator PleD; Reviewed 93.65
PRK10403215 transcriptional regulator NarP; Provisional 93.65
TIGR01818463 ntrC nitrogen regulation protein NR(I). This model 93.6
PRK15369211 two component system sensor kinase SsrB; Provision 93.52
COG3437360 Response regulator containing a CheY-like receiver 93.48
PRK13435145 response regulator; Provisional 93.47
COG3707194 AmiR Response regulator with putative antiterminat 93.26
PRK11107919 hybrid sensory histidine kinase BarA; Provisional 93.02
PRK10651216 transcriptional regulator NarL; Provisional 92.58
PRK15347921 two component system sensor kinase SsrA; Provision 92.43
PRK11466914 hybrid sensory histidine kinase TorS; Provisional 91.78
COG3706435 PleD Response regulator containing a CheY-like rec 91.67
cd00156113 REC Signal receiver domain; originally thought to 91.59
PRK09390202 fixJ response regulator FixJ; Provisional 91.1
TIGR02956968 TMAO_torS TMAO reductase sytem sensor TorS. This p 90.57
PRK099591197 hybrid sensory histidine kinase in two-component r 89.69
TIGR03815322 CpaE_hom_Actino helicase/secretion neighborhood Cp 87.93
PRK12555337 chemotaxis-specific methylesterase; Provisional 86.55
PRK11091779 aerobic respiration control sensor protein ArcB; P 85.41
COG3947361 Response regulator containing CheY-like receiver a 82.86
PRK12704520 phosphodiesterase; Provisional 81.21
>PF06203 CCT: CCT motif; InterPro: IPR010402 The CCT (CONSTANS, CO-like, and TOC1) domain is a highly conserved basic module of ~43 amino acids, which is found near the C terminus of plant proteins often involved in light signal transduction Back     alignment and domain information
Probab=99.74  E-value=7.6e-19  Score=132.47  Aligned_cols=45  Identities=56%  Similarity=0.986  Sum_probs=43.1

Q ss_pred             HHHHHHHHHHhhhccCCCCcccchhhhhhhhhCCCCCcceecccC
Q 011192          429 REAALNKFRLKRKDRCYDKKVRYESRKKLAEQRPRVKGQFVRQVH  473 (491)
Q Consensus       429 R~~~l~ryr~Krk~R~f~KkirY~~RK~~A~~RpRvKGrFvk~~~  473 (491)
                      |+++|+||++||+.|+|+|+|+|+|||.+|+.|||||||||+..+
T Consensus         1 R~~~l~Ry~~Kr~~R~f~kkirY~~Rk~~A~~R~RvkGRFvk~~e   45 (45)
T PF06203_consen    1 REEKLQRYREKRKRRNFEKKIRYESRKAVADKRPRVKGRFVKKSE   45 (45)
T ss_pred             CHHHHHHHHHHHHhhcccccCCcchHHHHHhhCCccCCcccCCCC
Confidence            689999999999999999999999999999999999999999764



The CCT domain is found in association with other domains, such as the B-box zinc finger, the GATA-type zinc finger, the ZIM motif or the response regulatory domain. The CCT domain contains a putative nuclear localisation signal within the second half of the CCT motif and has been shown to be involved in nuclear localization and probably also has a role in protein-protein interaction [].; GO: 0005515 protein binding

>COG4753 Response regulator containing CheY-like receiver domain and AraC-type DNA-binding domain [Signal transduction mechanisms] Back     alignment and domain information
>COG4566 TtrR Response regulator [Signal transduction mechanisms] Back     alignment and domain information
>COG4565 CitB Response regulator of citrate/malate metabolism [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information
>COG0745 OmpR Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>PRK09581 pleD response regulator PleD; Reviewed Back     alignment and domain information
>COG4567 Response regulator consisting of a CheY-like receiver domain and a Fis-type HTH domain [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>PLN03029 type-a response regulator protein; Provisional Back     alignment and domain information
>PRK10046 dpiA two-component response regulator DpiA; Provisional Back     alignment and domain information
>PRK10529 DNA-binding transcriptional activator KdpE; Provisional Back     alignment and domain information
>PRK10643 DNA-binding transcriptional regulator BasR; Provisional Back     alignment and domain information
>TIGR03787 marine_sort_RR proteobacterial dedicated sortase system response regulator Back     alignment and domain information
>PRK10766 DNA-binding transcriptional regulator TorR; Provisional Back     alignment and domain information
>PRK10336 DNA-binding transcriptional regulator QseB; Provisional Back     alignment and domain information
>PRK10161 transcriptional regulator PhoB; Provisional Back     alignment and domain information
>PRK11173 two-component response regulator; Provisional Back     alignment and domain information
>PRK09836 DNA-binding transcriptional activator CusR; Provisional Back     alignment and domain information
>PRK10816 DNA-binding transcriptional regulator PhoP; Provisional Back     alignment and domain information
>CHL00148 orf27 Ycf27; Reviewed Back     alignment and domain information
>PRK10430 DNA-binding transcriptional activator DcuR; Provisional Back     alignment and domain information
>TIGR02154 PhoB phosphate regulon transcriptional regulatory protein PhoB Back     alignment and domain information
>TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator Back     alignment and domain information
>PF09425 CCT_2: Divergent CCT motif; InterPro: IPR018467 The short CCT (CO, COL, TOC1) motif is found in a number of plant proteins, including Constans (CO), Constans-like (COL) and TOC1 Back     alignment and domain information
>PRK10955 DNA-binding transcriptional regulator CpxR; Provisional Back     alignment and domain information
>PRK10693 response regulator of RpoS; Provisional Back     alignment and domain information
>PRK09468 ompR osmolarity response regulator; Provisional Back     alignment and domain information
>PRK10610 chemotaxis regulatory protein CheY; Provisional Back     alignment and domain information
>PRK10360 DNA-binding transcriptional activator UhpA; Provisional Back     alignment and domain information
>PRK11517 transcriptional regulatory protein YedW; Provisional Back     alignment and domain information
>TIGR01387 cztR_silR_copR heavy metal response regulator Back     alignment and domain information
>PRK11083 DNA-binding response regulator CreB; Provisional Back     alignment and domain information
>PRK09958 DNA-binding transcriptional activator EvgA; Provisional Back     alignment and domain information
>PRK10840 transcriptional regulator RcsB; Provisional Back     alignment and domain information
>TIGR02875 spore_0_A sporulation transcription factor Spo0A Back     alignment and domain information
>KOG1601 consensus GATA-4/5/6 transcription factors [Transcription] Back     alignment and domain information
>PRK10701 DNA-binding transcriptional regulator RstA; Provisional Back     alignment and domain information
>PRK13856 two-component response regulator VirG; Provisional Back     alignment and domain information
>PRK09935 transcriptional regulator FimZ; Provisional Back     alignment and domain information
>PRK11697 putative two-component response-regulatory protein YehT; Provisional Back     alignment and domain information
>PRK15479 transcriptional regulatory protein TctD; Provisional Back     alignment and domain information
>PRK14084 two-component response regulator; Provisional Back     alignment and domain information
>PRK10710 DNA-binding transcriptional regulator BaeR; Provisional Back     alignment and domain information
>PRK11475 DNA-binding transcriptional activator BglJ; Provisional Back     alignment and domain information
>PRK10365 transcriptional regulatory protein ZraR; Provisional Back     alignment and domain information
>PRK10923 glnG nitrogen regulation protein NR(I); Provisional Back     alignment and domain information
>COG2197 CitB Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>PRK09483 response regulator; Provisional Back     alignment and domain information
>PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional Back     alignment and domain information
>PRK15115 response regulator GlrR; Provisional Back     alignment and domain information
>COG0784 CheY FOG: CheY-like receiver [Signal transduction mechanisms] Back     alignment and domain information
>PRK09581 pleD response regulator PleD; Reviewed Back     alignment and domain information
>PRK10403 transcriptional regulator NarP; Provisional Back     alignment and domain information
>TIGR01818 ntrC nitrogen regulation protein NR(I) Back     alignment and domain information
>PRK15369 two component system sensor kinase SsrB; Provisional Back     alignment and domain information
>COG3437 Response regulator containing a CheY-like receiver domain and an HD-GYP domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK13435 response regulator; Provisional Back     alignment and domain information
>COG3707 AmiR Response regulator with putative antiterminator output domain [Signal transduction mechanisms] Back     alignment and domain information
>PRK11107 hybrid sensory histidine kinase BarA; Provisional Back     alignment and domain information
>PRK10651 transcriptional regulator NarL; Provisional Back     alignment and domain information
>PRK15347 two component system sensor kinase SsrA; Provisional Back     alignment and domain information
>PRK11466 hybrid sensory histidine kinase TorS; Provisional Back     alignment and domain information
>COG3706 PleD Response regulator containing a CheY-like receiver domain and a GGDEF domain [Signal transduction mechanisms] Back     alignment and domain information
>cd00156 REC Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; contains a phosphoacceptor site that is phosphorylated by histidine kinase homologs; usually found N-terminal to a DNA binding effector domain; forms homodimers Back     alignment and domain information
>PRK09390 fixJ response regulator FixJ; Provisional Back     alignment and domain information
>TIGR02956 TMAO_torS TMAO reductase sytem sensor TorS Back     alignment and domain information
>PRK09959 hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional Back     alignment and domain information
>TIGR03815 CpaE_hom_Actino helicase/secretion neighborhood CpaE-like protein Back     alignment and domain information
>PRK12555 chemotaxis-specific methylesterase; Provisional Back     alignment and domain information
>PRK11091 aerobic respiration control sensor protein ArcB; Provisional Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>PRK12704 phosphodiesterase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query491
4dad_A146 Putative pilus assembly-related protein; response 8e-05
3i42_A127 Response regulator receiver domain protein (CHEY- 7e-04
1srr_A124 SPO0F, sporulation response regulatory protein; as 7e-04
>4dad_A Putative pilus assembly-related protein; response regulator receiver domain, CHEY-related protein, ST genomics; 2.50A {Burkholderia pseudomallei} PDB: 4dn6_A Length = 146 Back     alignment and structure
 Score = 41.6 bits (98), Expect = 8e-05
 Identities = 8/43 (18%), Positives = 17/43 (39%)

Query: 1   MSSQDSVSTVYKCMMRGAADYLVKPVRRNELRNLWQHVWRRQS 43
           +++  S  T+   M  G  D L  P+    L +  +    + +
Sbjct: 101 VTTDASSQTLLDAMRAGVRDVLRWPLEPRALDDALKRAAAQCA 143


>3i42_A Response regulator receiver domain protein (CHEY- like); structural genomics, PSI-2, protein structure initiative; 2.15A {Methylobacillus flagellatus KT} Length = 127 Back     alignment and structure
>1srr_A SPO0F, sporulation response regulatory protein; aspartate pocket, two component system; 1.90A {Bacillus subtilis} SCOP: c.23.1.1 PDB: 1pey_A 3q15_C 2ftk_E* 1fsp_A 1nat_A 1pux_A 2fsp_A 2jvj_A 2jvk_A 2jvi_A 1f51_E Length = 124 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query491
2pl1_A121 Transcriptional regulatory protein PHOP; CHEY-like 97.62
3gl9_A122 Response regulator; beta-sheet, surrounded by alph 97.59
1zgz_A122 Torcad operon transcriptional regulatory protein; 97.58
3t6k_A136 Response regulator receiver; flavodoxin-like, stru 97.58
1jbe_A128 Chemotaxis protein CHEY; signaling protein; 1.08A 97.55
3h1g_A129 Chemotaxis protein CHEY homolog; sulfate-bound CHE 97.55
3f6p_A120 Transcriptional regulatory protein YYCF; unphospho 97.55
1xhf_A123 DYE resistance, aerobic respiration control protei 97.54
1p6q_A129 CHEY2; chemotaxis, signal transduction, response r 97.52
3cfy_A137 Putative LUXO repressor protein; structural genomi 97.49
1zh2_A121 KDP operon transcriptional regulatory protein KDPE 97.49
2r25_B133 Osmosensing histidine protein kinase SLN1; alpha5- 97.49
3kto_A136 Response regulator receiver protein; PSI-II,struct 97.48
2qzj_A136 Two-component response regulator; 11017X, PSI-II, 97.48
3hdg_A137 Uncharacterized protein; two-component sensor acti 97.46
3crn_A132 Response regulator receiver domain protein, CHEY-; 97.46
1dbw_A126 Transcriptional regulatory protein FIXJ; doubly wo 97.44
2a9o_A120 Response regulator; essential protein, YYCF/YYCG h 97.43
3kht_A144 Response regulator; PSI-II, 11023K, structural gen 97.43
3jte_A143 Response regulator receiver protein; structural ge 97.41
1dcf_A136 ETR1 protein; beta-alpha five sandwich, transferas 97.4
1k68_A140 Phytochrome response regulator RCPA; phosphorylate 97.4
1dz3_A130 Stage 0 sporulation protein A; response regulator, 97.39
1tmy_A120 CHEY protein, TMY; chemotaxis, phosphoryl transfer 97.39
1qo0_D196 AMIR; binding protein, gene regulator, receptor; 2 97.38
1i3c_A149 Response regulator RCP1; phytochrome, signaling pr 97.36
3lua_A140 Response regulator receiver protein; two-component 97.34
3b2n_A133 Uncharacterized protein Q99UF4; structural genomic 97.34
3rqi_A184 Response regulator protein; structural genomics, s 97.32
1k66_A149 Phytochrome response regulator RCPB; CHEY homologu 97.32
3eod_A130 Protein HNR; response regulator, phosphoprotein, t 97.31
3hv2_A153 Response regulator/HD domain protein; PSI-2, NYSGX 97.3
2zay_A147 Response regulator receiver protein; structural ge 97.29
3gt7_A154 Sensor protein; structural genomics, signal receiv 97.29
1srr_A124 SPO0F, sporulation response regulatory protein; as 97.24
3cnb_A143 DNA-binding response regulator, MERR family; signa 97.23
3heb_A152 Response regulator receiver domain protein (CHEY); 97.23
1mb3_A124 Cell division response regulator DIVK; signal tran 97.2
3r0j_A250 Possible two component system response transcript 97.2
4e7p_A150 Response regulator; DNA binding, cytosol, transcri 97.2
3cg0_A140 Response regulator receiver modulated diguanylate 97.18
3hdv_A136 Response regulator; PSI-II, structural genomics, P 97.18
3cu5_A141 Two component transcriptional regulator, ARAC FAM; 97.16
2jba_A127 Phosphate regulon transcriptional regulatory PROT; 97.15
3m6m_D143 Sensory/regulatory protein RPFC; RPFF, REC, enoyl- 97.13
1s8n_A205 Putative antiterminator; RV1626, structural genomi 97.13
3eul_A152 Possible nitrate/nitrite response transcriptional 97.12
1qkk_A155 DCTD, C4-dicarboxylate transport transcriptional r 97.1
3dzd_A368 Transcriptional regulator (NTRC family); sigma43 a 97.09
2qxy_A142 Response regulator; regulation of transcription, N 97.09
1mvo_A136 PHOP response regulator; phosphate regulon, transc 97.08
3f6c_A134 Positive transcription regulator EVGA; structural 97.07
3kcn_A151 Adenylate cyclase homolog; SGX, PSI 2, structural 97.06
3grc_A140 Sensor protein, kinase; protein structure initiati 97.06
1a04_A215 Nitrate/nitrite response regulator protein NARL; s 97.06
2qr3_A140 Two-component system response regulator; structura 97.05
3h5i_A140 Response regulator/sensory box protein/ggdef domai 97.01
3n53_A140 Response regulator receiver modulated diguanylate; 97.01
1p2f_A220 Response regulator; DRRB, OMPR/PHOB, transcription 96.97
3q9s_A249 DNA-binding response regulator; DNA binding protei 96.95
1dc7_A124 NTRC, nitrogen regulation protein; receiver domain 96.94
3bre_A358 Probable two-component response regulator; protein 96.91
3i42_A127 Response regulator receiver domain protein (CHEY- 96.91
1yio_A208 Response regulatory protein; transcription regulat 96.89
2qvg_A143 Two component response regulator; NYSGXRC, PSI-2, 96.88
3cz5_A153 Two-component response regulator, LUXR family; str 96.86
2jk1_A139 HUPR, hydrogenase transcriptional regulatory prote 96.86
2rjn_A154 Response regulator receiver:metal-dependent phosph 96.85
3nhm_A133 Response regulator; protein structure initiative I 96.85
2qsj_A154 DNA-binding response regulator, LUXR family; struc 96.85
1kgs_A225 DRRD, DNA binding response regulator D; DNA-bindin 96.82
3lte_A132 Response regulator; structural genomics, PSI, prot 96.8
3eq2_A394 Probable two-component response regulator; adaptor 96.79
2hqr_A223 Putative transcriptional regulator; phosporylation 96.79
1w25_A459 Stalked-cell differentiation controlling protein; 96.78
2qv0_A143 Protein MRKE; structural genomics, transcription, 96.78
1ny5_A387 Transcriptional regulator (NTRC family); AAA+ ATPa 96.74
2oqr_A230 Sensory transduction protein REGX3; response regul 96.65
3eqz_A135 Response regulator; structural genomics, unknown f 96.65
3cg4_A142 Response regulator receiver domain protein (CHEY-; 96.64
3c3w_A225 Two component transcriptional regulatory protein; 96.45
3klo_A225 Transcriptional regulator VPST; REC domain, HTH do 96.41
2gkg_A127 Response regulator homolog; social motility, recei 96.4
1ys7_A233 Transcriptional regulatory protein PRRA; response 96.38
2gwr_A238 DNA-binding response regulator MTRA; two-component 96.03
3sy8_A400 ROCR; TIM barrel phosphodiesterase-A, transcriptio 95.82
3kyj_B145 CHEY6 protein, putative histidine protein kinase; 95.74
3c3m_A138 Response regulator receiver protein; structural ge 95.47
2rdm_A132 Response regulator receiver protein; structural ge 94.71
3a10_A116 Response regulator; phosphoacceptor, signaling pro 94.6
3ogl_Q21 JAZ1 incomplete degron peptide; leucine-rich repea 94.52
3luf_A259 Two-component system response regulator/ggdef doma 94.51
2lpm_A123 Two-component response regulator; transcription re 93.96
2j48_A119 Two-component sensor kinase; pseudo-receiver, circ 93.61
1a2o_A349 CHEB methylesterase; bacterial chemotaxis, adaptat 93.52
3t8y_A164 CHEB, chemotaxis response regulator protein-glutam 93.47
2pln_A137 HP1043, response regulator; signaling protein; 1.8 93.4
3c97_A140 Signal transduction histidine kinase; structural g 92.67
3cwo_X237 Beta/alpha-barrel protein based on 1THF and 1TMY; 92.09
3ogk_Q22 JAZ1 incomplete degron peptide; leucine rich repea 91.54
1w25_A459 Stalked-cell differentiation controlling protein; 88.95
2vyc_A 755 Biodegradative arginine decarboxylase; pyridoxal p 83.88
2b4a_A138 BH3024; flavodoxin-like fold, structural genomics, 80.84
>2pl1_A Transcriptional regulatory protein PHOP; CHEY-like fold, response regulator, beryllium fluoride, transcription factor, activated, virulence; 1.90A {Escherichia coli} SCOP: c.23.1.1 PDB: 2pkx_A Back     alignment and structure
Probab=97.62  E-value=6.3e-05  Score=60.61  Aligned_cols=42  Identities=26%  Similarity=0.434  Sum_probs=38.3

Q ss_pred             CCCcchHHHHHHHHHhccceeEeCCCCHHHHHHHHHHHHHHH
Q 011192            1 MSSQDSVSTVYKCMMRGAADYLVKPVRRNELRNLWQHVWRRQ   42 (491)
Q Consensus         1 MS~~d~~e~v~kal~~GA~DYLlKPv~~eELk~lwqhv~rk~   42 (491)
                      ||++.+.+.+.+|+..||.|||.||++.++|...++.++++.
T Consensus        78 ~s~~~~~~~~~~~~~~g~~~~l~kp~~~~~l~~~i~~~~~~~  119 (121)
T 2pl1_A           78 LTARESWQDKVEVLSAGADDYVTKPFHIEEVMARMQALMRRN  119 (121)
T ss_dssp             EESCCCHHHHHHHHHTTCSEEEESSCCHHHHHHHHHHHHHHH
T ss_pred             EecCCCHHHHHHHHHcCccceEECCCCHHHHHHHHHHHHHhh
Confidence            467888899999999999999999999999999999988764



>3gl9_A Response regulator; beta-sheet, surrounded by alpha helices, BOTH sides, signaling protein; HET: BFD; 1.80A {Thermotoga maritima} SCOP: c.23.1.0 PDB: 3dgf_C 3dge_C Back     alignment and structure
>1zgz_A Torcad operon transcriptional regulatory protein; two-component system, gene regulation, transcription factor, respiratory system; 1.80A {Escherichia coli} SCOP: c.23.1.1 Back     alignment and structure
>3t6k_A Response regulator receiver; flavodoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: MSE; 1.86A {Chloroflexus aurantiacus} SCOP: c.23.1.0 Back     alignment and structure
>1jbe_A Chemotaxis protein CHEY; signaling protein; 1.08A {Escherichia coli} SCOP: c.23.1.1 PDB: 3chy_A 1a0o_A 1cey_A 1bdj_A 1eay_A 1f4v_A 1ffg_A 1ffs_A 1ffw_A 1fqw_A 2b1j_A 1chn_A 1djm_A 1kmi_Y* 1d4z_A 3olx_A 3olw_A 1cye_A 2che_A 2chf_A ... Back     alignment and structure
>3h1g_A Chemotaxis protein CHEY homolog; sulfate-bound CHEY, cytoplasm, flagellar rotatio magnesium, metal-binding, phosphoprotein; 1.70A {Helicobacter pylori} SCOP: c.23.1.1 PDB: 3gwg_A 3h1e_A 3h1f_A Back     alignment and structure
>3f6p_A Transcriptional regulatory protein YYCF; unphosphorelated, receiver domain, cytoplasm, DNA-binding, phosphoprotein, transcription regulation; 1.95A {Bacillus subtilis} SCOP: c.23.1.1 PDB: 2zwm_A Back     alignment and structure
>1xhf_A DYE resistance, aerobic respiration control protein ARCA; two-component system, gene regulation, transcription factor, anoxic redox control; 2.15A {Escherichia coli} SCOP: c.23.1.1 PDB: 1xhe_A Back     alignment and structure
>1p6q_A CHEY2; chemotaxis, signal transduction, response regulator, structural proteomics in europe, spine, structural genomics; NMR {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1p6u_A Back     alignment and structure
>3cfy_A Putative LUXO repressor protein; structural genomics, unknown function, uncharacterized protein, signal receiver domain; 2.50A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1zh2_A KDP operon transcriptional regulatory protein KDPE; two-component system, gene regulation, transcription factor, KDP potassium transport system; 2.00A {Escherichia coli} SCOP: c.23.1.1 PDB: 1zh4_A Back     alignment and structure
>2r25_B Osmosensing histidine protein kinase SLN1; alpha5-BETA5, response regulator, four helix bundle, histidine phosphotransfer (HPT) protein; 1.70A {Saccharomyces cerevisiae} SCOP: c.23.1.1 PDB: 1oxk_B 1oxb_B Back     alignment and structure
>3kto_A Response regulator receiver protein; PSI-II,structural genomics, protein structure initiative; 1.98A {Pseudoalteromonas atlantica T6C} SCOP: c.23.1.0 Back     alignment and structure
>2qzj_A Two-component response regulator; 11017X, PSI-II, structural genomics; 2.89A {Clostridium difficile} Back     alignment and structure
>3hdg_A Uncharacterized protein; two-component sensor activity, response regulator, PSI-II, 11227F, NYSGXRC, structural genomics; 2.27A {Wolinella succinogenes} SCOP: c.23.1.0 Back     alignment and structure
>3crn_A Response regulator receiver domain protein, CHEY-; structural genomics, signal regulator receiver domain; HET: PHD; 1.58A {Methanospirillum hungatei jf-1} Back     alignment and structure
>1dbw_A Transcriptional regulatory protein FIXJ; doubly wound five-stranded beta/alpha fold, nitrogen fixatio regulation; HET: 15P; 1.60A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1dck_A* 1dcm_A 1d5w_A* Back     alignment and structure
>2a9o_A Response regulator; essential protein, YYCF/YYCG homolog, signaling protein; 1.65A {Streptococcus pneumoniae} SCOP: c.23.1.1 PDB: 1nxo_A 1nxs_A 1nxv_A 1nxw_A 1nxx_A 1nxp_A 2a9p_A 2a9q_A 1nxt_A* 2a9r_A* Back     alignment and structure
>3kht_A Response regulator; PSI-II, 11023K, structural genomics, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 2.10A {Hahella chejuensis} SCOP: c.23.1.0 Back     alignment and structure
>3jte_A Response regulator receiver protein; structural genomics, nysgrc, response regulator receiver DOM target 11226E, PSI-2; 1.90A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>1dcf_A ETR1 protein; beta-alpha five sandwich, transferase; 2.50A {Arabidopsis thaliana} SCOP: c.23.1.2 Back     alignment and structure
>1k68_A Phytochrome response regulator RCPA; phosphorylated aspartate, CHEY homologue, homodimer, (beta/alpha)5, signaling protein; HET: PHD; 1.90A {Tolypothrix SP} SCOP: c.23.1.1 Back     alignment and structure
>1dz3_A Stage 0 sporulation protein A; response regulator, domain swapping; 1.65A {Bacillus stearothermophilus} SCOP: c.23.1.1 PDB: 1qmp_A* Back     alignment and structure
>1tmy_A CHEY protein, TMY; chemotaxis, phosphoryl transfer, signal transduction; 1.90A {Thermotoga maritima} SCOP: c.23.1.1 PDB: 2tmy_A 3tmy_A 4tmy_A 1u0s_Y Back     alignment and structure
>1qo0_D AMIR; binding protein, gene regulator, receptor; 2.25A {Pseudomonas aeruginosa} SCOP: c.23.1.3 Back     alignment and structure
>1i3c_A Response regulator RCP1; phytochrome, signaling protein; 1.90A {Synechocystis SP} SCOP: c.23.1.1 PDB: 1jlk_A Back     alignment and structure
>3lua_A Response regulator receiver protein; two-component signal transduction system, histidine kinase, phosphorelay, receiver domain, nysgxrc; 2.40A {Clostridium thermocellum} Back     alignment and structure
>3b2n_A Uncharacterized protein Q99UF4; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.04A {Staphylococcus aureus} Back     alignment and structure
>3rqi_A Response regulator protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PHD CIT; 1.70A {Burkholderia pseudomallei} Back     alignment and structure
>1k66_A Phytochrome response regulator RCPB; CHEY homologue, homodimer, APO-protein, (beta/alpha)5, signaling protein; 1.75A {Tolypothrix SP} SCOP: c.23.1.1 Back     alignment and structure
>3eod_A Protein HNR; response regulator, phosphoprotein, two-component regulatory system, signaling protein; 1.75A {Escherichia coli K12} Back     alignment and structure
>3hv2_A Response regulator/HD domain protein; PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.50A {Pseudomonas fluorescens pf-5} Back     alignment and structure
>2zay_A Response regulator receiver protein; structural genomics, NYSGXRC, target 11006U, protein structure initiative; 2.00A {Desulfuromonas acetoxidans} Back     alignment and structure
>3gt7_A Sensor protein; structural genomics, signal receiver domain, kinase, PSI-2, protein structure initiative; 2.30A {Syntrophus aciditrophicus SB} Back     alignment and structure
>1srr_A SPO0F, sporulation response regulatory protein; aspartate pocket, two component system; 1.90A {Bacillus subtilis} SCOP: c.23.1.1 PDB: 1pey_A 3q15_C 2ftk_E* 1fsp_A 1nat_A 1pux_A 2fsp_A 2jvj_A 2jvk_A 2jvi_A 1f51_E Back     alignment and structure
>3cnb_A DNA-binding response regulator, MERR family; signal receiver domain, DNA binding protein, protein structu initiative, PSI-2; 2.00A {Colwellia psychrerythraea} Back     alignment and structure
>3heb_A Response regulator receiver domain protein (CHEY); NYSGXRC, PSI-II, respose regulator, structure initiative, structural genomics; 2.40A {Rhodospirillum rubrum} SCOP: c.23.1.0 Back     alignment and structure
>1mb3_A Cell division response regulator DIVK; signal transduction protein, structural proteomics in europe, spine, structural genomics; 1.41A {Caulobacter vibrioides} SCOP: c.23.1.1 PDB: 1m5u_A 1mav_A 1mb0_A 1m5t_A Back     alignment and structure
>3r0j_A Possible two component system response transcript positive regulator PHOP; beta-alpha fold, winged helix-turn-helix; 2.50A {Mycobacterium tuberculosis} Back     alignment and structure
>4e7p_A Response regulator; DNA binding, cytosol, transcription regulator; 1.89A {Streptococcus pneumoniae} PDB: 4e7o_A Back     alignment and structure
>3cg0_A Response regulator receiver modulated diguanylate with PAS/PAC sensor; signal receiver domain, diguanylate cyclase; 2.15A {Desulfovibrio desulfuricans subsp} Back     alignment and structure
>3hdv_A Response regulator; PSI-II, structural genomics, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 2.09A {Pseudomonas putida} SCOP: c.23.1.0 Back     alignment and structure
>3cu5_A Two component transcriptional regulator, ARAC FAM; structural genomics, protein structure initiative; 2.60A {Clostridium phytofermentans isdg} Back     alignment and structure
>2jba_A Phosphate regulon transcriptional regulatory PROT; transcription factor, sensory transduction, phosphate regula transcription regulation; 1.45A {Escherichia coli} PDB: 2jba_B 1b00_A 2iyn_A 2jb9_A 1zes_A Back     alignment and structure
>3m6m_D Sensory/regulatory protein RPFC; RPFF, REC, enoyl-COA hydratase, lyase-transferase COMP; 2.50A {Xanthomonas campestris PV} Back     alignment and structure
>1s8n_A Putative antiterminator; RV1626, structural genomics, transcriptional antiterminator, component system, PSI; 1.48A {Mycobacterium tuberculosis} SCOP: c.23.1.1 PDB: 1sd5_A Back     alignment and structure
>3eul_A Possible nitrate/nitrite response transcriptional regulatory protein NARL (DNA-binding...; central beta strand flanked by alpha helices; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>1qkk_A DCTD, C4-dicarboxylate transport transcriptional regulatory protein; receiver domain, 2-component signal transduction; 1.7A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1l5z_A 1l5y_A Back     alignment and structure
>3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A Back     alignment and structure
>2qxy_A Response regulator; regulation of transcription, NYSGXRC, protein structure initiative II (PSI II), structural genomics; 1.95A {Thermotoga maritima} Back     alignment and structure
>1mvo_A PHOP response regulator; phosphate regulon, transcriptional regulatory protein, alpha/beta doubly wound fold, phosphorylation; 1.60A {Bacillus subtilis} SCOP: c.23.1.1 Back     alignment and structure
>3f6c_A Positive transcription regulator EVGA; structural genomics, PSI-2, protein structure initiative, PO transcription regulator EVGA; 1.45A {Escherichia coli k-12} Back     alignment and structure
>3kcn_A Adenylate cyclase homolog; SGX, PSI 2, structural genomics, protein structure initiative; 2.45A {Rhodopirellula baltica} Back     alignment and structure
>3grc_A Sensor protein, kinase; protein structure initiative II(PSI II), NYSGXRC, 11025B, structural genomics; 2.21A {Polaromonas SP} Back     alignment and structure
>1a04_A Nitrate/nitrite response regulator protein NARL; signal transduction protein, response regulators, two- component systems; 2.20A {Escherichia coli} SCOP: a.4.6.2 c.23.1.1 PDB: 1rnl_A Back     alignment and structure
>2qr3_A Two-component system response regulator; structural genomics, signal receiver, PSI-2, protein structu initiative; 1.80A {Bacteroides fragilis} Back     alignment and structure
>3h5i_A Response regulator/sensory box protein/ggdef domain protein; structural genomics, transcription, PSI-2; 1.90A {Carboxydothermus hydrogenoformans z-2901} Back     alignment and structure
>3n53_A Response regulator receiver modulated diguanylate; diguanylate cyclase, protein structure I II(PSI II), NYSGXRC, structural genomics; 2.20A {Pelobacter carbinolicus} SCOP: c.23.1.0 Back     alignment and structure
>1p2f_A Response regulator; DRRB, OMPR/PHOB, transcription; HET: MSE; 1.80A {Thermotoga maritima} SCOP: a.4.6.1 c.23.1.1 PDB: 3nns_A* Back     alignment and structure
>3q9s_A DNA-binding response regulator; DNA binding protein; 2.40A {Deinococcus radiodurans} Back     alignment and structure
>1dc7_A NTRC, nitrogen regulation protein; receiver domain, phosphorylation, signal transduction, conformational rearrangement; NMR {Salmonella typhimurium} SCOP: c.23.1.1 PDB: 1j56_A 1krw_A 1krx_A 1ntr_A 1dc8_A* Back     alignment and structure
>3bre_A Probable two-component response regulator; protein-nucleotide complex, signaling protein; HET: C2E; 2.40A {Pseudomonas aeruginosa} PDB: 3i5a_A* Back     alignment and structure
>3i42_A Response regulator receiver domain protein (CHEY- like); structural genomics, PSI-2, protein structure initiative; 2.15A {Methylobacillus flagellatus KT} SCOP: c.23.1.0 Back     alignment and structure
>1yio_A Response regulatory protein; transcription regulation, DNA binding protein; 2.20A {Pseudomonas fluorescens} SCOP: a.4.6.2 c.23.1.1 PDB: 1zn2_A Back     alignment and structure
>2qvg_A Two component response regulator; NYSGXRC, PSI-2, structural genomics, protein structure initiative; 1.50A {Legionella pneumophila subsp} Back     alignment and structure
>3cz5_A Two-component response regulator, LUXR family; structural genomics, protein structure initiative; 2.70A {Aurantimonas SP} Back     alignment and structure
>2jk1_A HUPR, hydrogenase transcriptional regulatory protein HU; nucleotide-binding, transcription regulation; 2.10A {Rhodobacter capsulatus} PDB: 2vui_B 2vuh_B Back     alignment and structure
>2rjn_A Response regulator receiver:metal-dependent phosphohydrolase, HD subdomain; structural genomics, oceanospirillum SP. MED92; 2.10A {Neptuniibacter caesariensis} Back     alignment and structure
>3nhm_A Response regulator; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.19A {Myxococcus xanthus} Back     alignment and structure
>2qsj_A DNA-binding response regulator, LUXR family; structural genomics, PSI-2, protein structure initiative; 2.10A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>1kgs_A DRRD, DNA binding response regulator D; DNA-binding protein, ALPH-beta sandwich, winged-helix, helix helix, DNA binding protein; HET: DNA MSE; 1.50A {Thermotoga maritima} SCOP: a.4.6.1 c.23.1.1 PDB: 3nnn_A* Back     alignment and structure
>3lte_A Response regulator; structural genomics, PSI, protein structure initiative, NYSG YORK structural genomix research consortium, nysgxrc; 2.00A {Bermanella marisrubri} Back     alignment and structure
>3eq2_A Probable two-component response regulator; adaptor sigmas, signaling protein; 3.40A {Pseudomonas aeruginosa} PDB: 3f7a_A Back     alignment and structure
>2hqr_A Putative transcriptional regulator; phosporylation-independent response regulator, H. pylori, SY dimer, signaling protein; NMR {Helicobacter pylori} Back     alignment and structure
>1w25_A Stalked-cell differentiation controlling protein; two-component system, ggdef domain, cyclic dinucleotide, cyclic-digmp; HET: C2E; 2.70A {Caulobacter vibrioides} SCOP: c.23.1.1 c.23.1.1 d.58.29.2 PDB: 2v0n_A* 2wb4_A* Back     alignment and structure
>2qv0_A Protein MRKE; structural genomics, transcription, PSI-2, protein structure initiative; 2.40A {Klebsiella pneumoniae} Back     alignment and structure
>1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* Back     alignment and structure
>2oqr_A Sensory transduction protein REGX3; response regulator, winged-helix-turn-helix, DNA-binding, 3D swapping, two component system; 2.03A {Mycobacterium tuberculosis H37RV} Back     alignment and structure
>3eqz_A Response regulator; structural genomics, unknown function, PSI-2, protein struct initiative; 2.15A {Colwellia psychrerythraea} SCOP: c.23.1.0 Back     alignment and structure
>3cg4_A Response regulator receiver domain protein (CHEY-; structural genomics, unknown function; HET: MSE; 1.61A {Methanospirillum hungatei jf-1} Back     alignment and structure
>3c3w_A Two component transcriptional regulatory protein; response regulator, two-component regulatory system, DNA-BIN protein; 2.20A {Mycobacterium tuberculosis} Back     alignment and structure
>3klo_A Transcriptional regulator VPST; REC domain, HTH domain, DNA-binding, transcription regulation; HET: C2E TAR; 2.80A {Vibrio cholerae} PDB: 3kln_A* Back     alignment and structure
>2gkg_A Response regulator homolog; social motility, receiver domain, signalling, high resolutio signaling protein; 1.00A {Myxococcus xanthus} PDB: 2i6f_A 2nt4_A 2nt3_A Back     alignment and structure
>1ys7_A Transcriptional regulatory protein PRRA; response regulator, DNA binding domain, phosphorylation; 1.58A {Mycobacterium tuberculosis} SCOP: a.4.6.1 c.23.1.1 PDB: 1ys6_A Back     alignment and structure
>2gwr_A DNA-binding response regulator MTRA; two-component regulatory system, transcription regulation, phosphorylation, OMPR family; 2.10A {Mycobacterium tuberculosis} PDB: 3nhz_A Back     alignment and structure
>3sy8_A ROCR; TIM barrel phosphodiesterase-A, transcription regulator; HET: EPE; 2.50A {Pseudomonas aeruginosa} Back     alignment and structure
>3kyj_B CHEY6 protein, putative histidine protein kinase; protein-protein interaction, histidine kinase, response regulator, phosphorylation; 1.40A {Rhodobacter sphaeroides} PDB: 3kyi_B* Back     alignment and structure
>3c3m_A Response regulator receiver protein; structural genomics, unknown function, PSI-2, protein struct initiative; HET: MSE; 1.70A {Methanoculleus marisnigri JR1} Back     alignment and structure
>2rdm_A Response regulator receiver protein; structural genomics, unknown function, PSI-2, protein struct initiative; HET: MSE; 1.76A {Sinorhizobium medicae} Back     alignment and structure
>3a10_A Response regulator; phosphoacceptor, signaling protein; HET: MSE PG4; 1.63A {Thermotoga maritima} PDB: 3a0r_B* 3a0u_A* Back     alignment and structure
>3luf_A Two-component system response regulator/ggdef domain protein; structural genomics, ASA_2441, PSI-2, protein structure initiative; HET: MSE; 1.76A {Aeromonas salmonicida} PDB: 3mf4_A* Back     alignment and structure
>2lpm_A Two-component response regulator; transcription regulator; NMR {Sinorhizobium meliloti} Back     alignment and structure
>2j48_A Two-component sensor kinase; pseudo-receiver, circadian clock, transferase, response regulator, histidine protein kinase; NMR {Synechococcus elongatus} Back     alignment and structure
>1a2o_A CHEB methylesterase; bacterial chemotaxis, adaptation, serine hydrolase; 2.40A {Salmonella typhimurium} SCOP: c.23.1.1 c.40.1.1 Back     alignment and structure
>3t8y_A CHEB, chemotaxis response regulator protein-glutamate methylesterase; CHEA, hydrolase; 1.90A {Thermotoga maritima} Back     alignment and structure
>2pln_A HP1043, response regulator; signaling protein; 1.80A {Helicobacter pylori} PDB: 2hqo_A Back     alignment and structure
>3c97_A Signal transduction histidine kinase; structural genomics, signaling, PSI-2, protein structure initiative; 1.70A {Aspergillus oryzae RIB40} Back     alignment and structure
>3cwo_X Beta/alpha-barrel protein based on 1THF and 1TMY; XRAY, CHEY, HISF, half barrel, de novo protein; 3.10A {Thermotoga maritima} PDB: 2lle_A Back     alignment and structure
>3ogk_Q JAZ1 incomplete degron peptide; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} Back     alignment and structure
>1w25_A Stalked-cell differentiation controlling protein; two-component system, ggdef domain, cyclic dinucleotide, cyclic-digmp; HET: C2E; 2.70A {Caulobacter vibrioides} SCOP: c.23.1.1 c.23.1.1 d.58.29.2 PDB: 2v0n_A* 2wb4_A* Back     alignment and structure
>2vyc_A Biodegradative arginine decarboxylase; pyridoxal phosphate, PLP-dependent E lyase, acid resistance; HET: LLP; 2.4A {Escherichia coli} Back     alignment and structure
>2b4a_A BH3024; flavodoxin-like fold, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.42A {Bacillus halodurans} SCOP: c.23.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 491
d1jbea_128 c.23.1.1 (A:) CheY protein {Escherichia coli [TaxI 7e-06
d2a9pa1117 c.23.1.1 (A:2-118) DNA-binding response regulator 7e-06
d1zesa1121 c.23.1.1 (A:3-123) PhoB receiver domain {Escherich 8e-06
d1k66a_149 c.23.1.1 (A:) Response regulator for cyanobacteria 8e-06
d1k68a_140 c.23.1.1 (A:) Response regulator for cyanobacteria 1e-05
d1zh2a1119 c.23.1.1 (A:2-120) Transcriptional regulatory prot 1e-05
d1ys7a2121 c.23.1.1 (A:7-127) Transcriptional regulatory prot 2e-05
d2pl1a1119 c.23.1.1 (A:1-119) PhoP receiver domain {Escherich 3e-05
d1mb3a_123 c.23.1.1 (A:) Cell division response regulator Div 3e-05
d1kgsa2122 c.23.1.1 (A:2-123) PhoB receiver domain {Thermotog 4e-05
d1dz3a_123 c.23.1.1 (A:) Sporulation response regulator Spo0A 4e-05
d1xhfa1121 c.23.1.1 (A:2-122) Aerobic respiration control pro 5e-05
d1mvoa_121 c.23.1.1 (A:) PhoP receiver domain {Bacillus subti 5e-05
d1zgza1120 c.23.1.1 (A:2-121) TorCAD operon transcriptional r 5e-05
d1ny5a1137 c.23.1.1 (A:1-137) Transcriptional activator sigm5 7e-05
d1dcfa_134 c.23.1.2 (A:) Receiver domain of the ethylene rece 7e-05
d1i3ca_144 c.23.1.1 (A:) Response regulator for cyanobacteria 1e-04
d1p2fa2120 c.23.1.1 (A:1-120) Response regulator DrrB {Thermo 1e-04
d1p6qa_129 c.23.1.1 (A:) CheY protein {Sinorhizobium meliloti 1e-04
d2ayxa1133 c.23.1.1 (A:817-949) Sensor kinase protein RcsC, C 2e-04
d1dbwa_123 c.23.1.1 (A:) Transcriptional regulatory protein F 2e-04
d1krwa_123 c.23.1.1 (A:) NTRC receiver domain {Salmonella typ 2e-04
d1yioa2128 c.23.1.1 (A:3-130) Response regulatory protein Sty 2e-04
d1a04a2138 c.23.1.1 (A:5-142) Nitrate/nitrite response regula 3e-04
d2r25b1128 c.23.1.1 (B:1087-1214) Response regulator Sin1 {Ba 3e-04
d1qkka_140 c.23.1.1 (A:) Transcriptional regulatory protein D 6e-04
d1u0sy_118 c.23.1.1 (Y:) CheY protein {Thermotoga maritima [T 6e-04
d1w25a1139 c.23.1.1 (A:2-140) Response regulator PleD, receiv 7e-04
d1peya_119 c.23.1.1 (A:) Sporulation response regulator Spo0F 0.001
d1w25a2153 c.23.1.1 (A:141-293) Response regulator PleD, rece 0.001
>d1jbea_ c.23.1.1 (A:) CheY protein {Escherichia coli [TaxId: 562]} Length = 128 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Flavodoxin-like
superfamily: CheY-like
family: CheY-related
domain: CheY protein
species: Escherichia coli [TaxId: 562]
 Score = 43.4 bits (102), Expect = 7e-06
 Identities = 7/41 (17%), Positives = 17/41 (41%)

Query: 1   MSSQDSVSTVYKCMMRGAADYLVKPVRRNELRNLWQHVWRR 41
           ++++     +      GA+ Y+VKP     L      ++ +
Sbjct: 85  VTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEK 125


>d2a9pa1 c.23.1.1 (A:2-118) DNA-binding response regulator MicA, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Length = 117 Back     information, alignment and structure
>d1zesa1 c.23.1.1 (A:3-123) PhoB receiver domain {Escherichia coli [TaxId: 562]} Length = 121 Back     information, alignment and structure
>d1k66a_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Calothrix sp. pcc 7601, RcpB [TaxId: 1188]} Length = 149 Back     information, alignment and structure
>d1k68a_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Calothrix sp. pcc 7601, RcpA [TaxId: 1188]} Length = 140 Back     information, alignment and structure
>d1zh2a1 c.23.1.1 (A:2-120) Transcriptional regulatory protein KdpE, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 119 Back     information, alignment and structure
>d1ys7a2 c.23.1.1 (A:7-127) Transcriptional regulatory protein PrrA, N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 121 Back     information, alignment and structure
>d2pl1a1 c.23.1.1 (A:1-119) PhoP receiver domain {Escherichia coli [TaxId: 562]} Length = 119 Back     information, alignment and structure
>d1mb3a_ c.23.1.1 (A:) Cell division response regulator DivK {Caulobacter crescentus [TaxId: 155892]} Length = 123 Back     information, alignment and structure
>d1kgsa2 c.23.1.1 (A:2-123) PhoB receiver domain {Thermotoga maritima [TaxId: 2336]} Length = 122 Back     information, alignment and structure
>d1dz3a_ c.23.1.1 (A:) Sporulation response regulator Spo0A {Bacillus stearothermophilus [TaxId: 1422]} Length = 123 Back     information, alignment and structure
>d1xhfa1 c.23.1.1 (A:2-122) Aerobic respiration control protein ArcA, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 121 Back     information, alignment and structure
>d1mvoa_ c.23.1.1 (A:) PhoP receiver domain {Bacillus subtilis [TaxId: 1423]} Length = 121 Back     information, alignment and structure
>d1zgza1 c.23.1.1 (A:2-121) TorCAD operon transcriptional regulator TorD, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 120 Back     information, alignment and structure
>d1ny5a1 c.23.1.1 (A:1-137) Transcriptional activator sigm54 (NtrC1), N-terminal domain {Aquifex aeolicus [TaxId: 63363]} Length = 137 Back     information, alignment and structure
>d1dcfa_ c.23.1.2 (A:) Receiver domain of the ethylene receptor {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 134 Back     information, alignment and structure
>d1i3ca_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Synechocystis sp. PCC 6803, RCP1 [TaxId: 1148]} Length = 144 Back     information, alignment and structure
>d1p2fa2 c.23.1.1 (A:1-120) Response regulator DrrB {Thermotoga maritima [TaxId: 2336]} Length = 120 Back     information, alignment and structure
>d1p6qa_ c.23.1.1 (A:) CheY protein {Sinorhizobium meliloti, CheY2 [TaxId: 382]} Length = 129 Back     information, alignment and structure
>d2ayxa1 c.23.1.1 (A:817-949) Sensor kinase protein RcsC, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 133 Back     information, alignment and structure
>d1dbwa_ c.23.1.1 (A:) Transcriptional regulatory protein FixJ, receiver domain {Rhizobium meliloti [TaxId: 382]} Length = 123 Back     information, alignment and structure
>d1krwa_ c.23.1.1 (A:) NTRC receiver domain {Salmonella typhimurium [TaxId: 90371]} Length = 123 Back     information, alignment and structure
>d1yioa2 c.23.1.1 (A:3-130) Response regulatory protein StyR, N-terminal domain {Pseudomonas fluorescens [TaxId: 294]} Length = 128 Back     information, alignment and structure
>d1a04a2 c.23.1.1 (A:5-142) Nitrate/nitrite response regulator (NarL), receiver domain {Escherichia coli [TaxId: 562]} Length = 138 Back     information, alignment and structure
>d2r25b1 c.23.1.1 (B:1087-1214) Response regulator Sin1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 128 Back     information, alignment and structure
>d1qkka_ c.23.1.1 (A:) Transcriptional regulatory protein DctD, receiver domain {Sinorhizobium meliloti [TaxId: 382]} Length = 140 Back     information, alignment and structure
>d1u0sy_ c.23.1.1 (Y:) CheY protein {Thermotoga maritima [TaxId: 2336]} Length = 118 Back     information, alignment and structure
>d1w25a1 c.23.1.1 (A:2-140) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} Length = 139 Back     information, alignment and structure
>d1peya_ c.23.1.1 (A:) Sporulation response regulator Spo0F {Bacillus subtilis [TaxId: 1423]} Length = 119 Back     information, alignment and structure
>d1w25a2 c.23.1.1 (A:141-293) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} Length = 153 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query491
d1qkka_140 Transcriptional regulatory protein DctD, receiver 98.24
d1zh2a1119 Transcriptional regulatory protein KdpE, N-termina 98.22
d2pl1a1119 PhoP receiver domain {Escherichia coli [TaxId: 562 98.22
d1xhfa1121 Aerobic respiration control protein ArcA, N-termin 98.2
d1p2fa2120 Response regulator DrrB {Thermotoga maritima [TaxI 98.18
d1zgza1120 TorCAD operon transcriptional regulator TorD, N-te 98.16
d1krwa_123 NTRC receiver domain {Salmonella typhimurium [TaxI 98.16
d1ny5a1137 Transcriptional activator sigm54 (NtrC1), N-termin 98.15
d1qo0d_189 Positive regulator of the amidase operon AmiR {Pse 98.12
d2a9pa1117 DNA-binding response regulator MicA, N-terminal do 98.12
d1zesa1121 PhoB receiver domain {Escherichia coli [TaxId: 562 98.12
d1kgsa2122 PhoB receiver domain {Thermotoga maritima [TaxId: 98.11
d1dbwa_123 Transcriptional regulatory protein FixJ, receiver 98.09
d1w25a1139 Response regulator PleD, receiver domain {Caulobac 98.05
d1jbea_128 CheY protein {Escherichia coli [TaxId: 562]} 98.04
d1mvoa_121 PhoP receiver domain {Bacillus subtilis [TaxId: 14 98.0
d1dz3a_123 Sporulation response regulator Spo0A {Bacillus ste 97.97
d1ys7a2121 Transcriptional regulatory protein PrrA, N-termina 97.95
d1peya_119 Sporulation response regulator Spo0F {Bacillus sub 97.94
d1s8na_190 Probable two-component system transcriptional regu 97.93
d2ayxa1133 Sensor kinase protein RcsC, C-terminal domain {Esc 97.93
d1yioa2128 Response regulatory protein StyR, N-terminal domai 97.93
d1w25a2153 Response regulator PleD, receiver domain {Caulobac 97.92
d1p6qa_129 CheY protein {Sinorhizobium meliloti, CheY2 [TaxId 97.89
d1i3ca_144 Response regulator for cyanobacterial phytochrome 97.84
d1k68a_140 Response regulator for cyanobacterial phytochrome 97.8
d2r25b1128 Response regulator Sin1 {Baker's yeast (Saccharomy 97.76
d1a04a2138 Nitrate/nitrite response regulator (NarL), receive 97.74
d1k66a_149 Response regulator for cyanobacterial phytochrome 97.73
d1dcfa_134 Receiver domain of the ethylene receptor {Thale cr 97.6
d1mb3a_123 Cell division response regulator DivK {Caulobacter 97.59
d1a2oa1140 Methylesterase CheB, N-terminal domain {Salmonella 95.83
d2b4aa1118 Hypothetical protein BH3024 {Bacillus halodurans [ 93.19
>d1qkka_ c.23.1.1 (A:) Transcriptional regulatory protein DctD, receiver domain {Sinorhizobium meliloti [TaxId: 382]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Flavodoxin-like
superfamily: CheY-like
family: CheY-related
domain: Transcriptional regulatory protein DctD, receiver domain
species: Sinorhizobium meliloti [TaxId: 382]
Probab=98.24  E-value=4.1e-07  Score=78.11  Aligned_cols=42  Identities=14%  Similarity=0.332  Sum_probs=39.6

Q ss_pred             CCCcchHHHHHHHHHhccceeEeCCCCHHHHHHHHHHHHHHH
Q 011192            1 MSSQDSVSTVYKCMMRGAADYLVKPVRRNELRNLWQHVWRRQ   42 (491)
Q Consensus         1 MS~~d~~e~v~kal~~GA~DYLlKPv~~eELk~lwqhv~rk~   42 (491)
                      ||++++++++.+|++.||.|||+|||+.++|...+++++++.
T Consensus        78 lT~~~~~~~~~~a~~~Ga~dyl~KP~~~~~L~~~i~~~~~~~  119 (140)
T d1qkka_          78 VTGHGDIPMAVQAIQDGAYDFIAKPFAADRLVQSARRAEEKR  119 (140)
T ss_dssp             EECGGGHHHHHHHHHTTCCEEEESSCCHHHHHHHHHHHHHHH
T ss_pred             EECCCCHHHHHHHHHcCCCEeecCCCCHHHHHHHHHHHHHHH
Confidence            689999999999999999999999999999999999987665



>d1zh2a1 c.23.1.1 (A:2-120) Transcriptional regulatory protein KdpE, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pl1a1 c.23.1.1 (A:1-119) PhoP receiver domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xhfa1 c.23.1.1 (A:2-122) Aerobic respiration control protein ArcA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p2fa2 c.23.1.1 (A:1-120) Response regulator DrrB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1zgza1 c.23.1.1 (A:2-121) TorCAD operon transcriptional regulator TorD, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1krwa_ c.23.1.1 (A:) NTRC receiver domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ny5a1 c.23.1.1 (A:1-137) Transcriptional activator sigm54 (NtrC1), N-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1qo0d_ c.23.1.3 (D:) Positive regulator of the amidase operon AmiR {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2a9pa1 c.23.1.1 (A:2-118) DNA-binding response regulator MicA, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1zesa1 c.23.1.1 (A:3-123) PhoB receiver domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kgsa2 c.23.1.1 (A:2-123) PhoB receiver domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1dbwa_ c.23.1.1 (A:) Transcriptional regulatory protein FixJ, receiver domain {Rhizobium meliloti [TaxId: 382]} Back     information, alignment and structure
>d1w25a1 c.23.1.1 (A:2-140) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} Back     information, alignment and structure
>d1jbea_ c.23.1.1 (A:) CheY protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mvoa_ c.23.1.1 (A:) PhoP receiver domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1dz3a_ c.23.1.1 (A:) Sporulation response regulator Spo0A {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ys7a2 c.23.1.1 (A:7-127) Transcriptional regulatory protein PrrA, N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1peya_ c.23.1.1 (A:) Sporulation response regulator Spo0F {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1s8na_ c.23.1.1 (A:) Probable two-component system transcriptional regulator Rv1626 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ayxa1 c.23.1.1 (A:817-949) Sensor kinase protein RcsC, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yioa2 c.23.1.1 (A:3-130) Response regulatory protein StyR, N-terminal domain {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1w25a2 c.23.1.1 (A:141-293) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} Back     information, alignment and structure
>d1p6qa_ c.23.1.1 (A:) CheY protein {Sinorhizobium meliloti, CheY2 [TaxId: 382]} Back     information, alignment and structure
>d1i3ca_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Synechocystis sp. PCC 6803, RCP1 [TaxId: 1148]} Back     information, alignment and structure
>d1k68a_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Calothrix sp. pcc 7601, RcpA [TaxId: 1188]} Back     information, alignment and structure
>d2r25b1 c.23.1.1 (B:1087-1214) Response regulator Sin1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a04a2 c.23.1.1 (A:5-142) Nitrate/nitrite response regulator (NarL), receiver domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1k66a_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Calothrix sp. pcc 7601, RcpB [TaxId: 1188]} Back     information, alignment and structure
>d1dcfa_ c.23.1.2 (A:) Receiver domain of the ethylene receptor {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1mb3a_ c.23.1.1 (A:) Cell division response regulator DivK {Caulobacter crescentus [TaxId: 155892]} Back     information, alignment and structure
>d1a2oa1 c.23.1.1 (A:1-140) Methylesterase CheB, N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2b4aa1 c.23.1.1 (A:2-119) Hypothetical protein BH3024 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure