Citrus Sinensis ID: 011233

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490
MTELRTLKFYGSENKCMVSSLEGVPLTEVRYFEWHQFPLETLNINGENLVSLKMPGRKVKQLWNDVRNLVNLKYIDLSHSESLTKLPDLSLARNLEILDLGSCSSLTETHSSIQYLNKLEVLDLRHCESLGSLPTSIHSKYIEELDFVGCSKLKNHPAISSSLIPLLSLIKVGIKELPSSIECLSKLDRLSIQDCTRLENISSSIFKLKSLQYIEIKRCSNLKSLESLPNNLCMFKSLASLEIINCPKLERLPDELGNSKALEELRVEGAAIRERLPESLGQLALLCELKMIKCSSFESLPSSLCMLKYLTSLAIIDCKNFKRLPNELGNLKCLVVLIVKGTAIREVPESLGQLSSIVRLDLSNNNLERTPASLYQLSSIKYLKLFDNNFKHRLLTLSVDLNLVPNVLSEIINDRWRKLSFHVKVGSRVCISLGMKFQSGLGIKHFQFQTALGRKVWRMTGNATCLMCSVIGNSNPKDFFTLIFWGKLVL
cccccEEEEcccccccccccccccccccccEEEcccccccccccccccccEEEccccccccccccccccccccEEEccccccccccccccccccccEEEcccccccccccccHHccccccEEEccccccccccccccccccccEEEccccccccccccccccccccccccccccEEccccccccccccEEEEccccccccccccccccccccEEEccccccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccEEccccccccccccEEEcccccccccccccccccccccEEEccccccccccccccccccccEEEccccccccccHHHHccccccEEEccccccccccccccccccccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccccccccccccEEEEEEccEEcc
ccccEEEEEccccccccccccccccHHHccEEEccccccccccccHHHcEEEEccccccccccHHHcccccccEEEccccccccccccHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHcccccccEEEcccccccccccHHHHHHHHHHcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEccccccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEccccccccccHHHcccccccEEEccccccccccHHHcccccccEEEccccccccccccccHHHcccHHHHHEEHccccccccccccccccccHHccccHccEEEcccccccccccHHHHccHHHHHHHHHHcccccccHHHHHHHHccEEEc
mtelrtlkfygsenkcmvsslegvpltevryfewhqfpletlningenlvslkmpgrkVKQLWNDVRNLVNLKYidlshsesltklpdlslarnleildlgscssltetHSSIQYLNklevldlrhceslgslptsihSKYIEELDfvgcsklknhpaisssliPLLSLIKVGIkelpssieclskldrlsiqdctrlENISSSIFKLKSLQYIEIKRCsnlksleslpnnlcmfkslasleiincpklerlpdelgnsKALEELRVEGAAIRERLPESLGQLALLCELkmikcssfeslpssLCMLKYLTSLaiidcknfkrlpnelgnLKCLVVLIVKGtairevpeslgqLSSIVRldlsnnnlertpaslyQLSSIKYLKLFDNNFKHRLLTLSVDLNLVPNVLSEIINDRWRKLSFHVKVGSRVCISLGMkfqsglgikHFQFQTALGRKVWRMTGNATCLMCSvignsnpkdfFTLIFWGKLVL
mtelrtlkfygsenkcmvSSLEGVPLTEVRYFEWHQFPLETLNINGENLVSLKMPGRKVKQLWNDVRNLVNLKYIDLSHSESLTKLPDLSLARNLEILDLGSCSSLTETHSSIQYLNKLEVLDLRHCESLGSLPTSIHSKYIEELDFVGCSKLKNHPAISSSLIPLLSLIKVGIKELPSSIECLSKLDRLSIQDCTRLENIsssifklkslqYIEIKRCSNLKSLESLPNNLCMFKSLASLEIINCPKLERLPDELGNSKALEELRVEGAAIRERLPESLGQLALLCELKMIKCSSFESLPSSLCMLKYLTSLAIIDCKNFKRLPNELGNLKCLVVLIVKGTAIrevpeslgqlsSIVRLDLSNNNLERTPASLYQLSSIKYLKLFDNNFKHRLLTLSVDLNLVPNVLSEIINDRWRKLSFHVKVGSRVCISLGMKFQSGLGIKHFQFQTALGRKVWRMTGNATCLMCSVignsnpkdfFTLIFWGKLVL
MTELRTLKFYGSENKCMVSSLEGVPLTEVRYFEWHQFPLETLNINGENLVSLKMPGRKVKQLWNDVRNLVNLKYIDLSHSESLTKLPDLSLARNLEILDLGSCSSLTETHSSIQYLNKLEVLDLRHCESLGSLPTSIHSKYIEELDFVGCSKLKNHPAissslipllsliKVGIKELPSSIECLSKLDRLSIQDCTRLENISSSIFKLKSLQYIEIKRCSNLKSLESLPNNLCMFKSLASLEIINCPKLERLPDELGNSKALEELRVEGAAIRERLPESLGQLALLCELKMIKCSSFESLPSSLCMLKYLTSLAIIDCKNFKRLPNELGNLKCLVVLIVKGTAIREVPESLGQLSSIVRLDLSNNNLERTPASLYQLSSIKYLKLFDNNFKHRLLTLSVDLNLVPNVLSEIINDRWRKLSFHVKVGSRVCISLGMKFQSGLGIKHFQFQTALGRKVWRMTGNATCLMCSVIGNSNPKDFFTLIFWGKLVL
******LKFYGSENKCMVSSLEGVPLTEVRYFEWHQFPLETLNINGENLVSLKMPGRKVKQLWNDVRNLVNLKYIDLSHSESLTKLPDLSLARNLEILDLGSCSSLTETHSSIQYLNKLEVLDLRHCESLGSLPTSIHSKYIEELDFVGCSKLKNHPAISSSLIPLLSLIKVGIKELPSSIECLSKLDRLSIQDCTRLENISSSIFKLKSLQYIEIKRCSNLKSLESLPNNLCMFKSLASLEIINCPKLERLP********LEELRVEGAAIRERLPESLGQLALLCELKMIKCSSFESLPSSLCMLKYLTSLAIIDCKNFKRLPNELGNLKCLVVLIVKGTAIREVPESLGQLSSIVRLDLSNNNLERTPASLYQLSSIKYLKLFDNNFKHRLLTLSVDLNLVPNVLSEIINDRWRKLSFHVKVGSRVCISLGMKFQSGLGIKHFQFQTALGRKVWRMTGNATCLMCSVIGNSNPKDFFTLIFWGKLV*
MTELRTLKFYGSENKCMVSSLEGVPLTEVRYFEWHQFPLETLNINGENLVSLKMPGRKVKQLWNDVRNLVNLKYIDLSHSESLTKLPDLSLARNLEILDLGSCSSLTETHSSIQYLNKLEVLDLRHCESLGSLPTSIHSKYIEELDFVGCSKLKNHPAISSSLIPLLSLIKVGIKELPSSIECLSKLDRLSIQDCTRLENISSSIFKLKSLQYIEIKRCSNLKSLESLPNNLCMFKSLASLEIINCPKLERLPDELGNSKALEELRVEGAAIRERLPESLGQLALLCELKMIKCSSFESLPSSLCMLKYLTSLAIIDCKNFKRLPNELGNLKCLVVLIVKGTAIREVPESLGQLSSIVRLDLSNNNLERTPASLYQLSSIKYLKLFDNNFKHRLLTLSVDLNLVPNVLSEIINDRWRKLSF**********SLGMKFQSGLGIKHFQFQTALGRKVWRMTGNATCLMCSVIGNSNPKDFFTLIFWGKLVL
MTELRTLKFYGSENKCMVSSLEGVPLTEVRYFEWHQFPLETLNINGENLVSLKMPGRKVKQLWNDVRNLVNLKYIDLSHSESLTKLPDLSLARNLEILDLGSCSSLTETHSSIQYLNKLEVLDLRHCESLGSLPTSIHSKYIEELDFVGCSKLKNHPAISSSLIPLLSLIKVGIKELPSSIECLSKLDRLSIQDCTRLENISSSIFKLKSLQYIEIKRCSNLKSLESLPNNLCMFKSLASLEIINCPKLERLPDELGNSKALEELRVEGAAIRERLPESLGQLALLCELKMIKCSSFESLPSSLCMLKYLTSLAIIDCKNFKRLPNELGNLKCLVVLIVKGTAIREVPESLGQLSSIVRLDLSNNNLERTPASLYQLSSIKYLKLFDNNFKHRLLTLSVDLNLVPNVLSEIINDRWRKLSFHVKVGSRVCISLGMKFQSGLGIKHFQFQTALGRKVWRMTGNATCLMCSVIGNSNPKDFFTLIFWGKLVL
*TELRTLKFYGSENKCMVSSLEGVPLTEVRYFEWHQFPLETLNINGENLVSLKMPGRKVKQLWNDVRNLVNLKYIDLSHSESLTKLPDLSLARNLEILDLGSCSSLTETHSSIQYLNKLEVLDLRHCESLGSLPTSIHSKYIEELDFVGCSKLKNHPAISSSLIPLLSLIKVGIKELPSSIECLSKLDRLSIQDCTRLENISSSIFKLKSLQYIEIKRCSNLKSLESLPNNLCMFKSLASLEIINCPKLERLPDELGNSKALEELRVEGAAIRERLPESLGQLALLCELKMIKCSSFESLPSSLCMLKYLTSLAIIDCKNFKRLPNELGNLKCLVVLIVKGTAIREVPESLGQLSSIVRLDLSNNNLERTPASLYQLSSIKYLKLFDNNFKHRLLTLSVDLNLVPNVLSEIINDRWRKLSFHVKVGSRVCISLGMKFQSGLGIKHFQFQTALGRKVWRMTGNATCLMCSVIGNSNPKDFFTLIFWGKLVL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTELRTLKFYGSENKCMVSSLEGVPLTEVRYFEWHQFPLETLNINGENLVSLKMPGRKVKQLWNDVRNLVNLKYIDLSHSESLTKLPDLSLARNLEILDLGSCSSLTETHSSIQYLNKLEVLDLRHCESLGSLPTSIHSKYIEELDFVGCSKLKNHPAISSSLIPLLSLIKVGIKELPSSIECLSKLDRLSIQDCTRLENISSSIFKLKSLQYIEIKRCSNLKSLESLPNNLCMFKSLASLEIINCPKLERLPDELGNSKALEELRVEGAAIRERLPESLGQLALLCELKMIKCSSFESLPSSLCMLKYLTSLAIIDCKNFKRLPNELGNLKCLVVLIVKGTAIREVPESLGQLSSIVRLDLSNNNLERTPASLYQLSSIKYLKLFDNNFKHRLLTLSVDLNLVPNVLSEIINDRWRKLSFHVKVGSRVCISLGMKFQSGLGIKHFQFQTALGRKVWRMTGNATCLMCSVIGNSNPKDFFTLIFWGKLVL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query490 2.2.26 [Sep-21-2011]
O23530 1301 Protein SUPPRESSOR OF npr no no 0.655 0.246 0.338 9e-35
Q9SZ67 1895 Probable WRKY transcripti no no 0.530 0.137 0.365 1e-26
Q40392 1144 TMV resistance protein N N/A no 0.604 0.258 0.310 2e-25
O825001095 Putative disease resistan no no 0.512 0.229 0.344 2e-25
Q9FH83 1288 Probable WRKY transcripti no no 0.632 0.240 0.302 1e-18
Q9FL92 1372 Probable WRKY transcripti no no 0.528 0.188 0.304 1e-18
Q7KRY7 1851 Protein lap4 OS=Drosophil no no 0.653 0.172 0.292 4e-18
Q9FKN7 1613 Protein DA1-related 4 OS= no no 0.575 0.174 0.307 5e-18
Q96NW7 1537 Leucine-rich repeat-conta yes no 0.642 0.204 0.276 1e-14
P70587 1490 Leucine-rich repeat-conta yes no 0.640 0.210 0.276 3e-14
>sp|O23530|SNC1_ARATH Protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1 OS=Arabidopsis thaliana GN=SNC1 PE=1 SV=3 Back     alignment and function desciption
 Score =  148 bits (373), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 116/343 (33%), Positives = 191/343 (55%), Gaps = 22/343 (6%)

Query: 47   ENLVSLKMPGRKVKQLWNDVRNLVNLKYIDLSHSESLTKLPDLSLARNLEILDLGSCSSL 106
            E L  L + G K ++LW  +++L +L+ +DLS SE+LT++PDLS A  LE L L +C SL
Sbjct: 750  EQLAFLNVRGYKHEKLWEGIQSLGSLEGMDLSESENLTEIPDLSKATKLESLILNNCKSL 809

Query: 107  TETHSSIQYLNKLEVLDLRHCESLGSLPTSIHSKYIEELDFVGCSKLKNHPAISSSLIPL 166
                S+I  L++L  L+++ C  L  LPT ++   +E LD  GCS L++ P IS++++  
Sbjct: 810  VTLPSTIGNLHRLVRLEMKECTGLEVLPTDVNLSSLETLDLSGCSSLRSFPLISTNIV-W 868

Query: 167  LSLIKVGIKELPSSIECLSKLDRLSIQDCTRLENISSSIFKLKSLQYIEIKRCSNLKSLE 226
            L L    I+E+PS+I  L +L RL ++ CT LE + + +  L SL+ +++  CS+L+S  
Sbjct: 869  LYLENTAIEEIPSTIGNLHRLVRLEMKKCTGLEVLPTDV-NLSSLETLDLSGCSSLRSFP 927

Query: 227  SLPNNLCMFKSLASLEIINCPKLERLPDELGNSKALEELRVEGAAIRERLPESLGQLALL 286
             +       +S+  L + N   +E +PD L  +  L+ L++        LP ++G L  L
Sbjct: 928  LIS------ESIKWLYLENT-AIEEIPD-LSKATNLKNLKLNNCKSLVTLPTTIGNLQKL 979

Query: 287  CELKMIKCSSFESLPSSLCMLKYLTSLAIID---CKNFKRLPNELGNLKCLVVLIVKGTA 343
               +M +C+  E LP  +     L+SL I+D   C + +  P    N   +V L ++ TA
Sbjct: 980  VSFEMKECTGLEVLPIDV----NLSSLMILDLSGCSSLRTFPLISTN---IVWLYLENTA 1032

Query: 344  IREVPESLGQLSSIVRLDLSN-NNLERTPASLYQLSSIKYLKL 385
            I E+P ++G L  +V+L++     LE  P  +  LSS+  L L
Sbjct: 1033 IEEIPSTIGNLHRLVKLEMKECTGLEVLPTDV-NLSSLMILDL 1074
Disease resistance protein of the TIR-NB-LRR-type. Part of the RPP5 locus that contains a cluster of several paralogous disease resistance (R) genes. Resistance proteins guard the plant against pathogens that contain an appropriate avirulence protein via an indirect interaction with this avirulence protein. That triggers a defense system including the hypersensitive response, which restricts the pathogen growth. Regulated by RNA silencing. Expression regulated by MOS1 at chromatin level. Negatively regulated at the transcript level by BON1.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9SZ67|WRK19_ARATH Probable WRKY transcription factor 19 OS=Arabidopsis thaliana GN=WRKY19 PE=2 SV=1 Back     alignment and function description
>sp|Q40392|TMVRN_NICGU TMV resistance protein N OS=Nicotiana glutinosa GN=N PE=1 SV=1 Back     alignment and function description
>sp|O82500|Y4117_ARATH Putative disease resistance protein At4g11170 OS=Arabidopsis thaliana GN=At4g11170 PE=2 SV=1 Back     alignment and function description
>sp|Q9FH83|WRK52_ARATH Probable WRKY transcription factor 52 OS=Arabidopsis thaliana GN=WRKY52 PE=2 SV=3 Back     alignment and function description
>sp|Q9FL92|WRK16_ARATH Probable WRKY transcription factor 16 OS=Arabidopsis thaliana GN=WRKY16 PE=2 SV=1 Back     alignment and function description
>sp|Q7KRY7|LAP4_DROME Protein lap4 OS=Drosophila melanogaster GN=scrib PE=1 SV=1 Back     alignment and function description
>sp|Q9FKN7|DAR4_ARATH Protein DA1-related 4 OS=Arabidopsis thaliana GN=DAR4 PE=1 SV=2 Back     alignment and function description
>sp|Q96NW7|LRRC7_HUMAN Leucine-rich repeat-containing protein 7 OS=Homo sapiens GN=LRRC7 PE=1 SV=1 Back     alignment and function description
>sp|P70587|LRRC7_RAT Leucine-rich repeat-containing protein 7 OS=Rattus norvegicus GN=Lrrc7 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query490
224145030 1435 tir-nbs-lrr resistance protein [Populus 0.779 0.266 0.351 2e-53
224127917 1470 tir-nbs-lrr resistance protein [Populus 0.775 0.258 0.354 7e-52
224145016 1254 tir-nbs-lrr resistance protein [Populus 0.773 0.302 0.372 2e-51
255555349 1109 leucine-rich repeat containing protein, 0.651 0.287 0.399 1e-50
224145021 1561 tir-nbs-lrr resistance protein [Populus 0.781 0.245 0.337 3e-50
147802252 1441 hypothetical protein VITISV_020931 [Viti 0.781 0.265 0.349 9e-50
359489175 1254 PREDICTED: TMV resistance protein N-like 0.761 0.297 0.336 5e-48
451798988 1219 TMV resistance protein N-like protein 6 0.628 0.252 0.385 9e-48
255544956 1403 leucine-rich repeat containing protein, 0.757 0.264 0.373 6e-47
359486120 1218 PREDICTED: TMV resistance protein N-like 0.722 0.290 0.344 2e-46
>gi|224145030|ref|XP_002325501.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222862376|gb|EEE99882.1| tir-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  216 bits (551), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 171/486 (35%), Positives = 243/486 (50%), Gaps = 104/486 (21%)

Query: 1    MTELRTLKFYGSE--NKCMV---SSLEGVPLTEVRYFEWHQFPLETL--NINGENLVSLK 53
            M  LR LK Y S   +KC V   S LE +   E+RY  W  +PL +L  N   +NLV L 
Sbjct: 565  MYNLRLLKIYNSAAGDKCTVHLPSGLESLS-HELRYLHWDGYPLTSLPCNFRPQNLVELN 623

Query: 54   MPGRKVKQLWNDVRNLVNLKYIDLSHSESLTKLPDLSLARNLEILDLGSCSSLTETHSSI 113
            +   KVKQLW   +NL NLK ++LS+ E +T LPDLS ARNLE L+L  C SL +  SSI
Sbjct: 624  LSSSKVKQLWRGDQNLGNLKDVNLSNCEHITFLPDLSKARNLERLNLQFCKSLVKFPSSI 683

Query: 114  QYLNKLEVLDLRHCESLGSLPTSIHSKYIEELDFVGCSKLKNHPAISSSLIPLLSLIKVG 173
            Q+L+KL  LDLR C+ L +LP+ I+S  +E L+  GC+ LK  P  +  L   L+L +  
Sbjct: 684  QHLDKLVDLDLRGCKRLINLPSRINSSCLETLNLSGCANLKKCPETAGKLT-YLNLNETA 742

Query: 174  IKELPSSIECLSKLDRLSIQDCTRLENISSSIFKLKSLQYIEIKRCS------------- 220
            ++ELP SI  LS L  L++++C  + N+  +I+ LKSL  ++I  CS             
Sbjct: 743  VEELPQSIGELSGLVTLNLKNCKLVLNLPENIYLLKSLLIVDISGCSSISRFPDFSWNIR 802

Query: 221  ----NLKSLESLPNNLCMFKSLASLEIINCPKLERLPDELGN------------------ 258
                N  ++E LP+++   + L  L+++ C +L+ LP  +                    
Sbjct: 803  YLYLNGTAIEELPSSIGGLRELIYLDLVGCNRLKNLPSAVSKLGCLEKLDLSGCSSITEF 862

Query: 259  ---SKALEELRVEGAAIRERLPESLGQLALLCELKMIKCSSFESLPSSLCMLKYLTSLAI 315
               S+ + EL ++G AIRE +P S+  L  L EL +  C  FE LPSS+C LK L  L +
Sbjct: 863  PKVSRNIRELYLDGTAIRE-IPSSIECLCELNELHLRNCKQFEILPSSICKLKKLRRLNL 921

Query: 316  IDCKNFK-----------------------RLPNELGNLK-------------------- 332
              C  F+                       +LP+ +GNLK                    
Sbjct: 922  SGCLQFRDFPEVLEPMVCLRYLYLEQTRITKLPSPIGNLKGLACLEVGNCKYLEDIHCFV 981

Query: 333  -------------CLVVLIVKGTAIREVPESLGQLSSIVRLDLSNNNLERTPASLYQLSS 379
                         CL  L + G ++ EVP+SLG LSS+  LDLS NNL   P S+ +L  
Sbjct: 982  GLQLSKRHRVDLDCLRKLNLDGCSLSEVPDSLGLLSSLEVLDLSGNNLRTIPISINKLFE 1041

Query: 380  IKYLKL 385
            ++YL L
Sbjct: 1042 LQYLGL 1047

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224127917|ref|XP_002329209.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222870990|gb|EEF08121.1| tir-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224145016|ref|XP_002325496.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222862371|gb|EEE99877.1| tir-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255555349|ref|XP_002518711.1| leucine-rich repeat containing protein, putative [Ricinus communis] gi|223542092|gb|EEF43636.1| leucine-rich repeat containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224145021|ref|XP_002325498.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222862373|gb|EEE99879.1| tir-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147802252|emb|CAN68265.1| hypothetical protein VITISV_020931 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359489175|ref|XP_002264704.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|451798988|gb|AGF69192.1| TMV resistance protein N-like protein 6 [Vitis labrusca] Back     alignment and taxonomy information
>gi|255544956|ref|XP_002513539.1| leucine-rich repeat containing protein, putative [Ricinus communis] gi|223547447|gb|EEF48942.1| leucine-rich repeat containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|359486120|ref|XP_003633392.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query490
TAIR|locus:2175991 1294 AT5G17680 [Arabidopsis thalian 0.775 0.293 0.321 5.6e-42
TAIR|locus:2053405 1215 AT2G14080 [Arabidopsis thalian 0.722 0.291 0.334 2.7e-38
TAIR|locus:2094498 1981 AT3G25510 [Arabidopsis thalian 0.755 0.186 0.317 2.6e-37
TAIR|locus:2129236 1301 SNC1 "SUPPRESSOR OF NPR1-1, CO 0.655 0.246 0.332 5.9e-37
TAIR|locus:2118106 1219 AT4G12010 [Arabidopsis thalian 0.777 0.312 0.305 7.9e-36
TAIR|locus:21479921189 AT5G11250 [Arabidopsis thalian 0.742 0.306 0.323 1.1e-34
TAIR|locus:2205804 1556 AT1G27180 [Arabidopsis thalian 0.771 0.242 0.3 4.7e-34
TAIR|locus:2118116 1895 WRKY19 [Arabidopsis thaliana ( 0.528 0.136 0.360 9.2e-33
TAIR|locus:2153072 1229 AT5G51630 [Arabidopsis thalian 0.836 0.333 0.281 1.3e-32
TAIR|locus:21515061127 RPS6 "RESISTANT TO P. SYRINGAE 0.585 0.254 0.322 1.8e-32
TAIR|locus:2175991 AT5G17680 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 457 (165.9 bits), Expect = 5.6e-42, P = 5.6e-42
 Identities = 128/398 (32%), Positives = 201/398 (50%)

Query:     1 MTELRTLKFY-----GSENKCMVSSLEGVPLTEVRYFEWHQFPLETL--NINGENLVSLK 53
             ++ L+ L FY     G     + + L  +P  ++RY  W  +PL+T+      E LV L 
Sbjct:   550 LSNLKLLNFYDLSFDGETRVHLPNGLSYLP-RKLRYLRWDGYPLKTMPSRFFPEFLVELC 608

Query:    54 MPGRKVKQLWNDVRNLVNLKYIDLSHSESLTKLPDLSLARNLEILDLGSCSSLTETHSSI 113
             M    +++LW+ ++ L NLK +DLS  + L ++PDLS A NLE L+L  C SL E   SI
Sbjct:   609 MSNSNLEKLWDGIQPLRNLKKMDLSRCKYLVEVPDLSKATNLEELNLSYCQSLVEVTPSI 668

Query:   114 QYLNKLEVLDLRHCESLGSLPTSIHSKYIEELDFVGCSKLKNHPAXXXXXXXXXXXXKVG 173
             + L  L    L +C  L  +P  I  K +E +   GCS LK+ P                
Sbjct:   669 KNLKGLSCFYLTNCIQLKDIPIGIILKSLETVGMSGCSSLKHFPEISWNTRRLYLSS-TK 727

Query:   174 IKELPSSIECLSKLDRLSIQDCTRLENISSSIFKLKSLQYIEIKRCSNLKSLESLPNNLC 233
             I+ELPSSI  LS L +L + DC RL  + S +  L SL+ + +  C   + LE+LP+ L 
Sbjct:   728 IEELPSSISRLSCLVKLDMSDCQRLRTLPSYLGHLVSLKSLNLDGC---RRLENLPDTLQ 784

Query:   234 MFKSLASLEIINCPKLERLPDELGNSKALEELRVEGAAIRERLPESLGQLALLCELKMIK 293
                SL +LE+  C  +   P     S ++E LR+   +I E +P  +  L+ L  L + +
Sbjct:   785 NLTSLETLEVSGCLNVNEFPRV---STSIEVLRISETSIEE-IPARICNLSQLRSLDISE 840

Query:   294 CSSFESLPSSLCMLKYLTSLAIIDCKNFKRLPNEL-GNLKCLVVLIVKGTAIREVPESLG 352
                  SLP S+  L+ L  L +  C   +  P E+   + CL    +  T+I+E+PE++G
Sbjct:   841 NKRLASLPVSISELRSLEKLKLSGCSVLESFPLEICQTMSCLRWFDLDRTSIKELPENIG 900

Query:   353 QLSSIVRLDLSNNNLERTPASLYQLSSIKYLKLFDNNF 390
              L ++  L  S   + R P S+ +L+ ++ L +  N+F
Sbjct:   901 NLVALEVLQASRTVIRRAPWSIARLTRLQVLAI-GNSF 937
GO:0005622 "intracellular" evidence=IEA
GO:0006952 "defense response" evidence=IEA;ISS
GO:0007165 "signal transduction" evidence=IEA
GO:0043531 "ADP binding" evidence=IEA
TAIR|locus:2053405 AT2G14080 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2094498 AT3G25510 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2129236 SNC1 "SUPPRESSOR OF NPR1-1, CONSTITUTIVE 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2118106 AT4G12010 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2147992 AT5G11250 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2205804 AT1G27180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2118116 WRKY19 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2153072 AT5G51630 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2151506 RPS6 "RESISTANT TO P. SYRINGAE 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.00190624
tir-nbs-lrr resistance protein (1436 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query490
PLN032101153 PLN03210, PLN03210, Resistant to P 2e-48
PLN032101153 PLN03210, PLN03210, Resistant to P 8e-23
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 9e-07
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 6e-06
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-05
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-05
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-05
PLN03210 1153 PLN03210, PLN03210, Resistant to P 4e-04
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 9e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 9e-04
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information 
 Score =  178 bits (454), Expect = 2e-48
 Identities = 115/323 (35%), Positives = 174/323 (53%), Gaps = 41/323 (12%)

Query: 28  EVRYFEWHQFPLETL--NINGENLVSLKMPGRKVKQLWNDVRNLVNLKYIDLSHSESLTK 85
           ++R   W ++PL  +  N   ENLV L+M G K+++LW+ V +L  L+ IDL  S++L +
Sbjct: 590 KLRLLRWDKYPLRCMPSNFRPENLVKLQMQGSKLEKLWDGVHSLTGLRNIDLRGSKNLKE 649

Query: 86  LPDLSLARNLEILDLGSCSSLTETHSSIQYLNKLEVLDLRHCESLGSLPTSIHSKYIEEL 145
           +PDLS+A NLE L L  CSSL E  SSIQYLNKLE LD+  CE+L  LPT I+ K +  L
Sbjct: 650 IPDLSMATNLETLKLSDCSSLVELPSSIQYLNKLEDLDMSRCENLEILPTGINLKSLYRL 709

Query: 146 DFVGCSKLKNHPAISSSLIPLLSLIKVGIKELPSSIE---------CLSK---------- 186
           +  GCS+LK+ P IS++ I  L L +  I+E PS++          C  K          
Sbjct: 710 NLSGCSRLKSFPDISTN-ISWLDLDETAIEEFPSNLRLENLDELILCEMKSEKLWERVQP 768

Query: 187 -----------LDRLSIQDCTRLENISSSIFKLKSLQYIEIKRCSNLKSLESLPNNLCMF 235
                      L RL + D   L  + SSI  L  L+++EI+ C NL++L +  N     
Sbjct: 769 LTPLMTMLSPSLTRLFLSDIPSLVELPSSIQNLHKLEHLEIENCINLETLPTGIN----L 824

Query: 236 KSLASLEIINCPKLERLPDELGNSKALEELRVEGAAIRERLPESLGQLALLCELKMIKCS 295
           +SL SL++  C +L   PD    S  + +L +    I E +P  + + + L  L M  C+
Sbjct: 825 ESLESLDLSGCSRLRTFPDI---STNISDLNLSRTGI-EEVPWWIEKFSNLSFLDMNGCN 880

Query: 296 SFESLPSSLCMLKYLTSLAIIDC 318
           + + +  ++  LK+L ++   DC
Sbjct: 881 NLQRVSLNISKLKHLETVDFSDC 903

syringae 6; Provisional. Length = 1153
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 490
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.97
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.97
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.97
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.97
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.96
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.95
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.94
PLN032101153 Resistant to P. syringae 6; Provisional 99.92
KOG4237498 consensus Extracellular matrix protein slit, conta 99.87
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.85
KOG4237498 consensus Extracellular matrix protein slit, conta 99.82
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.82
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.79
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.78
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.75
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.72
KOG0617264 consensus Ras suppressor protein (contains leucine 99.65
KOG0617264 consensus Ras suppressor protein (contains leucine 99.56
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.24
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.21
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.18
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.17
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.17
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.16
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.12
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.12
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.09
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.05
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.03
PLN03150623 hypothetical protein; Provisional 99.02
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.99
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.96
PLN03150623 hypothetical protein; Provisional 98.94
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.9
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.83
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.75
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.71
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.69
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.61
KOG4341483 consensus F-box protein containing LRR [General fu 98.53
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.48
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.39
KOG4341483 consensus F-box protein containing LRR [General fu 98.38
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.35
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.24
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.24
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.19
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.12
PRK15386 426 type III secretion protein GogB; Provisional 98.01
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 98.01
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.01
PRK15386426 type III secretion protein GogB; Provisional 97.99
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.94
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.94
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.9
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.87
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.81
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.75
KOG2123388 consensus Uncharacterized conserved protein [Funct 97.52
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.35
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.25
KOG2123388 consensus Uncharacterized conserved protein [Funct 97.25
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.08
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.0
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.82
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.66
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.88
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.84
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 95.26
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.37
KOG4308478 consensus LRR-containing protein [Function unknown 93.84
KOG4308478 consensus LRR-containing protein [Function unknown 93.47
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 93.37
smart0037026 LRR Leucine-rich repeats, outliers. 93.37
KOG0473 326 consensus Leucine-rich repeat protein [Function un 92.65
KOG0473326 consensus Leucine-rich repeat protein [Function un 91.09
KOG3864221 consensus Uncharacterized conserved protein [Funct 89.43
smart0037026 LRR Leucine-rich repeats, outliers. 87.92
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 87.92
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 87.84
KOG3864221 consensus Uncharacterized conserved protein [Funct 86.96
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 81.36
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=1.5e-46  Score=417.06  Aligned_cols=440  Identities=20%  Similarity=0.246  Sum_probs=207.6

Q ss_pred             CCCccceeeecccccccc--ccCCCCccEEEcCCCCccc-ccccccCCCCCCEEecCCCCCCCCCC-CcccCCCCcEEec
Q 011233           25 PLTEVRYFEWHQFPLETL--NINGENLVSLKMPGRKVKQ-LWNDVRNLVNLKYIDLSHSESLTKLP-DLSLARNLEILDL  100 (490)
Q Consensus        25 ~~~~L~~L~l~~~~l~~l--~~~~~~L~~L~Ls~n~i~~-l~~~~~~l~~L~~L~Ls~n~~~~~~~-~~~~l~~L~~L~L  100 (490)
                      .+++|++|++++|.+.+.  ...+++|++|++++|.+.+ +|..++++++|++|++++|.+.+.+| .++++++|++|++
T Consensus       116 ~l~~L~~L~Ls~n~l~~~~p~~~l~~L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L  195 (968)
T PLN00113        116 TSSSLRYLNLSNNNFTGSIPRGSIPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTL  195 (968)
T ss_pred             cCCCCCEEECcCCccccccCccccCCCCEEECcCCcccccCChHHhcCCCCCEEECccCcccccCChhhhhCcCCCeeec
Confidence            344455555554444433  2334445555555554442 34445555555555555555444444 4455555555555


Q ss_pred             CCCCCCcccchhhhccccCcEEEccCCCCCCcCCcccc-cCCccEEeecCCCCCCCCcccccchhhhhhhhh---ccC-C
Q 011233          101 GSCSSLTETHSSIQYLNKLEVLDLRHCESLGSLPTSIH-SKYIEELDFVGCSKLKNHPAISSSLIPLLSLIK---VGI-K  175 (490)
Q Consensus       101 ~~n~~~~~~~~~l~~l~~L~~L~Ls~n~~~~~~p~~~~-l~~L~~L~ls~n~~~~~~~~~~~~~~~~L~~~~---~~~-~  175 (490)
                      ++|.+.+.+|..++++++|++|++++|.+.+.+|..+. +++|++|++++|.+.+..|..+..+. .|+.++   +.+ +
T Consensus       196 ~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~-~L~~L~L~~n~l~~  274 (968)
T PLN00113        196 ASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLK-NLQYLFLYQNKLSG  274 (968)
T ss_pred             cCCCCcCcCChHHcCcCCccEEECcCCccCCcCChhHhcCCCCCEEECcCceeccccChhHhCCC-CCCEEECcCCeeec
Confidence            55555555555555555555555555554444554444 55555555555554444444443333 333222   222 2


Q ss_pred             cCCccccccccCcEEEeccCCCcccccccccCCCCCCEEecccCCCCCCCCCCCcccccCCCCcEEEccCCCCCCccCcc
Q 011233          176 ELPSSIECLSKLDRLSIQDCTRLENISSSIFKLKSLQYIEIKRCSNLKSLESLPNNLCMFKSLASLEIINCPKLERLPDE  255 (490)
Q Consensus       176 ~lp~~~~~l~~L~~L~L~~n~~~~~~~~~~~~l~~L~~L~L~~~n~l~~~~~l~~~~~~l~~L~~L~l~~n~~~~~~p~~  255 (490)
                      .+|.++..+++|++|++++|.+.+.+|..+.++++|++|++++ |.+.  +.+|..+..+++|+.|++++|.+.+.+|..
T Consensus       275 ~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~l~~-n~~~--~~~~~~~~~l~~L~~L~L~~n~l~~~~p~~  351 (968)
T PLN00113        275 PIPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFS-NNFT--GKIPVALTSLPRLQVLQLWSNKFSGEIPKN  351 (968)
T ss_pred             cCchhHhhccCcCEEECcCCeeccCCChhHcCCCCCcEEECCC-CccC--CcCChhHhcCCCCCEEECcCCCCcCcCChH
Confidence            3344444455555555555554444444445555555555554 3443  344444445555555555555554445544


Q ss_pred             ccCccccceeEccCccccccchhhHhhccccccccccccccccccCccccCccccceeecccccccccCCcccCCccccc
Q 011233          256 LGNSKALEELRVEGAAIRERLPESLGQLALLCELKMIKCSSFESLPSSLCMLKYLTSLAIIDCKNFKRLPNELGNLKCLV  335 (490)
Q Consensus       256 ~~~l~~L~~L~ls~n~l~~~~~~~~~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~Ls~n~~~~~~~~~~~~l~~L~  335 (490)
                      ++.+++|+.|++++|++++.+|.++..+++|+.|++++|.+.+.+|..+..+++|+.|++++|++.+.+|..+..++.|+
T Consensus       352 l~~~~~L~~L~Ls~n~l~~~~p~~~~~~~~L~~L~l~~n~l~~~~p~~~~~~~~L~~L~L~~n~l~~~~p~~~~~l~~L~  431 (968)
T PLN00113        352 LGKHNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGELPSEFTKLPLVY  431 (968)
T ss_pred             HhCCCCCcEEECCCCeeEeeCChhHhCcCCCCEEECcCCEecccCCHHHhCCCCCCEEECcCCEeeeECChhHhcCCCCC
Confidence            45555555555555555444444444444455555554444444444444445555555555554444444444555555


Q ss_pred             eeeccCccccc-CCccccCCCCCCEEeCcCCCCCC-CchhhhccCCCCEEecCCCCCcccc----------ccccccccC
Q 011233          336 VLIVKGTAIRE-VPESLGQLSSIVRLDLSNNNLER-TPASLYQLSSIKYLKLFDNNFKHRL----------LTLSVDLNL  403 (490)
Q Consensus       336 ~L~L~~n~l~~-~p~~~~~l~~L~~L~Ls~n~l~~-l~~~l~~l~~L~~L~ls~n~~~~~l----------~~l~~~~n~  403 (490)
                      .|++++|.+++ +|..+..+++|+.|++++|++.+ +|.. ...++|+.|++++|++.+.+          ..++++.| 
T Consensus       432 ~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~n~~~~~~p~~-~~~~~L~~L~ls~n~l~~~~~~~~~~l~~L~~L~Ls~N-  509 (968)
T PLN00113        432 FLDISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLPDS-FGSKRLENLDLSRNQFSGAVPRKLGSLSELMQLKLSEN-  509 (968)
T ss_pred             EEECcCCcccCccChhhccCCCCcEEECcCceeeeecCcc-cccccceEEECcCCccCCccChhhhhhhccCEEECcCC-
Confidence            55555555444 33344444444444444444442 2321 22344444555444443222          12233332 


Q ss_pred             Ccccchhhhhhhhccc--------cceeeecCeeeeccchhhhcccccceeeeEeccccccccccccceeeeecccccc
Q 011233          404 VPNVLSEIINDRWRKL--------SFHVKVGSRVCISLGMKFQSGLGIKHFQFQTALGRKVWRMTGNATCLMCSVIGNS  474 (490)
Q Consensus       404 ~~~~~~~~~~~~~~~~--------~~~~~~~~~~~~~~~~~~~~~l~ls~n~~~~~~p~~~~~~~~~~~~l~~s~~~~~  474 (490)
                         .+.+.++..+...        +.+...+..+.....++.++.||+++|+++|.+|..+.. ...+++++++.+...
T Consensus       510 ---~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~-l~~L~~l~ls~N~l~  584 (968)
T PLN00113        510 ---KLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNLGN-VESLVQVNISHNHLH  584 (968)
T ss_pred             ---cceeeCChHHcCccCCCEEECCCCcccccCChhHhCcccCCEEECCCCcccccCChhHhc-CcccCEEeccCCcce
Confidence               2222222222111        001111111122233556677777777777777776533 456777777755443

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query490
4fcg_A328 Structure Of The Leucine-Rich Repeat Domain Of The 3e-08
>pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328 Back     alignment and structure 
Iteration: 1

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 52/218 (23%), Positives = 84/218 (38%), Gaps = 39/218 (17%)
Query: 172 VGIKELPSSIECLSKLDRLSIQDCTRLENISSSIFKLKSLQYIEIKRCSNLKSLESLPNN 231
           V + + P     LS L   +I D   L  +  +  +   L+ + + R      L +LP +
Sbjct: 91  VPLPQFPDQAFRLSHLQHXTI-DAAGLXELPDTXQQFAGLETLTLAR----NPLRALPAS 145
Query: 232 LCMFKSLASLEIINCPKLERLPDELGNSKA---------LEELRVEGAAIRERLPESLG- 281
           +     L  L I  CP+L  LP+ L ++ A         L+ LR+E   IR  LP S+  
Sbjct: 146 IASLNRLRELSIRACPELTELPEPLASTDASGEHQGLVNLQSLRLEWTGIRS-LPASIAN 204
Query: 282 ----------------------QLALLCELKMIKCSSFESLPSSLCMLKYLTSLAIIDCK 319
                                  L  L EL +  C++  + P        L  L + DC 
Sbjct: 205 LQNLKSLKIRNSPLSALGPAIHHLPKLEELDLRGCTALRNYPPIFGGRAPLKRLILKDCS 264
Query: 320 NFKRLPNELGNLKCLVVLIVKG-TAIREVPESLGQLSS 356
           N   LP ++  L  L  L ++G   +  +P  + QL +
Sbjct: 265 NLLTLPLDIHRLTQLEKLDLRGCVNLSRLPSLIAQLPA 302

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query490
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-45
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-41
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-36
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-33
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-16
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-24
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-14
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-23
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-22
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 8e-18
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-23
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-17
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-13
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 9e-10
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-07
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-22
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-19
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-19
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-18
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-17
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-15
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-15
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-17
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-17
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-16
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-14
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-09
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 3e-17
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-17
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-13
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-11
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-10
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 9e-16
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-14
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-14
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 6e-12
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-08
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-15
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-14
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-13
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-06
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-15
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-14
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-13
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-11
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-15
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-13
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-13
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-12
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-09
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-15
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-06
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-05
1o6v_A466 Internalin A; bacterial infection, extracellular r 9e-15
1o6v_A466 Internalin A; bacterial infection, extracellular r 9e-15
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-11
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-14
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-08
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-05
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-14
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-14
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-11
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-13
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-12
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-11
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-13
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-10
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-13
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-12
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-08
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-12
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-11
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-09
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-12
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-08
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-06
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-12
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-12
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-11
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-09
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-08
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-08
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-09
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-05
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-09
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-05
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 8e-09
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-05
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 9e-09
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-08
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-06
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 5e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-08
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-06
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 6e-08
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 9e-08
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-05
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-04
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 9e-08
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 8e-07
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-06
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-07
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 4e-07
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 6e-07
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-07
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-07
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-04
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 3e-07
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 6e-06
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-07
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 6e-07
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-06
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-04
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 7e-07
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 7e-05
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-06
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-04
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 1e-06
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-06
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-06
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-06
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-05
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-04
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-06
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 7e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 8e-04
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-05
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-04
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 6e-04
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 6e-04
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 6e-04
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
 Score =  158 bits (403), Expect = 7e-45
 Identities = 68/321 (21%), Positives = 120/321 (37%), Gaps = 26/321 (8%)

Query: 92  ARNLEILDLGSCSSLTETHSSIQYLNKLEVLDLRHCESLGSLPTSIHSKYIEELDFVGCS 151
           +   E L     ++L   H  +    +    D     S      S +     +++     
Sbjct: 11  SSGRENLYFQGSTALRPYHDVLSQWQRHYNADRNRWHSAWRQANSNN----PQIETRTGR 66

Query: 152 KLKNHPAISSSLIPL----LSLIKVGIKELPSSIECLSKLDRLSIQDCTRLENISSSIFK 207
            LK    +           L L  V + + P     LS L  ++I     L  +  ++ +
Sbjct: 67  ALKATADLLEDATQPGRVALELRSVPLPQFPDQAFRLSHLQHMTIDAA-GLMELPDTMQQ 125

Query: 208 LKSLQYIEIKRCSNLKSLESLPNNLCMFKSLASLEIINCPKLERLPDELGNSKA------ 261
              L+ + + R      L +LP ++     L  L I  CP+L  LP+ L ++ A      
Sbjct: 126 FAGLETLTLARNP----LRALPASIASLNRLRELSIRACPELTELPEPLASTDASGEHQG 181

Query: 262 ---LEELRVEGAAIRERLPESLGQLALLCELKMIKCSSFESLPSSLCMLKYLTSLAIIDC 318
              L+ LR+E   IR  LP S+  L  L  LK+       +L  ++  L  L  L +  C
Sbjct: 182 LVNLQSLRLEWTGIRS-LPASIANLQNLKSLKIRNSP-LSALGPAIHHLPKLEELDLRGC 239

Query: 319 KNFKRLPNELGNLKCLVVLIVKG-TAIREVPESLGQLSSIVRLDLSNN-NLERTPASLYQ 376
              +  P   G    L  LI+K  + +  +P  + +L+ + +LDL    NL R P+ + Q
Sbjct: 240 TALRNYPPIFGGRAPLKRLILKDCSNLLTLPLDIHRLTQLEKLDLRGCVNLSRLPSLIAQ 299

Query: 377 LSSIKYLKLFDNNFKHRLLTL 397
           L +   + +  +         
Sbjct: 300 LPANCIILVPPHLQAQLDQHR 320
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query490
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 100.0
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.98
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.98
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.98
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.98
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.96
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.96
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.95
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.95
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.95
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.95
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.95
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.94
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.94
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.94
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.94
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.94
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.94
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.94
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.94
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.93
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.93
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.93
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.93
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.93
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.92
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.92
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.92
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.91
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.9
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.9
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.9
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.9
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.9
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.9
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.89
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.89
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.89
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.88
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.88
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.87
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.87
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.87
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.87
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.86
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.86
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.86
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.86
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.85
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.85
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.82
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.82
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.81
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.81
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.8
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.79
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.78
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.77
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.77
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.77
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.76
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.75
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.74
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.74
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.74
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.73
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.73
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.73
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.72
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.71
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.71
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.68
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.68
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.68
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.67
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.66
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.66
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.65
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.64
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.63
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.62
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.61
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.6
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.6
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.58
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.58
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.56
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.56
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.56
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.52
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.51
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.51
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.49
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.49
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.45
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.44
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.42
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.36
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.35
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.34
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.33
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.27
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.26
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.14
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.11
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.11
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.08
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.06
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.92
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.9
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.8
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.52
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.35
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.3
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.25
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.19
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.83
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.28
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.11
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.67
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.53
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=3.2e-50  Score=434.37  Aligned_cols=347  Identities=22%  Similarity=0.304  Sum_probs=256.2

Q ss_pred             CCCCccEEEcCCCCcccccccccCCCCCCEEecCCCCCCCCCCCcccCCCCcEEecCCCCCCcccchhhhccccCcEEEc
Q 011233           45 NGENLVSLKMPGRKVKQLWNDVRNLVNLKYIDLSHSESLTKLPDLSLARNLEILDLGSCSSLTETHSSIQYLNKLEVLDL  124 (490)
Q Consensus        45 ~~~~L~~L~Ls~n~i~~l~~~~~~l~~L~~L~Ls~n~~~~~~~~~~~l~~L~~L~L~~n~~~~~~~~~l~~l~~L~~L~L  124 (490)
                      .+++|++|++++|.+.+.. .+..+++|++|++++|.+.+.+|.++.+++|++|++++|.+.+.+|..++++++|++|++
T Consensus       176 ~l~~L~~L~Ls~n~l~~~~-~~~~l~~L~~L~Ls~n~l~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~l~~l~~L~~L~L  254 (768)
T 3rgz_A          176 GCGELKHLAISGNKISGDV-DVSRCVNLEFLDVSSNNFSTGIPFLGDCSALQHLDISGNKLSGDFSRAISTCTELKLLNI  254 (768)
T ss_dssp             CCTTCCEEECCSSEEESCC-BCTTCTTCCEEECCSSCCCSCCCBCTTCCSCCEEECCSSCCCSCHHHHTTTCSSCCEEEC
T ss_pred             cCCCCCEEECCCCcccccC-CcccCCcCCEEECcCCcCCCCCcccccCCCCCEEECcCCcCCCcccHHHhcCCCCCEEEC
Confidence            3444444444444444322 125678888888888888777778888899999999998888888888888999999999


Q ss_pred             cCCCCCCcCCcccccCCccEEeecCCCCCCCCcccccchhhhhhhhh---ccCC-cCCccccccccCcEEEeccCCCccc
Q 011233          125 RHCESLGSLPTSIHSKYIEELDFVGCSKLKNHPAISSSLIPLLSLIK---VGIK-ELPSSIECLSKLDRLSIQDCTRLEN  200 (490)
Q Consensus       125 s~n~~~~~~p~~~~l~~L~~L~ls~n~~~~~~~~~~~~~~~~L~~~~---~~~~-~lp~~~~~l~~L~~L~L~~n~~~~~  200 (490)
                      ++|.+.+.+|.. .+++|++|++++|.+.+.+|..+....+.|+.++   +.+. .+|..++.+++|++|++++|.+.+.
T Consensus       255 s~n~l~~~~~~~-~l~~L~~L~L~~n~l~~~ip~~~~~~~~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~  333 (768)
T 3rgz_A          255 SSNQFVGPIPPL-PLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGE  333 (768)
T ss_dssp             CSSCCEESCCCC-CCTTCCEEECCSSEEEESCCCCSCTTCTTCSEEECCSSEEEECCCGGGGGCTTCCEEECCSSEEEEE
T ss_pred             CCCcccCccCcc-ccCCCCEEECcCCccCCccCHHHHhhcCcCCEEECcCCcCCCccchHHhcCCCccEEECCCCcccCc
Confidence            888877766665 6778888888888877777776655433555554   3333 5667778888888888888877777


Q ss_pred             cccc-ccCCCCCCEEecccCCCCCCCCCCCccccc---------------------------CCCCcEEEccCCCCCCcc
Q 011233          201 ISSS-IFKLKSLQYIEIKRCSNLKSLESLPNNLCM---------------------------FKSLASLEIINCPKLERL  252 (490)
Q Consensus       201 ~~~~-~~~l~~L~~L~L~~~n~l~~~~~l~~~~~~---------------------------l~~L~~L~l~~n~~~~~~  252 (490)
                      +|.. +..+++|++|++++ |.++  +.+|..+..                           +++|++|++++|.+.+.+
T Consensus       334 ip~~~l~~l~~L~~L~Ls~-n~l~--~~~p~~l~~l~~~L~~L~Ls~N~l~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~  410 (768)
T 3rgz_A          334 LPMDTLLKMRGLKVLDLSF-NEFS--GELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKI  410 (768)
T ss_dssp             CCHHHHTTCTTCCEEECCS-SEEE--ECCCTTHHHHTTTCSEEECCSSEEEEECCTTTTCSTTCCCCEEECCSSEEEEEC
T ss_pred             CCHHHHhcCCCCCEEeCcC-CccC--ccccHHHHhhhcCCcEEEccCCCcCCCcChhhhhcccCCccEEECCCCcccccc
Confidence            7755 77778888888877 5554  345544443                           445555666665555566


Q ss_pred             CccccCccccceeEccCccccccchhhHhhccccccccccccccccccCccccCccccceeecccccccccCCcccCCcc
Q 011233          253 PDELGNSKALEELRVEGAAIRERLPESLGQLALLCELKMIKCSSFESLPSSLCMLKYLTSLAIIDCKNFKRLPNELGNLK  332 (490)
Q Consensus       253 p~~~~~l~~L~~L~ls~n~l~~~~~~~~~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~Ls~n~~~~~~~~~~~~l~  332 (490)
                      |..+..+++|++|++++|++++..|..++.+++|++|++++|.+.+.+|..+..+++|++|++++|++.+.+|.++++++
T Consensus       411 p~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~  490 (768)
T 3rgz_A          411 PPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCT  490 (768)
T ss_dssp             CGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCT
T ss_pred             CHHHhcCCCCCEEECcCCcccCcccHHHhcCCCCCEEECCCCcccCcCCHHHcCCCCceEEEecCCcccCcCCHHHhcCC
Confidence            77777777788888888877777777777778888888888777777777777788888888888887777888888888


Q ss_pred             ccceeeccCccccc-CCccccCCCCCCEEeCcCCCCC-CCchhhhccCCCCEEecCCCCCcccccc
Q 011233          333 CLVVLIVKGTAIRE-VPESLGQLSSIVRLDLSNNNLE-RTPASLYQLSSIKYLKLFDNNFKHRLLT  396 (490)
Q Consensus       333 ~L~~L~L~~n~l~~-~p~~~~~l~~L~~L~Ls~n~l~-~l~~~l~~l~~L~~L~ls~n~~~~~l~~  396 (490)
                      +|++|++++|++++ +|.+++.+++|++|++++|+++ .+|..+..+++|++|++++|++.|.+|.
T Consensus       491 ~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~g~ip~  556 (768)
T 3rgz_A          491 NLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPA  556 (768)
T ss_dssp             TCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEEECCGGGGGCTTCCEEECCSSEEESBCCG
T ss_pred             CCCEEEccCCccCCcCChHHhcCCCCCEEECCCCcccCcCCHHHcCCCCCCEEECCCCccCCcCCh
Confidence            88888888888876 7777888888888888888887 5677788888888888888877665553
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 490
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 6e-09
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-07
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 6e-06
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 6e-05
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 0.001
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.002
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.004
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: Decorin
species: Cow (Bos taurus) [TaxId: 9913]

 Score = 55.0 bits (131), Expect = 6e-09
 Identities = 57/315 (18%), Positives = 108/315 (34%), Gaps = 42/315 (13%)

Query: 79  HSESLTKLPDLSLARNLEILDLGSCSSLTETHSSIQYLNKLEVLDLRHCESLGSLPTSIH 138
               L K+P   L  +  +LDL +           + L  L  L L + +     P +  
Sbjct: 18  SDLGLEKVPK-DLPPDTALLDLQNNKITEIKDGDFKNLKNLHTLILINNKISKISPGA-- 74

Query: 139 SKYIEELDFVGCSKLKNHPAISSSLIPLLSLIKVGIKELPSSIECLSKLDRLSIQDCTRL 198
                   F    KL+            L L K  +KELP  +    +  R+       +
Sbjct: 75  --------FAPLVKLER-----------LYLSKNQLKELPEKMPKTLQELRVH---ENEI 112

Query: 199 ENISSSIFKLKSLQYIEIKRCSNLKSLESLPNNLCMFKSLASLEIINCPKLERLPDELGN 258
             +  S+F   +   +     + LKS           K L+ + I +   +  +P   G 
Sbjct: 113 TKVRKSVFNGLNQMIVVELGTNPLKSSGIENGAFQGMKKLSYIRIADT-NITTIPQ--GL 169

Query: 259 SKALEELRVEGAAIRERLPESLGQLALLCELKMIKCSSFESLPSSLCMLKYLTSLAIIDC 318
             +L EL ++G  I +    SL  L  L +L +   S       SL    +L  L + + 
Sbjct: 170 PPSLTELHLDGNKITKVDAASLKGLNNLAKLGLSFNSISAVDNGSLANTPHLRELHLNNN 229

Query: 319 KNFKRLPNELGNLKCLVVLIVKGTAIREVPES-------LGQLSSIVRLDLSNNNLERTP 371
               ++P  L + K + V+ +    I  +  +         + +S   + L +N ++   
Sbjct: 230 -KLVKVPGGLADHKYIQVVYLHNNNISAIGSNDFCPPGYNTKKASYSGVSLFSNPVQYWE 288

Query: 372 AS------LYQLSSI 380
                   +Y  +++
Sbjct: 289 IQPSTFRCVYVRAAV 303
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query490
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.96
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.96
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.95
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.95
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.93
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.91
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.9
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.89
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.87
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.85
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.85
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.84
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.75
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.75
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.73
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.71
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.71
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.71
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.7
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.69
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.69
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.69
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.65
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.63
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.62
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.57
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.56
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.54
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.49
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.45
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.44
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.44
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.27
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.24
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.22
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.22
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.41
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.4
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.84
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.48
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.44
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.0
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

Probab=99.96  E-value=2e-28  Score=240.40  Aligned_cols=322  Identities=19%  Similarity=0.197  Sum_probs=211.8

Q ss_pred             CCCCccEEEcCCCCcccccccccCCCCCCEEecCCCCCCCCCCCcccCCCCcEEecCCCCCCcccchhhhccccCcEEEc
Q 011233           45 NGENLVSLKMPGRKVKQLWNDVRNLVNLKYIDLSHSESLTKLPDLSLARNLEILDLGSCSSLTETHSSIQYLNKLEVLDL  124 (490)
Q Consensus        45 ~~~~L~~L~Ls~n~i~~l~~~~~~l~~L~~L~Ls~n~~~~~~~~~~~l~~L~~L~L~~n~~~~~~~~~l~~l~~L~~L~L  124 (490)
                      .+.+|++|++++++|+++ +.+..+++|++|++++|++.+ ++.++++++|++|++++|.+.+..  .++++++|+.|++
T Consensus        42 ~l~~l~~L~l~~~~I~~l-~gl~~L~nL~~L~Ls~N~l~~-l~~l~~L~~L~~L~L~~n~i~~i~--~l~~l~~L~~L~~  117 (384)
T d2omza2          42 DLDQVTTLQADRLGIKSI-DGVEYLNNLTQINFSNNQLTD-ITPLKNLTKLVDILMNNNQIADIT--PLANLTNLTGLTL  117 (384)
T ss_dssp             HHTTCCEEECCSSCCCCC-TTGGGCTTCCEEECCSSCCCC-CGGGTTCTTCCEEECCSSCCCCCG--GGTTCTTCCEEEC
T ss_pred             HhCCCCEEECCCCCCCCc-cccccCCCCCEEeCcCCcCCC-CccccCCccccccccccccccccc--ccccccccccccc
Confidence            344555566655555554 344555556666666555332 334555556666666655544332  2455555666665


Q ss_pred             cCCCCCCcCCcccccCCccEEeecCCCCCCCCcc-------------------cccchhh-hhhhhhccCCcCCcccccc
Q 011233          125 RHCESLGSLPTSIHSKYIEELDFVGCSKLKNHPA-------------------ISSSLIP-LLSLIKVGIKELPSSIECL  184 (490)
Q Consensus       125 s~n~~~~~~p~~~~l~~L~~L~ls~n~~~~~~~~-------------------~~~~~~~-~L~~~~~~~~~lp~~~~~l  184 (490)
                      +++... .++.......+.......+.+....+.                   .+..... ...............+..+
T Consensus       118 ~~~~~~-~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l  196 (384)
T d2omza2         118 FNNQIT-DIDPLKNLTNLNRLELSSNTISDISALSGLTSLQQLSFGNQVTDLKPLANLTTLERLDISSNKVSDISVLAKL  196 (384)
T ss_dssp             CSSCCC-CCGGGTTCTTCSEEEEEEEEECCCGGGTTCTTCSEEEEEESCCCCGGGTTCTTCCEEECCSSCCCCCGGGGGC
T ss_pred             cccccc-ccccccccccccccccccccccccccccccccccccccccccchhhhhccccccccccccccccccccccccc
Confidence            555422 222222223333333322211110000                   0000000 0000001122233456778


Q ss_pred             ccCcEEEeccCCCcccccccccCCCCCCEEecccCCCCCCCCCCCcccccCCCCcEEEccCCCCCCccCccccCccccce
Q 011233          185 SKLDRLSIQDCTRLENISSSIFKLKSLQYIEIKRCSNLKSLESLPNNLCMFKSLASLEIINCPKLERLPDELGNSKALEE  264 (490)
Q Consensus       185 ~~L~~L~L~~n~~~~~~~~~~~~l~~L~~L~L~~~n~l~~~~~l~~~~~~l~~L~~L~l~~n~~~~~~p~~~~~l~~L~~  264 (490)
                      ++++.+++++|.+.+..+  +...++|++|++++ +.++   .++ .+..+++|+.+++++|.+.+..+  +..+++|++
T Consensus       197 ~~~~~l~l~~n~i~~~~~--~~~~~~L~~L~l~~-n~l~---~~~-~l~~l~~L~~L~l~~n~l~~~~~--~~~~~~L~~  267 (384)
T d2omza2         197 TNLESLIATNNQISDITP--LGILTNLDELSLNG-NQLK---DIG-TLASLTNLTDLDLANNQISNLAP--LSGLTKLTE  267 (384)
T ss_dssp             TTCSEEECCSSCCCCCGG--GGGCTTCCEEECCS-SCCC---CCG-GGGGCTTCSEEECCSSCCCCCGG--GTTCTTCSE
T ss_pred             cccceeeccCCccCCCCc--ccccCCCCEEECCC-CCCC---Ccc-hhhcccccchhccccCccCCCCc--ccccccCCE
Confidence            899999999988776544  46678999999999 7774   333 57789999999999988766443  778899999


Q ss_pred             eEccCccccccchhhHhhccccccccccccccccccCccccCccccceeecccccccccCCcccCCccccceeeccCccc
Q 011233          265 LRVEGAAIRERLPESLGQLALLCELKMIKCSSFESLPSSLCMLKYLTSLAIIDCKNFKRLPNELGNLKCLVVLIVKGTAI  344 (490)
Q Consensus       265 L~ls~n~l~~~~~~~~~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~Ls~n~~~~~~~~~~~~l~~L~~L~L~~n~l  344 (490)
                      ++++++++++ ++ .+..++.++.+.+..|.+.+.  ..+..+++++.|++++|++.+..  .+..+++|++|++++|++
T Consensus       268 L~l~~~~l~~-~~-~~~~~~~l~~l~~~~n~l~~~--~~~~~~~~l~~L~ls~n~l~~l~--~l~~l~~L~~L~L~~n~l  341 (384)
T d2omza2         268 LKLGANQISN-IS-PLAGLTALTNLELNENQLEDI--SPISNLKNLTYLTLYFNNISDIS--PVSSLTKLQRLFFANNKV  341 (384)
T ss_dssp             EECCSSCCCC-CG-GGTTCTTCSEEECCSSCCSCC--GGGGGCTTCSEEECCSSCCSCCG--GGGGCTTCCEEECCSSCC
T ss_pred             eeccCcccCC-CC-ccccccccccccccccccccc--cccchhcccCeEECCCCCCCCCc--ccccCCCCCEEECCCCCC
Confidence            9999999987 44 377888999999998877653  34678899999999999877643  388899999999999999


Q ss_pred             ccCCccccCCCCCCEEeCcCCCCCCCchhhhccCCCCEEecCCC
Q 011233          345 REVPESLGQLSSIVRLDLSNNNLERTPASLYQLSSIKYLKLFDN  388 (490)
Q Consensus       345 ~~~p~~~~~l~~L~~L~Ls~n~l~~l~~~l~~l~~L~~L~ls~n  388 (490)
                      ++++ .++.+++|++|++++|+++.+++ +..+++|++|+|++|
T Consensus       342 ~~l~-~l~~l~~L~~L~l~~N~l~~l~~-l~~l~~L~~L~L~~N  383 (384)
T d2omza2         342 SDVS-SLANLTNINWLSAGHNQISDLTP-LANLTRITQLGLNDQ  383 (384)
T ss_dssp             CCCG-GGGGCTTCCEEECCSSCCCBCGG-GTTCTTCSEEECCCE
T ss_pred             CCCh-hHcCCCCCCEEECCCCcCCCChh-hccCCCCCEeeCCCC
Confidence            9877 58889999999999999999874 889999999999987
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure