Citrus Sinensis ID: 011351


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------49
MASVSNSLSFKHGLSLWCPQSPSLHRIRHSSAKNFQRRGFVVAYSSFANENREFVIVGGGNAAGYAARTFVEHGMADGRLCIVSKEAYAPYERPALTKGYLFPLDKKPARLPGFHTCVGSGGERQTPEWYKEKGIEMIYQDPVTSIDIEKQTLITNSGKLLKYGSLIVATGCTASRFPEKIGGYLPGVHYIRDVADADALISSLEKAKKVVVVGGGYIGMEVAAAAVGWKLDTTIIFPENHLLQRLFTPSLAQRYEQLYQQNGVKFVKGASIKNLEAGSDGRVAAVKLEDGSTIDADTIVIGIGAKPTVSPFERVGLNSSVGGIQVDGQFRTRMPGIFAIGDVAAFPLKMYDRTARVEHVDHARQSAQHCIKALLSAQTHTYDYLPYFYSRVFEYEGSPRKVWWQFFGDNVGETIEIGNFDPKIATFWIDSGKLKGVLVESGSPEEFQLLPTLARSQPFVDKAKLQQASSVEEALEIARAALPVEAAV
ccccccccccccccccccccccccccEEEccccccEEccccccccccccccccEEEEcccHHHHHHHHHHHHcccccccEEEEcccccccccccccccccccccccccccccccccccccccccccHHHHHHcccEEEccccEEEEEccccEEEcccccEEccccEEEcccccccccccccccccccEEEEccHHHHHHHHHHHHccccEEEEcccHHHHHHHHHHHHccccEEEEccccccccccccHHHHHHHHHHHHHcccEEEcccEEEEEEEcccccEEEEEcccccEEEccEEEEccccccccHHHHHcccccccccEEEccccccccccEEEcccccccccccccccEEEccHHHHHHHHHHHHHHHHcccccccccccEEEccccccccccccEEEEEEEcccccEEEEEcccccEEEEEEEccEEEEEEEEcccHHHHHHHHHHHHccccccHHHHccccccHHHHHHHHHcccccccc
cccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHccccccEEEEEcccHHHHHHHHHHHHccccccEEEEEccccccccccccccHHHHcccccccccccccEEEcccccccccHHHHHHcccEEEEccEEEEEcccccEEEEccccEEEccEEEEEccccccccccccccccccEEEEEcHHHHHHHHHHHcccccEEEEcccHHHHHHHHHHHHccccEEEEEccccHHHHHccHHHHHHHHHHHHHcccEEEEccEEEEEEEccccEEEEEEEccccEEcccEEEEEEcccccHHHHHHccccEccccEEEccccccccccEEEEEccccccccccccEEEEEccHHHHHHHHHHHHHHHcccccccccccEEEccccEEEEEEEccccccccccccEEEEEccccccEEEEEEEccEEEEEEEccccHHHHHHHHHHHHccccccHHHHccccccHHHHHHHHHcccccccc
masvsnslsfkhglslwcpqspslhrirhsSAKNFQRRGFVVAYSSFANENREFVIVGGGNAAGYAARTFVehgmadgrlcivskeayapyerpaltkgylfpldkkparlpgfhtcvgsggerqtpewykekgiemiyqdpvtsidiEKQTLITNSGKLLKYGSLIvatgctasrfpekiggylpgvhyirdVADADALISSLEKAKKVVVVGGGYIGMEVAAAAVgwkldttiifpenhllqrlftpSLAQRYEQLYQQNGVKFVKGASiknleagsdgrVAAVkledgstidadtivigigakptvspfervglnssvggiqvdgqfrtrmpgifaigdvaafplkmydrtarveHVDHARQSAQHCIKALLSAQthtydylpyFYSRVFEYEGSPRKVWWQFFgdnvgetieignfdpkiatFWIDSGKLKGVlvesgspeefqllptlarsqpfvdkakLQQASSVEEALEIARAALPVEAAV
masvsnslsfkhglsLWCPQSPSLHRIRHSSAKNFQRRGFVVAYSSFANENREFVIVGGGNAAGYAARTFVEHGMADGRLCIVSKEAYAPYERPALTKGYLFPLDKKPARLPGFHtcvgsggerqtpeWYKEKGIEMIYQDPVTSIDIEKQTLITNSGKLLKYGSLIVATGCTASRFPEKIGGYLPGVHYIRDVADADALISSLEKAKKVVVVGGGYIGMEVAAAAVGWKLDTTIIFPENHLLQRLFTPSLAQRYEQLYQQNGVKFVKGASIknleagsdGRVAAVKledgstidaDTIVIGIGAKPTVSPFERVGLNSSVGGIQVDGQFRTRMPGIFAIGDVAAFPLKMYDRTARVEHVDHARQSAQHCIKALLSAQTHTYDYLPYFYSRVFEYEGSPRKVWWQFFGDNVGETIEIGNFDPKIATFWIDSGKLKGVLVESGSPEEFQLLPTLARSQPFVDKAKLQQASSVEEALEIARAALPVEAAV
MASVSNSLSFKHGLSLWCPQSPSLHRIRHSSAKNFQRRGFVVAYSSFANENREFVIVGGGNAAGYAARTFVEHGMADGRLCIVSKEAYAPYERPALTKGYLFPLDKKPARLPGFHTCVGSGGERQTPEWYKEKGIEMIYQDPVTSIDIEKQTLITNSGKLLKYGSLIVATGCTASRFPEKIGGYLPGVHYIRDVADADALISSLEKAKKvvvvgggYIGMEVAAAAVGWKLDTTIIFPENHLLQRLFTPSLAQRYEQLYQQNGVKFVKGASIKNLEAGSDGRVAAVKLEDGSTIDADTIVIGIGAKPTVSPFERVGLNSSVGGIQVDGQFRTRMPGIFAIGDVAAFPLKMYDRTARVEHVDHARQSAQHCIKALLSAQTHTYDYLPYFYSRVFEYEGSPRKVWWQFFGDNVGETIEIGNFDPKIATFWIDSGKLKGVLVESGSPEEFQLLPTLARSQPFVDKAKLQQASSVEEALEIARAALPVEAAV
***********HGLSLWCPQ****HRI****AKNFQRRGFVVAYSSFANENREFVIVGGGNAAGYAARTFVEHGMADGRLCIVSKEAYAPYERPALTKGYLFPLDKKPARLPGFHTCVGSGGERQTPEWYKEKGIEMIYQDPVTSIDIEKQTLITNSGKLLKYGSLIVATGCTASRFPEKIGGYLPGVHYIRDVADADALISSLEKAKKVVVVGGGYIGMEVAAAAVGWKLDTTIIFPENHLLQRLFTPSLAQRYEQLYQQNGVKFVKGASIKNLEAGSDGRVAAVKLEDGSTIDADTIVIGIGAKPTVSPFERVGLNSSVGGIQVDGQFRTRMPGIFAIGDVAAFPLKMYDRTARVEHVDHARQSAQHCIKALLSAQTHTYDYLPYFYSRVFEYEGSPRKVWWQFFGDNVGETIEIGNFDPKIATFWIDSGKLKGVLVE************************************************
******S***KHGLSLWCPQSPSLHRIR*************************FVIVGGGNAAGYAARTFVEHGMADGRLCIVSKEAYAPYERPALTKGYLFPLDKKPARLPGFHTCVGSGGERQTPEWYKEKGIEMIYQDPVTSIDIEKQTLITNSGKLLKYGSLIVATGCTASRFPEKIGGYLPGVHYIRDVADADALISSLEKAKKVVVVGGGYIGMEVAAAAVGWKLDTTIIFPENHLLQRLFTPSLAQRYEQLYQQNGVKFVKGASIKNLEAGSDGRVAAVKLEDGSTIDADTIVIGIGAKPTVSPFERVGLNSSVGGIQVDGQFRTRMPGIFAIGDVAAFPLKMYDRTARVEHVDHARQSAQHCIKALLSAQTHTYDYLPYFYSRVFEYEGSPRKVWWQFFGDNVGETIEIGNFDPKIATFWIDSGKLKGVLVESGSPEEFQLLPTLARSQPFVDKAKLQQASSVEEALEI****L******
***********HGLSLWCPQSPSLHRIRHSSAKNFQRRGFVVAYSSFANENREFVIVGGGNAAGYAARTFVEHGMADGRLCIVSKEAYAPYERPALTKGYLFPLDKKPARLPGFHTCVGSGGERQTPEWYKEKGIEMIYQDPVTSIDIEKQTLITNSGKLLKYGSLIVATGCTASRFPEKIGGYLPGVHYIRDVADADALISSLEKAKKVVVVGGGYIGMEVAAAAVGWKLDTTIIFPENHLLQRLFTPSLAQRYEQLYQQNGVKFVKGASIKNLEAGSDGRVAAVKLEDGSTIDADTIVIGIGAKPTVSPFERVGLNSSVGGIQVDGQFRTRMPGIFAIGDVAAFPLKMYDRTARVEH********QHCIKALLSAQTHTYDYLPYFYSRVFEYEGSPRKVWWQFFGDNVGETIEIGNFDPKIATFWIDSGKLKGVLVESGSPEEFQLLPTLARSQPFVDKAKLQQASSVEEALEIARAALPVEAAV
**********KHGLSLWCPQSPSLHRIRHSSAKNFQRRGFVVAYSSFANENREFVIVGGGNAAGYAARTFVEHGMADGRLCIVSKEAYAPYERPALTKGYLFPLDKKPARLPGFHTCVGSGGERQTPEWYKEKGIEMIYQDPVTSIDIEKQTLITNSGKLLKYGSLIVATGCTASRFPEKIGGYLPGVHYIRDVADADALISSLEKAKKVVVVGGGYIGMEVAAAAVGWKLDTTIIFPENHLLQRLFTPSLAQRYEQLYQQNGVKFVKGASIKNLEAGSDGRVAAVKLEDGSTIDADTIVIGIGAKPTVSPFERVGLNSSVGGIQVDGQFRTRMPGIFAIGDVAAFPLKMYDRTARVEHVDHARQSAQHCIKALLSAQTHTYDYLPYFYSRVFEYEGSPRKVWWQFFGDNVGETIEIGNFDPKIATFWIDSGKLKGVLVESGSPEEFQLLPTLARSQPFVDKAKLQQASSVEEALEIAR*********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASVSNSLSFKHGLSLWCPQSPSLHRIRHSSAKNFQRRGFVVAYSSFANENREFVIVGGGNAAGYAARTFVEHGMADGRLCIVSKEAYAPYERPALTKGYLFPLDKKPARLPGFHTCVGSGGERQTPEWYKEKGIEMIYQDPVTSIDIEKQTLITNSGKLLKYGSLIVATGCTASRFPEKIGGYLPGVHYIRDVADADALISSLEKAKKVVVVGGGYIGMEVAAAAVGWKLDTTIIFPENHLLQRLFTPSLAQRYEQLYQQNGVKFVKGASIKNLEAGSDGRVAAVKLEDGSTIDADTIVIGIGAKPTVSPFERVGLNSSVGGIQVDGQFRTRMPGIFAIGDVAAFPLKMYDRTARVEHVDHARQSAQHCIKALLSAQTHTYDYLPYFYSRVFEYEGSPRKVWWQFFGDNVGETIEIGNFDPKIATFWIDSGKLKGVLVESGSPEEFQLLPTLARSQPFVDKAKLQQASSVEEALEIARAALPVEAAV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query488 2.2.26 [Sep-21-2011]
P92947493 Monodehydroascorbate redu yes no 0.983 0.973 0.802 0.0
Q40977433 Monodehydroascorbate redu N/A no 0.817 0.921 0.457 1e-105
Q43497433 Monodehydroascorbate redu N/A no 0.823 0.928 0.451 1e-105
Q9LFA3434 Probable monodehydroascor no no 0.823 0.926 0.425 5e-95
Q42711434 Monodehydroascorbate redu N/A no 0.836 0.940 0.457 9e-95
Q93WJ8435 Probable monodehydroascor no no 0.786 0.882 0.429 9e-94
Q9LK94488 Probable monodehydroascor no no 0.780 0.780 0.427 1e-93
Q9SR59441 Probable monodehydroascor no no 0.784 0.868 0.408 2e-87
P43494427 Rhodocoxin reductase OS=R yes no 0.659 0.754 0.323 2e-39
P16640422 Putidaredoxin reductase O yes no 0.678 0.784 0.306 1e-36
>sp|P92947|MDARP_ARATH Monodehydroascorbate reductase, chloroplastic OS=Arabidopsis thaliana GN=At1g63940 PE=2 SV=3 Back     alignment and function desciption
 Score =  789 bits (2038), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/486 (80%), Positives = 429/486 (88%), Gaps = 6/486 (1%)

Query: 1   MASVSNSLSFKHGLSLWCPQSPSLHR---IRHSS-AKNFQRRGFVVAYSSFANENREFVI 56
           MA  S +L  K GLSLWCP SPSL R    R S        R  V A  SFANENREFVI
Sbjct: 8   MALASTTLPTKSGLSLWCPSSPSLARRFPARFSPIGSRIASRSLVTA--SFANENREFVI 65

Query: 57  VGGGNAAGYAARTFVEHGMADGRLCIVSKEAYAPYERPALTKGYLFPLDKKPARLPGFHT 116
           VGGGNAAGYAARTFVE+GMADGRLCIV+KEAYAPYERPALTK YLFP +KKPARLPGFHT
Sbjct: 66  VGGGNAAGYAARTFVENGMADGRLCIVTKEAYAPYERPALTKAYLFPPEKKPARLPGFHT 125

Query: 117 CVGSGGERQTPEWYKEKGIEMIYQDPVTSIDIEKQTLITNSGKLLKYGSLIVATGCTASR 176
           CVG GGERQTP+WYKEKGIE+IY+DPV   D EKQTL T++GK LKYGSLI+ATGCTASR
Sbjct: 126 CVGGGGERQTPDWYKEKGIEVIYEDPVAGADFEKQTLTTDAGKQLKYGSLIIATGCTASR 185

Query: 177 FPEKIGGYLPGVHYIRDVADADALISSLEKAKKVVVVGGGYIGMEVAAAAVGWKLDTTII 236
           FP+KIGG+LPGVHYIR+VADAD+LI+SL KAKK+V+VGGGYIGMEVAAAAV W LDTTI+
Sbjct: 186 FPDKIGGHLPGVHYIREVADADSLIASLGKAKKIVIVGGGYIGMEVAAAAVAWNLDTTIV 245

Query: 237 FPENHLLQRLFTPSLAQRYEQLYQQNGVKFVKGASIKNLEAGSDGRVAAVKLEDGSTIDA 296
           FPE+ LLQRLFTPSLAQ+YE+LY+QNGVKFVKGASI NLEAGSDGRV+AVKL DGSTI+A
Sbjct: 246 FPEDQLLQRLFTPSLAQKYEELYRQNGVKFVKGASINNLEAGSDGRVSAVKLADGSTIEA 305

Query: 297 DTIVIGIGAKPTVSPFERVGLNSSVGGIQVDGQFRTRMPGIFAIGDVAAFPLKMYDRTAR 356
           DT+VIGIGAKP + PFE + +N S+GGIQVDG FRT  PGIFAIGDVAAFPLK+YDR  R
Sbjct: 306 DTVVIGIGAKPAIGPFETLAMNKSIGGIQVDGLFRTSTPGIFAIGDVAAFPLKIYDRMTR 365

Query: 357 VEHVDHARQSAQHCIKALLSAQTHTYDYLPYFYSRVFEYEGSPRKVWWQFFGDNVGETIE 416
           VEHVDHAR+SAQHC+K+LL+A T TYDYLPYFYSRVFEYEGSPRKVWWQFFGDNVGET+E
Sbjct: 366 VEHVDHARRSAQHCVKSLLTAHTDTYDYLPYFYSRVFEYEGSPRKVWWQFFGDNVGETVE 425

Query: 417 IGNFDPKIATFWIDSGKLKGVLVESGSPEEFQLLPTLARSQPFVDKAKLQQASSVEEALE 476
           +GNFDPKIATFWI+SG+LKGVLVESGSPEEFQLLP LARSQP VDKAKL  ASSVEEALE
Sbjct: 426 VGNFDPKIATFWIESGRLKGVLVESGSPEEFQLLPKLARSQPLVDKAKLASASSVEEALE 485

Query: 477 IARAAL 482
           IA+AAL
Sbjct: 486 IAQAAL 491




Catalyzes the conversion of monodehydroascorbate to ascorbate, oxidizing NADH in the process.
Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 6EC: .EC: 5EC: .EC: 4
>sp|Q40977|MDAR_PEA Monodehydroascorbate reductase OS=Pisum sativum PE=1 SV=1 Back     alignment and function description
>sp|Q43497|MDAR_SOLLC Monodehydroascorbate reductase OS=Solanum lycopersicum GN=AFRR PE=1 SV=1 Back     alignment and function description
>sp|Q9LFA3|MDAR3_ARATH Probable monodehydroascorbate reductase, cytoplasmic isoform 3 OS=Arabidopsis thaliana GN=At3g52880 PE=1 SV=1 Back     alignment and function description
>sp|Q42711|MDARS_CUCSA Monodehydroascorbate reductase, seedling isozyme OS=Cucumis sativus PE=2 SV=1 Back     alignment and function description
>sp|Q93WJ8|MDAR4_ARATH Probable monodehydroascorbate reductase, cytoplasmic isoform 4 OS=Arabidopsis thaliana GN=At5g03630 PE=1 SV=1 Back     alignment and function description
>sp|Q9LK94|MDAR2_ARATH Probable monodehydroascorbate reductase, cytoplasmic isoform 2 OS=Arabidopsis thaliana GN=At3g27820 PE=2 SV=1 Back     alignment and function description
>sp|Q9SR59|MDAR1_ARATH Probable monodehydroascorbate reductase, cytoplasmic isoform 1 OS=Arabidopsis thaliana GN=At3g09940 PE=2 SV=1 Back     alignment and function description
>sp|P43494|THCD_RHOER Rhodocoxin reductase OS=Rhodococcus erythropolis GN=thcD PE=1 SV=2 Back     alignment and function description
>sp|P16640|CAMA_PSEPU Putidaredoxin reductase OS=Pseudomonas putida GN=camA PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query488
359474156497 PREDICTED: monodehydroascorbate reductas 1.0 0.981 0.836 0.0
297742237490 unnamed protein product [Vitis vinifera] 1.0 0.995 0.836 0.0
147834040 889 hypothetical protein VITISV_021486 [Viti 1.0 0.548 0.815 0.0
224058437497 predicted protein [Populus trichocarpa] 0.987 0.969 0.828 0.0
194716776486 monodehydroascorbate reductase [Picrorhi 0.983 0.987 0.816 0.0
255537579493 monodehydroascorbate reductase, putative 0.983 0.973 0.845 0.0
350536875482 monodehydroascorbate reductase [Solanum 0.987 1.0 0.817 0.0
110265126482 chloroplast monodehydroascorbate reducta 0.987 1.0 0.815 0.0
46093473486 monodehydroascorbate reductase [Brassica 0.983 0.987 0.808 0.0
30696924493 Monodehydroascorbate reductase [Arabidop 0.983 0.973 0.802 0.0
>gi|359474156|ref|XP_002278648.2| PREDICTED: monodehydroascorbate reductase, chloroplastic [Vitis vinifera] Back     alignment and taxonomy information
 Score =  841 bits (2172), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/490 (83%), Positives = 451/490 (92%), Gaps = 2/490 (0%)

Query: 1   MASVSNSLSFKHGLSLWCPQSPSLHRIRHSSA--KNFQRRGFVVAYSSFANENREFVIVG 58
           MAS+SNSL  KHG+SLWCPQ  SL+R R  S+   +   R + V   +FANENREFVIVG
Sbjct: 8   MASISNSLPLKHGISLWCPQHASLNRTRLPSSFGSSASARRYGVVSCAFANENREFVIVG 67

Query: 59  GGNAAGYAARTFVEHGMADGRLCIVSKEAYAPYERPALTKGYLFPLDKKPARLPGFHTCV 118
           GGNAAGYAARTFVEHGMADG+LCIVSKEA+APYERPALTKGYLFPLDKKPARLPGFHTCV
Sbjct: 68  GGNAAGYAARTFVEHGMADGKLCIVSKEAFAPYERPALTKGYLFPLDKKPARLPGFHTCV 127

Query: 119 GSGGERQTPEWYKEKGIEMIYQDPVTSIDIEKQTLITNSGKLLKYGSLIVATGCTASRFP 178
           GSGGERQTP+WYKEKGIEM+Y+DPVT IDIEKQTL+TNSGKLLKYGSLI+ATGCTASR P
Sbjct: 128 GSGGERQTPDWYKEKGIEMLYEDPVTGIDIEKQTLMTNSGKLLKYGSLIIATGCTASRLP 187

Query: 179 EKIGGYLPGVHYIRDVADADALISSLEKAKKVVVVGGGYIGMEVAAAAVGWKLDTTIIFP 238
           +KIGG LPGVHYIRDVADAD+LISSLEKA+KVV+VGGGYIGMEVAAAA GWKLDTTIIFP
Sbjct: 188 DKIGGNLPGVHYIRDVADADSLISSLEKARKVVIVGGGYIGMEVAAAAAGWKLDTTIIFP 247

Query: 239 ENHLLQRLFTPSLAQRYEQLYQQNGVKFVKGASIKNLEAGSDGRVAAVKLEDGSTIDADT 298
           E+HLLQRLFTP+LA+RYE+ YQ+NGVKFVKGASIKN+EAGSDG V AVKLE+GSTI+ADT
Sbjct: 248 EDHLLQRLFTPTLARRYEEFYQENGVKFVKGASIKNIEAGSDGHVTAVKLENGSTIEADT 307

Query: 299 IVIGIGAKPTVSPFERVGLNSSVGGIQVDGQFRTRMPGIFAIGDVAAFPLKMYDRTARVE 358
           I+IGIGAKP VSPFERVG+N++VGGIQVDGQFRT +PGIFAIGDVAAFPLKMY+R ARVE
Sbjct: 308 IIIGIGAKPAVSPFERVGINTTVGGIQVDGQFRTSVPGIFAIGDVAAFPLKMYNRIARVE 367

Query: 359 HVDHARQSAQHCIKALLSAQTHTYDYLPYFYSRVFEYEGSPRKVWWQFFGDNVGETIEIG 418
           HVDHAR+SAQHCI ALL+A+TH YDYLPYFYSRVFEYEGSPRK+WWQFFGDNVGET+EIG
Sbjct: 368 HVDHARRSAQHCINALLTAKTHLYDYLPYFYSRVFEYEGSPRKIWWQFFGDNVGETVEIG 427

Query: 419 NFDPKIATFWIDSGKLKGVLVESGSPEEFQLLPTLARSQPFVDKAKLQQASSVEEALEIA 478
           NFDPKIATFWIDSGKLKGVL+ESGSPEEFQLLP LARSQP VD  KLQ+ASSVEEALE+A
Sbjct: 428 NFDPKIATFWIDSGKLKGVLLESGSPEEFQLLPKLARSQPHVDMTKLQKASSVEEALELA 487

Query: 479 RAALPVEAAV 488
            A +   AAV
Sbjct: 488 HAYVQAGAAV 497




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|297742237|emb|CBI34386.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147834040|emb|CAN64338.1| hypothetical protein VITISV_021486 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224058437|ref|XP_002299509.1| predicted protein [Populus trichocarpa] gi|118488230|gb|ABK95934.1| unknown [Populus trichocarpa] gi|222846767|gb|EEE84314.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|194716776|gb|ACF93237.1| monodehydroascorbate reductase [Picrorhiza kurrooa] Back     alignment and taxonomy information
>gi|255537579|ref|XP_002509856.1| monodehydroascorbate reductase, putative [Ricinus communis] gi|223549755|gb|EEF51243.1| monodehydroascorbate reductase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|350536875|ref|NP_001234013.1| monodehydroascorbate reductase [Solanum lycopersicum] gi|195542238|gb|AAZ66138.2| monodehydroascorbate reductase [Solanum lycopersicum] gi|299507810|gb|ADJ21816.1| monodehydroascorbate reductase [Solanum lycopersicum var. cerasiforme] Back     alignment and taxonomy information
>gi|110265126|gb|ABG57052.1| chloroplast monodehydroascorbate reductase [Solanum lycopersicum] Back     alignment and taxonomy information
>gi|46093473|dbj|BAD14933.1| monodehydroascorbate reductase [Brassica oleracea] Back     alignment and taxonomy information
>gi|30696924|ref|NP_849839.1| Monodehydroascorbate reductase [Arabidopsis thaliana] gi|50400853|sp|P92947.3|MDARP_ARATH RecName: Full=Monodehydroascorbate reductase, chloroplastic; Short=MDAR; Flags: Precursor gi|12325013|gb|AAG52455.1|AC010852_12 putative monodehydroascorbate reductase; 10617-7178 [Arabidopsis thaliana] gi|23397057|gb|AAN31814.1| putative monodehydroascorbate reductase [Arabidopsis thaliana] gi|332196050|gb|AEE34171.1| Monodehydroascorbate reductase [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query488
TAIR|locus:2195503493 MDAR6 "monodehydroascorbate re 0.983 0.973 0.792 1.5e-207
TAIR|locus:2144588435 ATMDAR2 [Arabidopsis thaliana 0.850 0.954 0.424 5.7e-91
TAIR|locus:2086430488 MDAR4 "monodehydroascorbate re 0.813 0.813 0.429 6.5e-90
TAIR|locus:2085176466 MDAR1 "monodehydroascorbate re 0.788 0.826 0.426 2e-86
TAIR|locus:2100143441 MDHAR "monodehydroascorbate re 0.842 0.931 0.405 6.2e-85
UNIPROTKB|P95146411 Rv1869c "Probable reductase" [ 0.778 0.924 0.298 1.7e-36
TIGR_CMR|SPO_3737403 SPO_3737 "pyridine nucleotide- 0.782 0.947 0.289 4.4e-36
UNIPROTKB|D5IGG6414 fdr "Ferredoxin--NAD(P)(+) red 0.665 0.785 0.305 8.5e-33
UNIPROTKB|P95034406 Rv0688 "PUTATIVE FERREDOXIN RE 0.653 0.785 0.311 1.8e-32
UNIPROTKB|Q9L4M8385 alkT "Rubredoxin-NAD(+) reduct 0.631 0.8 0.309 4.9e-30
TAIR|locus:2195503 MDAR6 "monodehydroascorbate reductase 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2007 (711.6 bits), Expect = 1.5e-207, P = 1.5e-207
 Identities = 385/486 (79%), Positives = 422/486 (86%)

Query:     1 MASVSNSLSFKHGLSLWCPQSPSLHR---IRHSS-AKNFQRRGFVVAYSSFANENREFVI 56
             MA  S +L  K GLSLWCP SPSL R    R S        R  V A  SFANENREFVI
Sbjct:     8 MALASTTLPTKSGLSLWCPSSPSLARRFPARFSPIGSRIASRSLVTA--SFANENREFVI 65

Query:    57 VGGGNAAGYAARTFVEHGMADGRLCIVSKEAYAPYERPALTKGYLFPLDKKPARLPGFHT 116
             VGGGNAAGYAARTFVE+GMADGRLCIV+KEAYAPYERPALTK YLFP +KKPARLPGFHT
Sbjct:    66 VGGGNAAGYAARTFVENGMADGRLCIVTKEAYAPYERPALTKAYLFPPEKKPARLPGFHT 125

Query:   117 CVGSGGERQTPEWYKEKGIEMIYQDPVTSIDIEKQTLITNSGKLLKYGSLIVATGCTASR 176
             CVG GGERQTP+WYKEKGIE+IY+DPV   D EKQTL T++GK LKYGSLI+ATGCTASR
Sbjct:   126 CVGGGGERQTPDWYKEKGIEVIYEDPVAGADFEKQTLTTDAGKQLKYGSLIIATGCTASR 185

Query:   177 FPEKIGGYLPGVHYIRDVADADALISSLEKAKKXXXXXXXYIGMEVAAAAVGWKLDTTII 236
             FP+KIGG+LPGVHYIR+VADAD+LI+SL KAKK       YIGMEVAAAAV W LDTTI+
Sbjct:   186 FPDKIGGHLPGVHYIREVADADSLIASLGKAKKIVIVGGGYIGMEVAAAAVAWNLDTTIV 245

Query:   237 FPENHLLQRLFTPSLAQRYEQLYQQNGVKFVKGASIKNLEAGSDGRVAAVKLEDGSTIDA 296
             FPE+ LLQRLFTPSLAQ+YE+LY+QNGVKFVKGASI NLEAGSDGRV+AVKL DGSTI+A
Sbjct:   246 FPEDQLLQRLFTPSLAQKYEELYRQNGVKFVKGASINNLEAGSDGRVSAVKLADGSTIEA 305

Query:   297 DTIVIGIGAKPTVSPFERVGLNSSVGGIQVDGQFRTRMPGIFAIGDVAAFPLKMYDRTAR 356
             DT+VIGIGAKP + PFE + +N S+GGIQVDG FRT  PGIFAIGDVAAFPLK+YDR  R
Sbjct:   306 DTVVIGIGAKPAIGPFETLAMNKSIGGIQVDGLFRTSTPGIFAIGDVAAFPLKIYDRMTR 365

Query:   357 VEHVDHARQSAQHCIKALLSAQTHTYDYLPYFYSRVFEYEGSPRKVWWQFFGDNVGETIE 416
             VEHVDHAR+SAQHC+K+LL+A T TYDYLPYFYSRVFEYEGSPRKVWWQFFGDNVGET+E
Sbjct:   366 VEHVDHARRSAQHCVKSLLTAHTDTYDYLPYFYSRVFEYEGSPRKVWWQFFGDNVGETVE 425

Query:   417 IGNFDPKIATFWIDSGKLKGVLVESGSPEEFQLLPTLARSQPFVDKAKLQQASSVEEALE 476
             +GNFDPKIATFWI+SG+LKGVLVESGSPEEFQLLP LARSQP VDKAKL  ASSVEEALE
Sbjct:   426 VGNFDPKIATFWIESGRLKGVLVESGSPEEFQLLPKLARSQPLVDKAKLASASSVEEALE 485

Query:   477 IARAAL 482
             IA+AAL
Sbjct:   486 IAQAAL 491




GO:0009055 "electron carrier activity" evidence=IEA
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0050660 "flavin adenine dinucleotide binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0005739 "mitochondrion" evidence=IDA
GO:0009570 "chloroplast stroma" evidence=IDA
GO:0046686 "response to cadmium ion" evidence=IEP
GO:0009409 "response to cold" evidence=IEP
GO:0010319 "stromule" evidence=IDA
GO:0005524 "ATP binding" evidence=IDA
GO:0005829 "cytosol" evidence=RCA
GO:0042744 "hydrogen peroxide catabolic process" evidence=RCA
TAIR|locus:2144588 ATMDAR2 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2086430 MDAR4 "monodehydroascorbate reductase 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2085176 MDAR1 "monodehydroascorbate reductase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2100143 MDHAR "monodehydroascorbate reductase" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|P95146 Rv1869c "Probable reductase" [Mycobacterium tuberculosis H37Rv (taxid:83332)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_3737 SPO_3737 "pyridine nucleotide-disulphide oxidoreductase family protein" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
UNIPROTKB|D5IGG6 fdr "Ferredoxin--NAD(P)(+) reductase fdr" [Sphingomonas sp. (taxid:28214)] Back     alignment and assigned GO terms
UNIPROTKB|P95034 Rv0688 "PUTATIVE FERREDOXIN REDUCTASE" [Mycobacterium tuberculosis (taxid:1773)] Back     alignment and assigned GO terms
UNIPROTKB|Q9L4M8 alkT "Rubredoxin-NAD(+) reductase" [Pseudomonas putida (taxid:303)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P92947MDARP_ARATH1, ., 6, ., 5, ., 40.80240.98360.9736yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer1.6.5.40.979
3rd Layer1.6.50.983

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query488
pfam07992283 pfam07992, Pyr_redox_2, Pyridine nucleotide-disulp 2e-60
COG0446415 COG0446, HcaD, Uncharacterized NAD(FAD)-dependent 1e-45
PRK09754396 PRK09754, PRK09754, phenylpropionate dioxygenase f 1e-41
COG1251 793 COG1251, NirB, NAD(P)H-nitrite reductase [Energy p 1e-34
TIGR02374 785 TIGR02374, nitri_red_nirB, nitrite reductase [NAD( 7e-31
TIGR03385427 TIGR03385, CoA_CoA_reduc, CoA-disulfide reductase 6e-28
COG1252405 COG1252, Ndh, NADH dehydrogenase, FAD-containing s 5e-24
COG1249454 COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenas 6e-24
PRK09564444 PRK09564, PRK09564, coenzyme A disulfide reductase 2e-23
TIGR01350460 TIGR01350, lipoamide_DH, dihydrolipoamide dehydrog 5e-23
PRK04965377 PRK04965, PRK04965, NADH:flavorubredoxin oxidoredu 2e-20
PRK06116450 PRK06116, PRK06116, glutathione reductase; Validat 8e-19
COG0492305 COG0492, TrxB, Thioredoxin reductase [Posttranslat 4e-17
PRK05976472 PRK05976, PRK05976, dihydrolipoamide dehydrogenase 6e-17
PRK13512438 PRK13512, PRK13512, coenzyme A disulfide reductase 8e-16
pfam0007082 pfam00070, Pyr_redox, Pyridine nucleotide-disulphi 1e-15
PRK06416462 PRK06416, PRK06416, dihydrolipoamide dehydrogenase 1e-15
PRK06370463 PRK06370, PRK06370, mercuric reductase; Validated 1e-15
PRK14989 847 PRK14989, PRK14989, nitrite reductase subunit NirD 3e-15
TIGR01421450 TIGR01421, gluta_reduc_1, glutathione-disulfide re 7e-15
TIGR02053463 TIGR02053, MerA, mercuric reductase 1e-14
PRK07818466 PRK07818, PRK07818, dihydrolipoamide dehydrogenase 2e-14
PTZ00058561 PTZ00058, PTZ00058, glutathione reductase; Provisi 5e-14
PRK06292460 PRK06292, PRK06292, dihydrolipoamide dehydrogenase 6e-13
PRK05249461 PRK05249, PRK05249, soluble pyridine nucleotide tr 7e-13
PRK07251438 PRK07251, PRK07251, pyridine nucleotide-disulfide 9e-13
TIGR01424446 TIGR01424, gluta_reduc_2, glutathione-disulfide re 2e-12
PRK12771564 PRK12771, PRK12771, putative glutamate synthase (N 4e-12
TIGR01423486 TIGR01423, trypano_reduc, trypanothione-disulfide 9e-12
PRK06327475 PRK06327, PRK06327, dihydrolipoamide dehydrogenase 1e-11
PRK11749457 PRK11749, PRK11749, dihydropyrimidine dehydrogenas 1e-11
TIGR03169364 TIGR03169, Nterm_to_SelD, pyridine nucleotide-disu 7e-11
TIGR01292299 TIGR01292, TRX_reduct, thioredoxin-disulfide reduc 1e-10
PTZ00052499 PTZ00052, PTZ00052, thioredoxin reductase; Provisi 3e-10
PRK12770352 PRK12770, PRK12770, putative glutamate synthase su 4e-10
TIGR01438484 TIGR01438, TGR, thioredoxin and glutathione reduct 6e-10
PRK07846451 PRK07846, PRK07846, mycothione reductase; Reviewed 2e-09
TIGR01316449 TIGR01316, gltA, glutamate synthase (NADPH), homot 4e-09
PRK06115466 PRK06115, PRK06115, dihydrolipoamide dehydrogenase 7e-09
PRK06912458 PRK06912, acoL, dihydrolipoamide dehydrogenase; Va 7e-09
TIGR03452452 TIGR03452, mycothione_red, mycothione reductase 8e-09
PRK08010441 PRK08010, PRK08010, pyridine nucleotide-disulfide 1e-08
TIGR03140515 TIGR03140, AhpF, alkyl hydroperoxide reductase sub 3e-08
PLN02507499 PLN02507, PLN02507, glutathione reductase 6e-08
PLN02546558 PLN02546, PLN02546, glutathione reductase 1e-07
PTZ00318424 PTZ00318, PTZ00318, NADH dehydrogenase-like protei 2e-07
PRK12810471 PRK12810, gltD, glutamate synthase subunit beta; R 3e-07
PRK14694468 PRK14694, PRK14694, putative mercuric reductase; P 4e-07
pfam07992283 pfam07992, Pyr_redox_2, Pyridine nucleotide-disulp 1e-06
PRK098531019 PRK09853, PRK09853, putative selenate reductase su 2e-06
PRK12814652 PRK12814, PRK12814, putative NADPH-dependent gluta 3e-06
PRK07845466 PRK07845, PRK07845, flavoprotein disulfide reducta 9e-06
PRK12778752 PRK12778, PRK12778, putative bifunctional 2-polypr 1e-05
COG3634520 COG3634, AhpF, Alkyl hydroperoxide reductase, larg 2e-05
PRK06467471 PRK06467, PRK06467, dihydrolipoamide dehydrogenase 6e-05
pfam13738202 pfam13738, Pyr_redox_3, Pyridine nucleotide-disulp 7e-05
COG0493457 COG0493, GltD, NADPH-dependent glutamate synthase 1e-04
TIGR033151012 TIGR03315, Se_ygfK, putative selenate reductase, Y 2e-04
PRK12831464 PRK12831, PRK12831, putative oxidoreductase; Provi 2e-04
COG1252 405 COG1252, Ndh, NADH dehydrogenase, FAD-containing s 3e-04
PRK14727479 PRK14727, PRK14727, putative mercuric reductase; P 0.001
TIGR03140515 TIGR03140, AhpF, alkyl hydroperoxide reductase sub 0.003
PRK00711416 PRK00711, PRK00711, D-amino acid dehydrogenase sma 0.003
PRK15317517 PRK15317, PRK15317, alkyl hydroperoxide reductase 0.003
PRK15317517 PRK15317, PRK15317, alkyl hydroperoxide reductase 0.004
>gnl|CDD|219686 pfam07992, Pyr_redox_2, Pyridine nucleotide-disulphide oxidoreductase Back     alignment and domain information
 Score =  199 bits (508), Expect = 2e-60
 Identities = 95/298 (31%), Positives = 139/298 (46%), Gaps = 21/298 (7%)

Query: 55  VIVGGGNAAGYAARTFVEHGMADGRLCIVSKEAYAPYERPALTKGYLFPLDKKPARLPGF 114
           VI+GGG  AG AA   +       ++ ++ +E    Y R  L K  L  L+         
Sbjct: 3   VIIGGG-PAGLAAAIRL--ARLGLKVALIEREGGTCYNRGCLPKKLL--LEVAEGLELA- 56

Query: 115 HTCVGSGGERQTPEWYKEKGIEMIYQDPVTSIDIEKQTLITNS---GKLLKYGSLIVATG 171
                  G     E YKE G+E++    V  ID  ++T++      G+ + Y  LI+ATG
Sbjct: 57  ------IGLALPEEVYKEFGVEVLLGTEVVDIDRGEKTVVLKDVETGREITYDKLIIATG 110

Query: 172 CTASRFPEKIGGYLPGVHYIRDVADADALISSLEKAKKVVVVGGGYIGMEVAAAAVGWKL 231
                    I G    V  +R V D+D ++  LE  K+VVVVGGGYIG+E+AAA      
Sbjct: 111 ARPRIPG--IPGV--EVATLRGVIDSDEILELLELPKRVVVVGGGYIGLELAAALAKLGK 166

Query: 232 DTTIIFPENHLLQRLFTPSLAQRYEQLYQQNGVKFVKGASIKNLEAGSDGRVAAVKLEDG 291
           + T++   + LL R      A   E+L +   +       +  +    DG+V  VKL DG
Sbjct: 167 EVTVVERRDRLLARADDEISAALLEKLEKL-LLGVTVLLVVVVVVKVGDGKVVEVKLGDG 225

Query: 292 STIDADTIVIGIGAKPTVSPFERVGLN-SSVGGIQVDGQFRTRMPGIFAIGDVAAFPL 348
             +DAD +++ IG +P     E+ G+     G I VD   RT +PGI+A GDVA    
Sbjct: 226 EELDADVVLVAIGRRPNTELLEQAGVELDERGYIVVDEYLRTSVPGIYAAGDVAEGKP 283


This family includes both class I and class II oxidoreductases and also NADH oxidases and peroxidases. This domain is actually a small NADH binding domain within a larger FAD binding domain. Length = 283

>gnl|CDD|223523 COG0446, HcaD, Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>gnl|CDD|170080 PRK09754, PRK09754, phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>gnl|CDD|224171 COG1251, NirB, NAD(P)H-nitrite reductase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|162827 TIGR02374, nitri_red_nirB, nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>gnl|CDD|163244 TIGR03385, CoA_CoA_reduc, CoA-disulfide reductase Back     alignment and domain information
>gnl|CDD|224172 COG1252, Ndh, NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|224169 COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|181958 PRK09564, PRK09564, coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>gnl|CDD|233368 TIGR01350, lipoamide_DH, dihydrolipoamide dehydrogenase Back     alignment and domain information
>gnl|CDD|179902 PRK04965, PRK04965, NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|235701 PRK06116, PRK06116, glutathione reductase; Validated Back     alignment and domain information
>gnl|CDD|223566 COG0492, TrxB, Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|235660 PRK05976, PRK05976, dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|184103 PRK13512, PRK13512, coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>gnl|CDD|215691 pfam00070, Pyr_redox, Pyridine nucleotide-disulphide oxidoreductase Back     alignment and domain information
>gnl|CDD|235798 PRK06416, PRK06416, dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|235787 PRK06370, PRK06370, mercuric reductase; Validated Back     alignment and domain information
>gnl|CDD|184951 PRK14989, PRK14989, nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>gnl|CDD|130488 TIGR01421, gluta_reduc_1, glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>gnl|CDD|233700 TIGR02053, MerA, mercuric reductase Back     alignment and domain information
>gnl|CDD|236106 PRK07818, PRK07818, dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|185420 PTZ00058, PTZ00058, glutathione reductase; Provisional Back     alignment and domain information
>gnl|CDD|235774 PRK06292, PRK06292, dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|235373 PRK05249, PRK05249, soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180907 PRK07251, PRK07251, pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|213618 TIGR01424, gluta_reduc_2, glutathione-disulfide reductase, plant Back     alignment and domain information
>gnl|CDD|237198 PRK12771, PRK12771, putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>gnl|CDD|200098 TIGR01423, trypano_reduc, trypanothione-disulfide reductase Back     alignment and domain information
>gnl|CDD|235779 PRK06327, PRK06327, dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|236967 PRK11749, PRK11749, dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>gnl|CDD|234134 TIGR03169, Nterm_to_SelD, pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>gnl|CDD|233345 TIGR01292, TRX_reduct, thioredoxin-disulfide reductase Back     alignment and domain information
>gnl|CDD|185416 PTZ00052, PTZ00052, thioredoxin reductase; Provisional Back     alignment and domain information
>gnl|CDD|237197 PRK12770, PRK12770, putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>gnl|CDD|233412 TIGR01438, TGR, thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>gnl|CDD|181142 PRK07846, PRK07846, mycothione reductase; Reviewed Back     alignment and domain information
>gnl|CDD|130383 TIGR01316, gltA, glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>gnl|CDD|180409 PRK06115, PRK06115, dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|180743 PRK06912, acoL, dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|132493 TIGR03452, mycothione_red, mycothione reductase Back     alignment and domain information
>gnl|CDD|181196 PRK08010, PRK08010, pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|234119 TIGR03140, AhpF, alkyl hydroperoxide reductase subunit F Back     alignment and domain information
>gnl|CDD|215281 PLN02507, PLN02507, glutathione reductase Back     alignment and domain information
>gnl|CDD|215301 PLN02546, PLN02546, glutathione reductase Back     alignment and domain information
>gnl|CDD|185553 PTZ00318, PTZ00318, NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>gnl|CDD|237213 PRK12810, gltD, glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>gnl|CDD|237790 PRK14694, PRK14694, putative mercuric reductase; Provisional Back     alignment and domain information
>gnl|CDD|219686 pfam07992, Pyr_redox_2, Pyridine nucleotide-disulphide oxidoreductase Back     alignment and domain information
>gnl|CDD|236630 PRK09853, PRK09853, putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>gnl|CDD|139246 PRK12814, PRK12814, putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>gnl|CDD|236112 PRK07845, PRK07845, flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>gnl|CDD|237200 PRK12778, PRK12778, putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>gnl|CDD|226160 COG3634, AhpF, Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|180579 PRK06467, PRK06467, dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|222355 pfam13738, Pyr_redox_3, Pyridine nucleotide-disulphide oxidoreductase Back     alignment and domain information
>gnl|CDD|223567 COG0493, GltD, NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|132358 TIGR03315, Se_ygfK, putative selenate reductase, YgfK subunit Back     alignment and domain information
>gnl|CDD|183780 PRK12831, PRK12831, putative oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|224172 COG1252, Ndh, NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|237806 PRK14727, PRK14727, putative mercuric reductase; Provisional Back     alignment and domain information
>gnl|CDD|234119 TIGR03140, AhpF, alkyl hydroperoxide reductase subunit F Back     alignment and domain information
>gnl|CDD|234819 PRK00711, PRK00711, D-amino acid dehydrogenase small subunit; Validated Back     alignment and domain information
>gnl|CDD|237942 PRK15317, PRK15317, alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>gnl|CDD|237942 PRK15317, PRK15317, alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 488
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 100.0
KOG1336478 consensus Monodehydroascorbate/ferredoxin reductas 100.0
PRK14989 847 nitrite reductase subunit NirD; Provisional 100.0
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 100.0
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 100.0
COG1251 793 NirB NAD(P)H-nitrite reductase [Energy production 100.0
PRK13512438 coenzyme A disulfide reductase; Provisional 100.0
PRK09564444 coenzyme A disulfide reductase; Reviewed 100.0
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 100.0
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [En 100.0
PRK06370463 mercuric reductase; Validated 100.0
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 100.0
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 100.0
PLN02507499 glutathione reductase 100.0
PRK14694468 putative mercuric reductase; Provisional 100.0
PRK06116450 glutathione reductase; Validated 100.0
PRK06467471 dihydrolipoamide dehydrogenase; Reviewed 100.0
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 100.0
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 100.0
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Prov 100.0
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 100.0
PRK05976472 dihydrolipoamide dehydrogenase; Validated 100.0
TIGR02053463 MerA mercuric reductase. This model represents the 100.0
PRK07845466 flavoprotein disulfide reductase; Reviewed 100.0
PTZ00058561 glutathione reductase; Provisional 100.0
PRK07818466 dihydrolipoamide dehydrogenase; Reviewed 100.0
PTZ00318424 NADH dehydrogenase-like protein; Provisional 100.0
PLN02546558 glutathione reductase 100.0
PRK13748561 putative mercuric reductase; Provisional 100.0
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Prov 100.0
PRK07846451 mycothione reductase; Reviewed 100.0
TIGR03385427 CoA_CoA_reduc CoA-disulfide reductase. Members of 100.0
TIGR01423486 trypano_reduc trypanothione-disulfide reductase. T 100.0
PRK14727479 putative mercuric reductase; Provisional 100.0
PTZ00153659 lipoamide dehydrogenase; Provisional 100.0
PRK098531019 putative selenate reductase subunit YgfK; Provisio 100.0
TIGR01438484 TGR thioredoxin and glutathione reductase selenopr 100.0
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 100.0
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 100.0
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a 100.0
PRK06292460 dihydrolipoamide dehydrogenase; Validated 100.0
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 100.0
PRK06327475 dihydrolipoamide dehydrogenase; Validated 100.0
PRK12831464 putative oxidoreductase; Provisional 100.0
KOG1346659 consensus Programmed cell death 8 (apoptosis-induc 100.0
PTZ00052499 thioredoxin reductase; Provisional 100.0
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 100.0
PRK12779 944 putative bifunctional glutamate synthase subunit b 100.0
PRK11749457 dihydropyrimidine dehydrogenase subunit A; Provisi 100.0
KOG1335506 consensus Dihydrolipoamide dehydrogenase [Energy p 100.0
TIGR033151012 Se_ygfK putative selenate reductase, YgfK subunit. 100.0
PRK12778752 putative bifunctional 2-polyprenylphenol hydroxyla 100.0
PRK12810471 gltD glutamate synthase subunit beta; Reviewed 100.0
TIGR01318467 gltD_gamma_fam glutamate synthase small subunit fa 100.0
PRK12814652 putative NADPH-dependent glutamate synthase small 100.0
PRK12775 1006 putative trifunctional 2-polyprenylphenol hydroxyl 100.0
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 100.0
PRK12769654 putative oxidoreductase Fe-S binding subunit; Revi 100.0
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 100.0
TIGR01317485 GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal 100.0
PRK10262321 thioredoxin reductase; Provisional 100.0
PRK13984604 putative oxidoreductase; Provisional 100.0
COG0446415 HcaD Uncharacterized NAD(FAD)-dependent dehydrogen 100.0
PRK12809639 putative oxidoreductase Fe-S binding subunit; Revi 100.0
COG0492305 TrxB Thioredoxin reductase [Posttranslational modi 100.0
KOG0405478 consensus Pyridine nucleotide-disulphide oxidoredu 100.0
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 100.0
TIGR03143 555 AhpF_homolog putative alkyl hydroperoxide reductas 100.0
KOG2495491 consensus NADH-dehydrogenase (ubiquinone) [Energy 100.0
PRK12771564 putative glutamate synthase (NADPH) small subunit; 100.0
PRK12770352 putative glutamate synthase subunit beta; Provisio 99.97
PLN02852491 ferredoxin-NADP+ reductase 99.96
KOG4716503 consensus Thioredoxin reductase [Posttranslational 99.95
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 99.95
PRK06567 1028 putative bifunctional glutamate synthase subunit b 99.94
KOG0404322 consensus Thioredoxin reductase [Posttranslational 99.94
COG3634520 AhpF Alkyl hydroperoxide reductase, large subunit 99.93
PLN02172461 flavin-containing monooxygenase FMO GS-OX 99.92
COG0493457 GltD NADPH-dependent glutamate synthase beta chain 99.92
KOG3851446 consensus Sulfide:quinone oxidoreductase/flavo-bin 99.89
KOG2755334 consensus Oxidoreductase [General function predict 99.88
KOG03992142 consensus Glutamate synthase [Amino acid transport 99.87
PF00743531 FMO-like: Flavin-binding monooxygenase-like; Inter 99.86
PF07992201 Pyr_redox_2: Pyridine nucleotide-disulphide oxidor 99.83
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 99.72
COG1148622 HdrA Heterodisulfide reductase, subunit A and rela 99.71
PTZ00188506 adrenodoxin reductase; Provisional 99.69
PF13434341 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi 99.68
KOG1399448 consensus Flavin-containing monooxygenase [Seconda 99.67
COG3486436 IucD Lysine/ornithine N-monooxygenase [Secondary m 99.65
COG2072443 TrkA Predicted flavoprotein involved in K+ transpo 99.65
KOG1800468 consensus Ferredoxin/adrenodoxin reductase [Nucleo 99.63
PRK05329422 anaerobic glycerol-3-phosphate dehydrogenase subun 99.63
COG4529474 Uncharacterized protein conserved in bacteria [Fun 99.55
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 99.47
PRK09897534 hypothetical protein; Provisional 99.36
COG0029518 NadB Aspartate oxidase [Coenzyme metabolism] 99.33
COG2081408 Predicted flavoproteins [General function predicti 99.21
TIGR03378419 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase 99.2
PRK08401466 L-aspartate oxidase; Provisional 99.11
PRK07804541 L-aspartate oxidase; Provisional 99.05
PRK06175433 L-aspartate oxidase; Provisional 99.04
COG0579429 Predicted dehydrogenase [General function predicti 99.0
TIGR00551488 nadB L-aspartate oxidase. L-aspartate oxidase is t 98.98
COG3075421 GlpB Anaerobic glycerol-3-phosphate dehydrogenase 98.96
PRK08071510 L-aspartate oxidase; Provisional 98.94
PF03486409 HI0933_like: HI0933-like protein; InterPro: IPR004 98.94
PRK08275 554 putative oxidoreductase; Provisional 98.92
PRK06452 566 sdhA succinate dehydrogenase flavoprotein subunit; 98.92
PRK09231 582 fumarate reductase flavoprotein subunit; Validated 98.91
TIGR01176 580 fum_red_Fp fumarate reductase, flavoprotein subuni 98.91
PRK09077536 L-aspartate oxidase; Provisional 98.89
PRK05945 575 sdhA succinate dehydrogenase flavoprotein subunit; 98.89
PRK07395553 L-aspartate oxidase; Provisional 98.88
TIGR01812 566 sdhA_frdA_Gneg succinate dehydrogenase or fumarate 98.85
PLN00128 635 Succinate dehydrogenase [ubiquinone] flavoprotein 98.84
PRK06069 577 sdhA succinate dehydrogenase flavoprotein subunit; 98.84
PRK12842 574 putative succinate dehydrogenase; Reviewed 98.84
PRK08205 583 sdhA succinate dehydrogenase flavoprotein subunit; 98.83
PRK13800 897 putative oxidoreductase/HEAT repeat-containing pro 98.83
PRK07573 640 sdhA succinate dehydrogenase flavoprotein subunit; 98.82
PLN02815 594 L-aspartate oxidase 98.82
PRK06847375 hypothetical protein; Provisional 98.81
PF1475985 Reductase_C: Reductase C-terminal; PDB: 3FG2_P 3LX 98.79
PRK07512513 L-aspartate oxidase; Provisional 98.78
PRK06854 608 adenylylsulfate reductase subunit alpha; Validated 98.77
PF01266358 DAO: FAD dependent oxidoreductase; InterPro: IPR00 98.77
PRK07057 591 sdhA succinate dehydrogenase flavoprotein subunit; 98.76
PRK06263 543 sdhA succinate dehydrogenase flavoprotein subunit; 98.76
TIGR02061 614 aprA adenosine phosphosulphate reductase, alpha su 98.75
PRK11728393 hydroxyglutarate oxidase; Provisional 98.72
PRK08641 589 sdhA succinate dehydrogenase flavoprotein subunit; 98.72
PRK13977 576 myosin-cross-reactive antigen; Provisional 98.72
PRK08626 657 fumarate reductase flavoprotein subunit; Provision 98.7
PRK07843 557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 98.69
PLN02463447 lycopene beta cyclase 98.68
PRK06834488 hypothetical protein; Provisional 98.68
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 98.68
COG2081408 Predicted flavoproteins [General function predicti 98.67
PRK10015429 oxidoreductase; Provisional 98.66
TIGR02032295 GG-red-SF geranylgeranyl reductase family. This mo 98.66
PRK10157428 putative oxidoreductase FixC; Provisional 98.65
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Prov 98.64
COG0644396 FixC Dehydrogenases (flavoproteins) [Energy produc 98.64
COG1053 562 SdhA Succinate dehydrogenase/fumarate reductase, f 98.64
PRK07190487 hypothetical protein; Provisional 98.63
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 98.6
PRK07333403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 98.59
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 98.59
PRK06184502 hypothetical protein; Provisional 98.59
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 98.58
PRK07236386 hypothetical protein; Provisional 98.57
TIGR00292254 thiazole biosynthesis enzyme. This enzyme is invol 98.55
PF13454156 NAD_binding_9: FAD-NAD(P)-binding 98.54
TIGR01811 603 sdhA_Bsu succinate dehydrogenase or fumarate reduc 98.54
PRK06134 581 putative FAD-binding dehydrogenase; Reviewed 98.54
PRK12409410 D-amino acid dehydrogenase small subunit; Provisio 98.53
PRK00711416 D-amino acid dehydrogenase small subunit; Validate 98.52
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 98.51
COG1232444 HemY Protoporphyrinogen oxidase [Coenzyme metaboli 98.5
PRK08020391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin 98.5
PRK01747662 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans 98.49
TIGR01790388 carotene-cycl lycopene cyclase family protein. Thi 98.49
PRK09126392 hypothetical protein; Provisional 98.49
PRK07494388 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 98.48
TIGR02734502 crtI_fam phytoene desaturase. Phytoene is converte 98.48
COG3380331 Predicted NAD/FAD-dependent oxidoreductase [Genera 98.48
PTZ00383497 malate:quinone oxidoreductase; Provisional 98.48
PRK08244493 hypothetical protein; Provisional 98.48
TIGR02731453 phytoene_desat phytoene desaturase. Plants and cya 98.47
TIGR01377380 soxA_mon sarcosine oxidase, monomeric form. Sarcos 98.46
TIGR00292254 thiazole biosynthesis enzyme. This enzyme is invol 98.46
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 98.45
PRK07045388 putative monooxygenase; Reviewed 98.43
PF03486409 HI0933_like: HI0933-like protein; InterPro: IPR004 98.43
PRK07233434 hypothetical protein; Provisional 98.43
PRK08849384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 98.43
TIGR03385427 CoA_CoA_reduc CoA-disulfide reductase. Members of 98.42
COG2509486 Uncharacterized FAD-dependent dehydrogenases [Gene 98.42
TIGR01373407 soxB sarcosine oxidase, beta subunit family, heter 98.42
PLN02697529 lycopene epsilon cyclase 98.41
PRK06183538 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va 98.41
PRK07608388 ubiquinone biosynthesis hydroxylase family protein 98.41
PRK08274466 tricarballylate dehydrogenase; Validated 98.41
PLN02612567 phytoene desaturase 98.41
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 98.4
PRK05714405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 98.4
PRK09754 396 phenylpropionate dioxygenase ferredoxin reductase 98.4
PRK05868372 hypothetical protein; Validated 98.4
PRK08013400 oxidoreductase; Provisional 98.39
PRK08163396 salicylate hydroxylase; Provisional 98.39
PRK06126 545 hypothetical protein; Provisional 98.38
PRK07364415 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 98.38
COG0654387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and 98.38
PRK06185407 hypothetical protein; Provisional 98.37
PRK08850405 2-octaprenyl-6-methoxyphenol hydroxylase; Validate 98.37
COG1233487 Phytoene dehydrogenase and related proteins [Secon 98.36
PRK07588391 hypothetical protein; Provisional 98.36
PF05834374 Lycopene_cycl: Lycopene cyclase protein; InterPro: 98.35
PRK06481506 fumarate reductase flavoprotein subunit; Validated 98.35
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 98.34
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 98.34
PTZ00363443 rab-GDP dissociation inhibitor; Provisional 98.33
PRK05732395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 98.32
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 98.32
PRK06753373 hypothetical protein; Provisional 98.31
PRK05192 618 tRNA uridine 5-carboxymethylaminomethyl modificati 98.31
PRK08132547 FAD-dependent oxidoreductase; Provisional 98.31
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 98.29
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 98.29
TIGR01789370 lycopene_cycl lycopene cyclase. This model represe 98.28
COG1635262 THI4 Ribulose 1,5-bisphosphate synthetase, convert 98.28
PRK05976472 dihydrolipoamide dehydrogenase; Validated 98.27
PRK13512438 coenzyme A disulfide reductase; Provisional 98.27
PRK09564 444 coenzyme A disulfide reductase; Reviewed 98.27
TIGR01984382 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T 98.26
TIGR01988385 Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub 98.26
TIGR03329460 Phn_aa_oxid putative aminophosphonate oxidoreducta 98.26
PRK11259376 solA N-methyltryptophan oxidase; Provisional 98.26
PRK11445351 putative oxidoreductase; Provisional 98.26
PRK06847375 hypothetical protein; Provisional 98.25
PLN02172 461 flavin-containing monooxygenase FMO GS-OX 98.25
PRK14694468 putative mercuric reductase; Provisional 98.25
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 98.25
PRK11883451 protoporphyrinogen oxidase; Reviewed 98.24
PLN00093450 geranylgeranyl diphosphate reductase; Provisional 98.24
TIGR00275400 flavoprotein, HI0933 family. The model when search 98.24
PRK06116450 glutathione reductase; Validated 98.24
TIGR03364365 HpnW_proposed FAD dependent oxidoreductase TIGR033 98.23
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 98.23
PF07992201 Pyr_redox_2: Pyridine nucleotide-disulphide oxidor 98.23
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 98.23
PRK07846451 mycothione reductase; Reviewed 98.22
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 98.22
TIGR02023388 BchP-ChlP geranylgeranyl reductase. This model rep 98.22
PF01134392 GIDA: Glucose inhibited division protein A; InterP 98.22
PRK09078 598 sdhA succinate dehydrogenase flavoprotein subunit; 98.22
PLN02661357 Putative thiazole synthesis 98.21
TIGR00562462 proto_IX_ox protoporphyrinogen oxidase. This prote 98.21
COG0665387 DadA Glycine/D-amino acid oxidases (deaminating) [ 98.21
PRK05257494 malate:quinone oxidoreductase; Validated 98.21
TIGR03219414 salicylate_mono salicylate 1-monooxygenase. Member 98.21
PRK06996398 hypothetical protein; Provisional 98.21
PTZ00318 424 NADH dehydrogenase-like protein; Provisional 98.2
PLN02487569 zeta-carotene desaturase 98.19
PRK07818466 dihydrolipoamide dehydrogenase; Reviewed 98.19
PRK06370463 mercuric reductase; Validated 98.19
PF01134392 GIDA: Glucose inhibited division protein A; InterP 98.19
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 98.18
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 98.18
TIGR01320483 mal_quin_oxido malate:quinone-oxidoreductase. This 98.18
PF12831428 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3 98.18
PRK13339497 malate:quinone oxidoreductase; Reviewed 98.18
TIGR01989437 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T 98.17
TIGR02360390 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase. 98.17
TIGR02053463 MerA mercuric reductase. This model represents the 98.17
PRK07845466 flavoprotein disulfide reductase; Reviewed 98.16
COG1252 405 Ndh NADH dehydrogenase, FAD-containing subunit [En 98.16
PRK08243392 4-hydroxybenzoate 3-monooxygenase; Validated 98.15
PRK12416463 protoporphyrinogen oxidase; Provisional 98.14
PRK06327475 dihydrolipoamide dehydrogenase; Validated 98.14
TIGR02028398 ChlP geranylgeranyl reductase. This model represen 98.13
PRK06617374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 98.12
PLN02507499 glutathione reductase 98.12
PRK06475400 salicylate hydroxylase; Provisional 98.12
PRK14989 847 nitrite reductase subunit NirD; Provisional 98.12
PRK07236386 hypothetical protein; Provisional 98.12
PF01494356 FAD_binding_3: FAD binding domain; InterPro: IPR00 98.12
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 98.1
PRK11101 546 glpA sn-glycerol-3-phosphate dehydrogenase subunit 98.1
PTZ00139 617 Succinate dehydrogenase [ubiquinone] flavoprotein 98.09
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a 98.09
TIGR02732474 zeta_caro_desat carotene 7,8-desaturase. Carotene 98.08
PRK12770352 putative glutamate synthase subunit beta; Provisio 98.07
PF1345068 NAD_binding_8: NAD(P)-binding Rossmann-like domain 98.07
TIGR02032295 GG-red-SF geranylgeranyl reductase family. This mo 98.06
PRK09853 1019 putative selenate reductase subunit YgfK; Provisio 98.06
PTZ00052499 thioredoxin reductase; Provisional 98.06
COG0446415 HcaD Uncharacterized NAD(FAD)-dependent dehydrogen 98.05
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Prov 98.05
TIGR01423486 trypano_reduc trypanothione-disulfide reductase. T 98.05
PF00890417 FAD_binding_2: FAD binding domain of the Pfam fami 98.04
PRK07121492 hypothetical protein; Validated 98.04
PRK13748561 putative mercuric reductase; Provisional 98.03
PRK07803 626 sdhA succinate dehydrogenase flavoprotein subunit; 98.02
PRK06834 488 hypothetical protein; Provisional 98.01
PRK11749457 dihydropyrimidine dehydrogenase subunit A; Provisi 98.01
PLN02463447 lycopene beta cyclase 98.01
TIGR01438484 TGR thioredoxin and glutathione reductase selenopr 98.0
PRK14727479 putative mercuric reductase; Provisional 97.99
TIGR01813439 flavo_cyto_c flavocytochrome c. This model describ 97.98
PRK07045388 putative monooxygenase; Reviewed 97.98
PRK07538413 hypothetical protein; Provisional 97.98
PRK12779 944 putative bifunctional glutamate synthase subunit b 97.96
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 97.96
PRK06292460 dihydrolipoamide dehydrogenase; Validated 97.96
PRK08958 588 sdhA succinate dehydrogenase flavoprotein subunit; 97.96
PTZ00058561 glutathione reductase; Provisional 97.96
COG2907447 Predicted NAD/FAD-binding protein [General functio 97.95
KOG2820399 consensus FAD-dependent oxidoreductase [General fu 97.94
PRK10262321 thioredoxin reductase; Provisional 97.91
COG1635262 THI4 Ribulose 1,5-bisphosphate synthetase, convert 97.91
PRK08163396 salicylate hydroxylase; Provisional 97.9
PRK10157428 putative oxidoreductase FixC; Provisional 97.9
PRK07190 487 hypothetical protein; Provisional 97.89
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 97.89
PRK08294 634 phenol 2-monooxygenase; Provisional 97.89
PF01946230 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K. 97.89
PRK06467471 dihydrolipoamide dehydrogenase; Reviewed 97.88
PRK08244 493 hypothetical protein; Provisional 97.88
PF04820454 Trp_halogenase: Tryptophan halogenase; InterPro: I 97.88
PRK07588391 hypothetical protein; Provisional 97.88
TIGR00136 617 gidA glucose-inhibited division protein A. GidA, t 97.88
PLN02464 627 glycerol-3-phosphate dehydrogenase 97.87
KOG1336478 consensus Monodehydroascorbate/ferredoxin reductas 97.87
PRK07333403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 97.87
COG0654387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and 97.85
PRK05868372 hypothetical protein; Validated 97.84
PRK12843 578 putative FAD-binding dehydrogenase; Reviewed 97.84
PRK12831464 putative oxidoreductase; Provisional 97.83
TIGR03143 555 AhpF_homolog putative alkyl hydroperoxide reductas 97.82
PF00743 531 FMO-like: Flavin-binding monooxygenase-like; Inter 97.82
KOG0029501 consensus Amine oxidase [Secondary metabolites bio 97.82
TIGR01318467 gltD_gamma_fam glutamate synthase small subunit fa 97.81
COG0492305 TrxB Thioredoxin reductase [Posttranslational modi 97.81
PRK05714405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 97.8
PLN02852 491 ferredoxin-NADP+ reductase 97.8
KOG2415 621 consensus Electron transfer flavoprotein ubiquinon 97.8
PRK01438 480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 97.79
PRK06184 502 hypothetical protein; Provisional 97.79
PF04820454 Trp_halogenase: Tryptophan halogenase; InterPro: I 97.79
PLN02546558 glutathione reductase 97.77
COG0493457 GltD NADPH-dependent glutamate synthase beta chain 97.77
PRK09126392 hypothetical protein; Provisional 97.76
PTZ00153659 lipoamide dehydrogenase; Provisional 97.75
TIGR01984382 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T 97.75
TIGR01317485 GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal 97.75
PLN02697529 lycopene epsilon cyclase 97.74
PRK05192 618 tRNA uridine 5-carboxymethylaminomethyl modificati 97.74
TIGR01988385 Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub 97.72
PTZ00188 506 adrenodoxin reductase; Provisional 97.71
PRK08013400 oxidoreductase; Provisional 97.7
PRK07608388 ubiquinone biosynthesis hydroxylase family protein 97.7
PRK07364415 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 97.7
PRK07208479 hypothetical protein; Provisional 97.69
PF01494356 FAD_binding_3: FAD binding domain; InterPro: IPR00 97.69
PRK12778752 putative bifunctional 2-polyprenylphenol hydroxyla 97.69
KOG2665453 consensus Predicted FAD-dependent oxidoreductase [ 97.67
TIGR03315 1012 Se_ygfK putative selenate reductase, YgfK subunit. 97.67
PRK06753373 hypothetical protein; Provisional 97.66
COG0578 532 GlpA Glycerol-3-phosphate dehydrogenase [Energy pr 97.66
PRK08020391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin 97.64
PLN02661357 Putative thiazole synthesis 97.64
PRK08849384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 97.63
TIGR00136 617 gidA glucose-inhibited division protein A. GidA, t 97.63
TIGR01790388 carotene-cycl lycopene cyclase family protein. Thi 97.63
COG0644396 FixC Dehydrogenases (flavoproteins) [Energy produc 97.63
COG0445 621 GidA Flavin-dependent tRNA uridine 5-carboxymethyl 97.62
PRK08850405 2-octaprenyl-6-methoxyphenol hydroxylase; Validate 97.6
PLN02529 738 lysine-specific histone demethylase 1 97.6
PF12831428 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3 97.6
PRK12809639 putative oxidoreductase Fe-S binding subunit; Revi 97.59
PRK06183 538 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va 97.58
PRK12810471 gltD glutamate synthase subunit beta; Reviewed 97.58
PRK08132 547 FAD-dependent oxidoreductase; Provisional 97.57
KOG1399 448 consensus Flavin-containing monooxygenase [Seconda 97.57
PRK06475400 salicylate hydroxylase; Provisional 97.56
PRK12775 1006 putative trifunctional 2-polyprenylphenol hydroxyl 97.56
PRK01438480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 97.56
COG2072 443 TrkA Predicted flavoprotein involved in K+ transpo 97.56
PRK06617374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 97.54
PRK09897 534 hypothetical protein; Provisional 97.53
PRK12814 652 putative NADPH-dependent glutamate synthase small 97.53
PTZ00306 1167 NADH-dependent fumarate reductase; Provisional 97.53
TIGR01789370 lycopene_cycl lycopene cyclase. This model represe 97.53
PRK10015429 oxidoreductase; Provisional 97.52
PRK05732395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 97.51
PRK07494388 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 97.5
PRK06185407 hypothetical protein; Provisional 97.48
PLN02785 587 Protein HOTHEAD 97.48
COG3349485 Uncharacterized conserved protein [Function unknow 97.48
PLN02568539 polyamine oxidase 97.48
PRK12769654 putative oxidoreductase Fe-S binding subunit; Revi 97.46
PLN02268435 probable polyamine oxidase 97.44
TIGR02485432 CobZ_N-term precorrin 3B synthase CobZ. CobZ is es 97.44
TIGR03219414 salicylate_mono salicylate 1-monooxygenase. Member 97.42
PRK05335436 tRNA (uracil-5-)-methyltransferase Gid; Reviewed 97.42
TIGR00275400 flavoprotein, HI0933 family. The model when search 97.41
PLN02576496 protoporphyrinogen oxidase 97.39
PF01946230 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K. 97.39
KOG0685498 consensus Flavin-containing amine oxidase [Coenzym 97.37
TIGR01813439 flavo_cyto_c flavocytochrome c. This model describ 97.37
PRK13369 502 glycerol-3-phosphate dehydrogenase; Provisional 97.37
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 97.36
PRK12266 508 glpD glycerol-3-phosphate dehydrogenase; Reviewed 97.35
PLN02985514 squalene monooxygenase 97.35
PF13454156 NAD_binding_9: FAD-NAD(P)-binding 97.35
PRK08243392 4-hydroxybenzoate 3-monooxygenase; Validated 97.33
PRK06126 545 hypothetical protein; Provisional 97.33
PLN02328 808 lysine-specific histone demethylase 1 homolog 97.33
PLN02927 668 antheraxanthin epoxidase/zeaxanthin epoxidase 97.32
PF05834374 Lycopene_cycl: Lycopene cyclase protein; InterPro: 97.3
TIGR00031377 UDP-GALP_mutase UDP-galactopyranose mutase. The ge 97.3
KOG0404322 consensus Thioredoxin reductase [Posttranslational 97.3
PRK06996398 hypothetical protein; Provisional 97.3
PRK11259376 solA N-methyltryptophan oxidase; Provisional 97.29
TIGR00137 433 gid_trmFO tRNA:m(5)U-54 methyltransferase. This mo 97.28
TIGR01989437 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T 97.27
PRK13984604 putative oxidoreductase; Provisional 97.27
TIGR02733492 desat_CrtD C-3',4' desaturase CrtD. Members of thi 97.26
PRK12771 564 putative glutamate synthase (NADPH) small subunit; 97.26
KOG4254561 consensus Phytoene desaturase [Coenzyme transport 97.23
PTZ00367567 squalene epoxidase; Provisional 97.23
PRK07538413 hypothetical protein; Provisional 97.22
PF06039488 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro 97.2
COG0445 621 GidA Flavin-dependent tRNA uridine 5-carboxymethyl 97.17
PF00890417 FAD_binding_2: FAD binding domain of the Pfam fami 97.17
KOG1335506 consensus Dihydrolipoamide dehydrogenase [Energy p 97.16
KOG2844 856 consensus Dimethylglycine dehydrogenase precursor 97.16
KOG2853509 consensus Possible oxidoreductase [General functio 97.15
TIGR02360390 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase. 97.15
PF14721133 AIF_C: Apoptosis-inducing factor, mitochondrion-as 97.14
PRK11101 546 glpA sn-glycerol-3-phosphate dehydrogenase subunit 97.13
KOG2404477 consensus Fumarate reductase, flavoprotein subunit 97.13
KOG03992142 consensus Glutamate synthase [Amino acid transport 97.09
COG1231450 Monoamine oxidase [Amino acid transport and metabo 97.09
TIGR02028398 ChlP geranylgeranyl reductase. This model represen 97.09
KOG2820399 consensus FAD-dependent oxidoreductase [General fu 97.07
TIGR02023388 BchP-ChlP geranylgeranyl reductase. This model rep 97.06
TIGR02730493 carot_isom carotene isomerase. Members of this fam 97.05
PRK07804 541 L-aspartate oxidase; Provisional 97.05
PRK11445351 putative oxidoreductase; Provisional 97.04
PRK06567 1028 putative bifunctional glutamate synthase subunit b 97.03
KOG1276491 consensus Protoporphyrinogen oxidase [Coenzyme tra 97.01
TIGR03364365 HpnW_proposed FAD dependent oxidoreductase TIGR033 97.01
KOG2614420 consensus Kynurenine 3-monooxygenase and related f 97.0
PLN02676487 polyamine oxidase 96.98
PRK08401 466 L-aspartate oxidase; Provisional 96.98
COG3573 552 Predicted oxidoreductase [General function predict 96.95
TIGR02485432 CobZ_N-term precorrin 3B synthase CobZ. CobZ is es 96.94
COG1251 793 NirB NAD(P)H-nitrite reductase [Energy production 96.92
PRK12834 549 putative FAD-binding dehydrogenase; Reviewed 96.9
PF06100500 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross 96.9
TIGR00137433 gid_trmFO tRNA:m(5)U-54 methyltransferase. This mo 96.89
PRK12837513 3-ketosteroid-delta-1-dehydrogenase; Provisional 96.84
TIGR01812 566 sdhA_frdA_Gneg succinate dehydrogenase or fumarate 96.82
PRK08255 765 salicylyl-CoA 5-hydroxylase; Reviewed 96.8
KOG2495 491 consensus NADH-dehydrogenase (ubiquinone) [Energy 96.8
PF00732296 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR0001 96.79
PLN00093450 geranylgeranyl diphosphate reductase; Provisional 96.79
PRK09078 598 sdhA succinate dehydrogenase flavoprotein subunit; 96.77
PRK08275 554 putative oxidoreductase; Provisional 96.77
COG0562374 Glf UDP-galactopyranose mutase [Cell envelope biog 96.76
TIGR01811 603 sdhA_Bsu succinate dehydrogenase or fumarate reduc 96.76
PTZ00139 617 Succinate dehydrogenase [ubiquinone] flavoprotein 96.73
KOG2311 679 consensus NAD/FAD-utilizing protein possibly invol 96.69
PRK12835 584 3-ketosteroid-delta-1-dehydrogenase; Reviewed 96.67
KOG2311 679 consensus NAD/FAD-utilizing protein possibly invol 96.62
PRK02106 560 choline dehydrogenase; Validated 96.61
COG3380331 Predicted NAD/FAD-dependent oxidoreductase [Genera 96.61
PRK12844 557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 96.61
PRK12839 572 hypothetical protein; Provisional 96.6
PRK08958 588 sdhA succinate dehydrogenase flavoprotein subunit; 96.59
PRK06452 566 sdhA succinate dehydrogenase flavoprotein subunit; 96.57
PRK07573 640 sdhA succinate dehydrogenase flavoprotein subunit; 96.56
PRK06175433 L-aspartate oxidase; Provisional 96.55
TIGR00551 488 nadB L-aspartate oxidase. L-aspartate oxidase is t 96.52
PRK06263 543 sdhA succinate dehydrogenase flavoprotein subunit; 96.5
PRK13369 502 glycerol-3-phosphate dehydrogenase; Provisional 96.5
PRK08294 634 phenol 2-monooxygenase; Provisional 96.5
PLN02927 668 antheraxanthin epoxidase/zeaxanthin epoxidase 96.46
PRK07057 591 sdhA succinate dehydrogenase flavoprotein subunit; 96.44
COG4529 474 Uncharacterized protein conserved in bacteria [Fun 96.44
PRK06854 608 adenylylsulfate reductase subunit alpha; Validated 96.44
PLN02985 514 squalene monooxygenase 96.44
PLN00128 635 Succinate dehydrogenase [ubiquinone] flavoprotein 96.38
PLN03000 881 amine oxidase 96.35
PRK08205 583 sdhA succinate dehydrogenase flavoprotein subunit; 96.35
PRK05945 575 sdhA succinate dehydrogenase flavoprotein subunit; 96.31
COG3634520 AhpF Alkyl hydroperoxide reductase, large subunit 96.28
PLN02976 1713 amine oxidase 96.26
PRK07803 626 sdhA succinate dehydrogenase flavoprotein subunit; 96.22
PRK12845 564 3-ketosteroid-delta-1-dehydrogenase; Reviewed 96.2
KOG2852380 consensus Possible oxidoreductase [General functio 96.16
KOG1346659 consensus Programmed cell death 8 (apoptosis-induc 96.16
KOG2404477 consensus Fumarate reductase, flavoprotein subunit 96.14
COG1148 622 HdrA Heterodisulfide reductase, subunit A and rela 96.14
PRK12266 508 glpD glycerol-3-phosphate dehydrogenase; Reviewed 96.12
PF1345068 NAD_binding_8: NAD(P)-binding Rossmann-like domain 96.11
KOG1298509 consensus Squalene monooxygenase [Lipid transport 96.11
TIGR02462544 pyranose_ox pyranose oxidase. Pyranose oxidase (al 96.05
PRK06069 577 sdhA succinate dehydrogenase flavoprotein subunit; 96.05
PRK08641 589 sdhA succinate dehydrogenase flavoprotein subunit; 96.04
PRK08255 765 salicylyl-CoA 5-hydroxylase; Reviewed 96.04
PRK12835 584 3-ketosteroid-delta-1-dehydrogenase; Reviewed 95.99
PRK14106 450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.96
PRK07395 553 L-aspartate oxidase; Provisional 95.96
KOG2960328 consensus Protein involved in thiamine biosynthesi 95.86
PF02852110 Pyr_redox_dim: Pyridine nucleotide-disulphide oxid 95.84
PRK08071 510 L-aspartate oxidase; Provisional 95.82
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
Probab=100.00  E-value=7.7e-58  Score=457.27  Aligned_cols=391  Identities=27%  Similarity=0.428  Sum_probs=335.3

Q ss_pred             CCCeEEEEcCchHHHHHHHHHHHcCCCCCcEEEEcCCCCCCCCCCCCCccccCCCCCCCCCCCCcccccCCCCCCCCHhH
Q 011351           50 ENREFVIVGGGNAAGYAARTFVEHGMADGRLCIVSKEAYAPYERPALTKGYLFPLDKKPARLPGFHTCVGSGGERQTPEW  129 (488)
Q Consensus        50 ~~~~vvIIGgG~AGl~aA~~L~~~g~~~~~V~lie~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  129 (488)
                      .+++|||||||+||++||..|++.++ +.+|+||+++++.+|.+|++++.++........             .....++
T Consensus         2 ~~~~vvIIGgG~AG~~aA~~Lr~~~~-~~~I~li~~e~~~~y~r~~l~~~~~~~~~~~~~-------------~~~~~~~   67 (396)
T PRK09754          2 KEKTIIIVGGGQAAAMAAASLRQQGF-TGELHLFSDERHLPYERPPLSKSMLLEDSPQLQ-------------QVLPANW   67 (396)
T ss_pred             CcCcEEEECChHHHHHHHHHHHhhCC-CCCEEEeCCCCCCCCCCCCCCHHHHCCCCcccc-------------ccCCHHH
Confidence            45689999999999999999999986 789999999999999999998766543222111             1234678


Q ss_pred             HHHCCCeEEeCCcEEEEeCCCcEEEeCCCcEEEeccEEeccCCCCCcCCCCCCCCCCcEEEecCHHHHHHHHHhhhcCCe
Q 011351          130 YKEKGIEMIYQDPVTSIDIEKQTLITNSGKLLKYGSLIVATGCTASRFPEKIGGYLPGVHYIRDVADADALISSLEKAKK  209 (488)
Q Consensus       130 ~~~~~i~~~~~~~v~~id~~~~~v~~~~g~~i~yd~lVlAtG~~~~~~~~~~g~~~~gv~~~~~~~~~~~~~~~~~~~~~  209 (488)
                      +.+.+++++.++.|..+|++++.+++.+|+++.||+||||||+.++.+| .++...++++++++..++..+.+.+..+++
T Consensus        68 ~~~~~i~~~~g~~V~~id~~~~~v~~~~g~~~~yd~LViATGs~~~~~p-~~~~~~~~v~~~~~~~da~~l~~~~~~~~~  146 (396)
T PRK09754         68 WQENNVHLHSGVTIKTLGRDTRELVLTNGESWHWDQLFIATGAAARPLP-LLDALGERCFTLRHAGDAARLREVLQPERS  146 (396)
T ss_pred             HHHCCCEEEcCCEEEEEECCCCEEEECCCCEEEcCEEEEccCCCCCCCC-CCCcCCCCEEecCCHHHHHHHHHHhhcCCe
Confidence            8899999999888999999999999999999999999999999986543 344456788999999999888887788899


Q ss_pred             EEEECCCHHHHHHHHHHHhCCCcEEEEecCCcCcccccCHHHHHHHHHHHHHcCcEEEcCCeEEEEEeCCCCcEEEEEeC
Q 011351          210 VVVVGGGYIGMEVAAAAVGWKLDTTIIFPENHLLQRLFTPSLAQRYEQLYQQNGVKFVKGASIKNLEAGSDGRVAAVKLE  289 (488)
Q Consensus       210 vvVvG~G~~g~e~A~~l~~~g~~v~lv~~~~~~l~~~~~~~~~~~~~~~l~~~GV~v~~~~~v~~i~~~~~~~v~~v~l~  289 (488)
                      ++|||+|++|+|+|..|.++|.+|+++++.++++++.+++.+.+.+.+.+++.||++++++.+++++.  ++. ..+.+.
T Consensus       147 vvViGgG~ig~E~A~~l~~~g~~Vtlv~~~~~~l~~~~~~~~~~~l~~~l~~~GV~i~~~~~V~~i~~--~~~-~~v~l~  223 (396)
T PRK09754        147 VVIVGAGTIGLELAASATQRRCKVTVIELAATVMGRNAPPPVQRYLLQRHQQAGVRILLNNAIEHVVD--GEK-VELTLQ  223 (396)
T ss_pred             EEEECCCHHHHHHHHHHHHcCCeEEEEecCCcchhhhcCHHHHHHHHHHHHHCCCEEEeCCeeEEEEc--CCE-EEEEEC
Confidence            99999999999999999999999999999999998778889999999999999999999999999974  233 357788


Q ss_pred             CCcEEEcCEEEEeecCccCChhhhhcCCcccCCCEEeCCCCCCCCCCEEEEceecccCCccCCcccccccHHHHHHHHHH
Q 011351          290 DGSTIDADTIVIGIGAKPTVSPFERVGLNSSVGGIQVDGQFRTRMPGIFAIGDVAAFPLKMYDRTARVEHVDHARQSAQH  369 (488)
Q Consensus       290 ~g~~i~~D~vi~a~G~~p~~~~~~~~gl~~~~g~i~vd~~~~t~~~~Ifa~GD~a~~~~~~~~~~~~~~~~~~A~~~g~~  369 (488)
                      +|+++++|.||+++|.+|++.+++++++..+ ++|.||++++|+.|||||+|||+..+.. .|...+.++|..|..||+.
T Consensus       224 ~g~~i~aD~Vv~a~G~~pn~~l~~~~gl~~~-~gi~vd~~~~ts~~~IyA~GD~a~~~~~-~g~~~~~~~~~~A~~qg~~  301 (396)
T PRK09754        224 SGETLQADVVIYGIGISANDQLAREANLDTA-NGIVIDEACRTCDPAIFAGGDVAITRLD-NGALHRCESWENANNQAQI  301 (396)
T ss_pred             CCCEEECCEEEECCCCChhhHHHHhcCCCcC-CCEEECCCCccCCCCEEEccceEeeeCC-CCCEEEECcHHHHHHHHHH
Confidence            9999999999999999999888888898775 6799999999999999999999987766 6766678899999999999


Q ss_pred             HHHHHhcCCCCCCCCCCceeEeccccCCCCcceeeEEeeCCCC-cEEEEccCC-CcEEEEEEECCEEEEEEeecCChHHh
Q 011351          370 CIKALLSAQTHTYDYLPYFYSRVFEYEGSPRKVWWQFFGDNVG-ETIEIGNFD-PKIATFWIDSGKLKGVLVESGSPEEF  447 (488)
Q Consensus       370 ~a~~i~~~~~~~~~~~p~~~~~~~~~~g~~~~~~~~~~g~~~~-~~~~~~~~~-~~~~~~~~~~~~~~g~~~~~~~~~~~  447 (488)
                      +|+||++. ..++..+||||+++|+..       ++++|.... +.+..++.+ .++..+|+++|+|+|+++ .+++..+
T Consensus       302 aa~ni~g~-~~~~~~~p~~~~~~~~~~-------~~~~G~~~~~~~~~~~~~~~~~~~~~~~~~~~l~g~~~-~~~~~~~  372 (396)
T PRK09754        302 AAAAMLGL-PLPLLPPPWFWSDQYSDN-------LQFIGDMRGDDWLCRGNPETQKAIWFNLQNGVLIGAVT-LNQGREI  372 (396)
T ss_pred             HHHHhcCC-CCCCCCCCceEEEeCCcc-------EEEeeCCCCCEEEEecCCCCceEEEEEeeCCEEEEEEE-ECCHHHH
Confidence            99999974 467889999999999865       888997544 344556544 457778889999999986 7889999


Q ss_pred             hHHHHHHhcCCCCChhhhcCCC
Q 011351          448 QLLPTLARSQPFVDKAKLQQAS  469 (488)
Q Consensus       448 ~~~~~~~~~~~~~~~~~~~~~~  469 (488)
                      ..++++++.+..+++..+.++.
T Consensus       373 ~~~~~~~~~~~~~~~~~~~~~~  394 (396)
T PRK09754        373 RPIRKWIQSGKTFDAKLLIDEN  394 (396)
T ss_pred             HHHHHHHHCCCCCCHHHhcCcc
Confidence            9999999999999988887763



>KOG1336 consensus Monodehydroascorbate/ferredoxin reductase [General function prediction only] Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>COG1251 NirB NAD(P)H-nitrite reductase [Energy production and conversion] Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>KOG1346 consensus Programmed cell death 8 (apoptosis-inducing factor) [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>KOG1335 consensus Dihydrolipoamide dehydrogenase [Energy production and conversion] Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0405 consensus Pyridine nucleotide-disulphide oxidoreductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>KOG2495 consensus NADH-dehydrogenase (ubiquinone) [Energy production and conversion] Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PLN02852 ferredoxin-NADP+ reductase Back     alignment and domain information
>KOG4716 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated Back     alignment and domain information
>KOG0404 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>KOG3851 consensus Sulfide:quinone oxidoreductase/flavo-binding protein [Energy production and conversion] Back     alignment and domain information
>KOG2755 consensus Oxidoreductase [General function prediction only] Back     alignment and domain information
>KOG0399 consensus Glutamate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] Back     alignment and domain information
>PTZ00188 adrenodoxin reductase; Provisional Back     alignment and domain information
>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B Back     alignment and domain information
>KOG1399 consensus Flavin-containing monooxygenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG3486 IucD Lysine/ornithine N-monooxygenase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG1800 consensus Ferredoxin/adrenodoxin reductase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>COG4529 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PRK09897 hypothetical protein; Provisional Back     alignment and domain information
>COG0029 NadB Aspartate oxidase [Coenzyme metabolism] Back     alignment and domain information
>COG2081 Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit Back     alignment and domain information
>PRK08401 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK07804 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK06175 L-aspartate oxidase; Provisional Back     alignment and domain information
>COG0579 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>TIGR00551 nadB L-aspartate oxidase Back     alignment and domain information
>COG3075 GlpB Anaerobic glycerol-3-phosphate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08071 L-aspartate oxidase; Provisional Back     alignment and domain information
>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases Back     alignment and domain information
>PRK08275 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK09231 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>TIGR01176 fum_red_Fp fumarate reductase, flavoprotein subunit Back     alignment and domain information
>PRK09077 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07395 L-aspartate oxidase; Provisional Back     alignment and domain information
>TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup Back     alignment and domain information
>PLN00128 Succinate dehydrogenase [ubiquinone] flavoprotein subunit Back     alignment and domain information
>PRK06069 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK12842 putative succinate dehydrogenase; Reviewed Back     alignment and domain information
>PRK08205 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>PRK07573 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PLN02815 L-aspartate oxidase Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>PF14759 Reductase_C: Reductase C-terminal; PDB: 3FG2_P 3LXD_A 2YVG_A 2GR1_A 2GQW_A 2GR3_A 2YVF_A 1F3P_A 2GR0_A 2GR2_A Back     alignment and domain information
>PRK07512 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK06854 adenylylsulfate reductase subunit alpha; Validated Back     alignment and domain information
>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>PRK07057 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06263 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR02061 aprA adenosine phosphosulphate reductase, alpha subunit Back     alignment and domain information
>PRK11728 hydroxyglutarate oxidase; Provisional Back     alignment and domain information
>PRK08641 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK13977 myosin-cross-reactive antigen; Provisional Back     alignment and domain information
>PRK08626 fumarate reductase flavoprotein subunit; Provisional Back     alignment and domain information
>PRK07843 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PLN02463 lycopene beta cyclase Back     alignment and domain information
>PRK06834 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>COG2081 Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>PRK10015 oxidoreductase; Provisional Back     alignment and domain information
>TIGR02032 GG-red-SF geranylgeranyl reductase family Back     alignment and domain information
>PRK10157 putative oxidoreductase FixC; Provisional Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>COG1053 SdhA Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>PRK07190 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>PRK06184 hypothetical protein; Provisional Back     alignment and domain information
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00292 thiazole biosynthesis enzyme Back     alignment and domain information
>PF13454 NAD_binding_9: FAD-NAD(P)-binding Back     alignment and domain information
>TIGR01811 sdhA_Bsu succinate dehydrogenase or fumarate reductase, flavoprotein subunit, Bacillus subtilis subgroup Back     alignment and domain information
>PRK06134 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>PRK00711 D-amino acid dehydrogenase small subunit; Validated Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>COG1232 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] Back     alignment and domain information
>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed Back     alignment and domain information
>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information
>TIGR01790 carotene-cycl lycopene cyclase family protein Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>TIGR02734 crtI_fam phytoene desaturase Back     alignment and domain information
>COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>PTZ00383 malate:quinone oxidoreductase; Provisional Back     alignment and domain information
>PRK08244 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02731 phytoene_desat phytoene desaturase Back     alignment and domain information
>TIGR01377 soxA_mon sarcosine oxidase, monomeric form Back     alignment and domain information
>TIGR00292 thiazole biosynthesis enzyme Back     alignment and domain information
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>PRK07045 putative monooxygenase; Reviewed Back     alignment and domain information
>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases Back     alignment and domain information
>PRK07233 hypothetical protein; Provisional Back     alignment and domain information
>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase Back     alignment and domain information
>COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form Back     alignment and domain information
>PLN02697 lycopene epsilon cyclase Back     alignment and domain information
>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>PRK08274 tricarballylate dehydrogenase; Validated Back     alignment and domain information
>PLN02612 phytoene desaturase Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>PRK05868 hypothetical protein; Validated Back     alignment and domain information
>PRK08013 oxidoreductase; Provisional Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK06126 hypothetical protein; Provisional Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>PRK06185 hypothetical protein; Provisional Back     alignment and domain information
>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated Back     alignment and domain information
>COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK07588 hypothetical protein; Provisional Back     alignment and domain information
>PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins Back     alignment and domain information
>PRK06481 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>PTZ00363 rab-GDP dissociation inhibitor; Provisional Back     alignment and domain information
>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated Back     alignment and domain information
>PRK08132 FAD-dependent oxidoreductase; Provisional Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>TIGR01789 lycopene_cycl lycopene cyclase Back     alignment and domain information
>COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase Back     alignment and domain information
>PRK11259 solA N-methyltryptophan oxidase; Provisional Back     alignment and domain information
>PRK11445 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>PRK11883 protoporphyrinogen oxidase; Reviewed Back     alignment and domain information
>PLN00093 geranylgeranyl diphosphate reductase; Provisional Back     alignment and domain information
>TIGR00275 flavoprotein, HI0933 family Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364 Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>TIGR02023 BchP-ChlP geranylgeranyl reductase Back     alignment and domain information
>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria Back     alignment and domain information
>PRK09078 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PLN02661 Putative thiazole synthesis Back     alignment and domain information
>TIGR00562 proto_IX_ox protoporphyrinogen oxidase Back     alignment and domain information
>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05257 malate:quinone oxidoreductase; Validated Back     alignment and domain information
>TIGR03219 salicylate_mono salicylate 1-monooxygenase Back     alignment and domain information
>PRK06996 hypothetical protein; Provisional Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>PLN02487 zeta-carotene desaturase Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase Back     alignment and domain information
>PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>PRK13339 malate:quinone oxidoreductase; Reviewed Back     alignment and domain information
>TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6 Back     alignment and domain information
>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated Back     alignment and domain information
>PRK12416 protoporphyrinogen oxidase; Provisional Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR02028 ChlP geranylgeranyl reductase Back     alignment and domain information
>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>PRK06475 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional Back     alignment and domain information
>PTZ00139 Succinate dehydrogenase [ubiquinone] flavoprotein subunit; Provisional Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>TIGR02732 zeta_caro_desat carotene 7,8-desaturase Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G Back     alignment and domain information
>TIGR02032 GG-red-SF geranylgeranyl reductase family Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>PF00890 FAD_binding_2: FAD binding domain of the Pfam family Back     alignment and domain information
>PRK07121 hypothetical protein; Validated Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK07803 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06834 hypothetical protein; Provisional Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>PLN02463 lycopene beta cyclase Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>TIGR01813 flavo_cyto_c flavocytochrome c Back     alignment and domain information
>PRK07045 putative monooxygenase; Reviewed Back     alignment and domain information
>PRK07538 hypothetical protein; Provisional Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK08958 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>COG2907 Predicted NAD/FAD-binding protein [General function prediction only] Back     alignment and domain information
>KOG2820 consensus FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK10157 putative oxidoreductase FixC; Provisional Back     alignment and domain information
>PRK07190 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>PRK08294 phenol 2-monooxygenase; Provisional Back     alignment and domain information
>PF01946 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK08244 hypothetical protein; Provisional Back     alignment and domain information
>PF04820 Trp_halogenase: Tryptophan halogenase; InterPro: IPR006905 Tryptophan halogenase catalyses the chlorination of tryptophan to form 7-chlorotryptophan Back     alignment and domain information
>PRK07588 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00136 gidA glucose-inhibited division protein A Back     alignment and domain information
>PLN02464 glycerol-3-phosphate dehydrogenase Back     alignment and domain information
>KOG1336 consensus Monodehydroascorbate/ferredoxin reductase [General function prediction only] Back     alignment and domain information
>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>PRK05868 hypothetical protein; Validated Back     alignment and domain information
>PRK12843 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>KOG0029 consensus Amine oxidase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PLN02852 ferredoxin-NADP+ reductase Back     alignment and domain information
>KOG2415 consensus Electron transfer flavoprotein ubiquinone oxidoreductase [Energy production and conversion] Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK06184 hypothetical protein; Provisional Back     alignment and domain information
>PF04820 Trp_halogenase: Tryptophan halogenase; InterPro: IPR006905 Tryptophan halogenase catalyses the chlorination of tryptophan to form 7-chlorotryptophan Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>PLN02697 lycopene epsilon cyclase Back     alignment and domain information
>PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated Back     alignment and domain information
>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>PTZ00188 adrenodoxin reductase; Provisional Back     alignment and domain information
>PRK08013 oxidoreductase; Provisional Back     alignment and domain information
>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK07208 hypothetical protein; Provisional Back     alignment and domain information
>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>KOG2665 consensus Predicted FAD-dependent oxidoreductase [Function unknown] Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>COG0578 GlpA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed Back     alignment and domain information
>PLN02661 Putative thiazole synthesis Back     alignment and domain information
>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>TIGR00136 gidA glucose-inhibited division protein A Back     alignment and domain information
>TIGR01790 carotene-cycl lycopene cyclase family protein Back     alignment and domain information
>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>COG0445 GidA Flavin-dependent tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated Back     alignment and domain information
>PLN02529 lysine-specific histone demethylase 1 Back     alignment and domain information
>PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>PRK08132 FAD-dependent oxidoreductase; Provisional Back     alignment and domain information
>KOG1399 consensus Flavin-containing monooxygenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK06475 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK09897 hypothetical protein; Provisional Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>PTZ00306 NADH-dependent fumarate reductase; Provisional Back     alignment and domain information
>TIGR01789 lycopene_cycl lycopene cyclase Back     alignment and domain information
>PRK10015 oxidoreductase; Provisional Back     alignment and domain information
>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK06185 hypothetical protein; Provisional Back     alignment and domain information
>PLN02785 Protein HOTHEAD Back     alignment and domain information
>COG3349 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN02568 polyamine oxidase Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PLN02268 probable polyamine oxidase Back     alignment and domain information
>TIGR02485 CobZ_N-term precorrin 3B synthase CobZ Back     alignment and domain information
>TIGR03219 salicylate_mono salicylate 1-monooxygenase Back     alignment and domain information
>PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed Back     alignment and domain information
>TIGR00275 flavoprotein, HI0933 family Back     alignment and domain information
>PLN02576 protoporphyrinogen oxidase Back     alignment and domain information
>PF01946 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K Back     alignment and domain information
>KOG0685 consensus Flavin-containing amine oxidase [Coenzyme transport and metabolism] Back     alignment and domain information
>TIGR01813 flavo_cyto_c flavocytochrome c Back     alignment and domain information
>PRK13369 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>PLN02985 squalene monooxygenase Back     alignment and domain information
>PF13454 NAD_binding_9: FAD-NAD(P)-binding Back     alignment and domain information
>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated Back     alignment and domain information
>PRK06126 hypothetical protein; Provisional Back     alignment and domain information
>PLN02328 lysine-specific histone demethylase 1 homolog Back     alignment and domain information
>PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase Back     alignment and domain information
>PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins Back     alignment and domain information
>TIGR00031 UDP-GALP_mutase UDP-galactopyranose mutase Back     alignment and domain information
>KOG0404 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06996 hypothetical protein; Provisional Back     alignment and domain information
>PRK11259 solA N-methyltryptophan oxidase; Provisional Back     alignment and domain information
>TIGR00137 gid_trmFO tRNA:m(5)U-54 methyltransferase Back     alignment and domain information
>TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6 Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>TIGR02733 desat_CrtD C-3',4' desaturase CrtD Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>KOG4254 consensus Phytoene desaturase [Coenzyme transport and metabolism] Back     alignment and domain information
>PTZ00367 squalene epoxidase; Provisional Back     alignment and domain information
>PRK07538 hypothetical protein; Provisional Back     alignment and domain information
>PF06039 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro: IPR006231 The membrane-associated enzyme, malate:quinone-oxidoreductase, is an alternative to the better-known NAD-dependent malate dehydrogenase as part of the TCA cycle Back     alignment and domain information
>COG0445 GidA Flavin-dependent tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF00890 FAD_binding_2: FAD binding domain of the Pfam family Back     alignment and domain information
>KOG1335 consensus Dihydrolipoamide dehydrogenase [Energy production and conversion] Back     alignment and domain information
>KOG2844 consensus Dimethylglycine dehydrogenase precursor [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2853 consensus Possible oxidoreductase [General function prediction only] Back     alignment and domain information
>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase Back     alignment and domain information
>PF14721 AIF_C: Apoptosis-inducing factor, mitochondrion-associated, C-term; PDB: 3GD4_A 1GV4_A 3GD3_A 1M6I_A Back     alignment and domain information
>PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional Back     alignment and domain information
>KOG2404 consensus Fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>KOG0399 consensus Glutamate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>COG1231 Monoamine oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02028 ChlP geranylgeranyl reductase Back     alignment and domain information
>KOG2820 consensus FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>TIGR02023 BchP-ChlP geranylgeranyl reductase Back     alignment and domain information
>TIGR02730 carot_isom carotene isomerase Back     alignment and domain information
>PRK07804 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK11445 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated Back     alignment and domain information
>KOG1276 consensus Protoporphyrinogen oxidase [Coenzyme transport and metabolism] Back     alignment and domain information
>TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364 Back     alignment and domain information
>KOG2614 consensus Kynurenine 3-monooxygenase and related flavoprotein monooxygenases [Energy production and conversion; General function prediction only] Back     alignment and domain information
>PLN02676 polyamine oxidase Back     alignment and domain information
>PRK08401 L-aspartate oxidase; Provisional Back     alignment and domain information
>COG3573 Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>TIGR02485 CobZ_N-term precorrin 3B synthase CobZ Back     alignment and domain information
>COG1251 NirB NAD(P)H-nitrite reductase [Energy production and conversion] Back     alignment and domain information
>PRK12834 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PF06100 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross-reactive antigen like family ; InterPro: IPR010354 Members of this family are thought to have structural features in common with the beta chain of the class II antigens, as well as myosin, and may play an important role in the pathogenesis [] Back     alignment and domain information
>TIGR00137 gid_trmFO tRNA:m(5)U-54 methyltransferase Back     alignment and domain information
>PRK12837 3-ketosteroid-delta-1-dehydrogenase; Provisional Back     alignment and domain information
>TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup Back     alignment and domain information
>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>KOG2495 consensus NADH-dehydrogenase (ubiquinone) [Energy production and conversion] Back     alignment and domain information
>PF00732 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR000172 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ] Back     alignment and domain information
>PLN00093 geranylgeranyl diphosphate reductase; Provisional Back     alignment and domain information
>PRK09078 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08275 putative oxidoreductase; Provisional Back     alignment and domain information
>COG0562 Glf UDP-galactopyranose mutase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR01811 sdhA_Bsu succinate dehydrogenase or fumarate reductase, flavoprotein subunit, Bacillus subtilis subgroup Back     alignment and domain information
>PTZ00139 Succinate dehydrogenase [ubiquinone] flavoprotein subunit; Provisional Back     alignment and domain information
>KOG2311 consensus NAD/FAD-utilizing protein possibly involved in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK12835 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>KOG2311 consensus NAD/FAD-utilizing protein possibly involved in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK02106 choline dehydrogenase; Validated Back     alignment and domain information
>COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK12844 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK12839 hypothetical protein; Provisional Back     alignment and domain information
>PRK08958 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07573 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06175 L-aspartate oxidase; Provisional Back     alignment and domain information
>TIGR00551 nadB L-aspartate oxidase Back     alignment and domain information
>PRK06263 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK13369 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK08294 phenol 2-monooxygenase; Provisional Back     alignment and domain information
>PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase Back     alignment and domain information
>PRK07057 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>COG4529 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK06854 adenylylsulfate reductase subunit alpha; Validated Back     alignment and domain information
>PLN02985 squalene monooxygenase Back     alignment and domain information
>PLN00128 Succinate dehydrogenase [ubiquinone] flavoprotein subunit Back     alignment and domain information
>PLN03000 amine oxidase Back     alignment and domain information
>PRK08205 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02976 amine oxidase Back     alignment and domain information
>PRK07803 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK12845 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>KOG2852 consensus Possible oxidoreductase [General function prediction only] Back     alignment and domain information
>KOG1346 consensus Programmed cell death 8 (apoptosis-inducing factor) [Signal transduction mechanisms] Back     alignment and domain information
>KOG2404 consensus Fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] Back     alignment and domain information
>PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G Back     alignment and domain information
>KOG1298 consensus Squalene monooxygenase [Lipid transport and metabolism] Back     alignment and domain information
>TIGR02462 pyranose_ox pyranose oxidase Back     alignment and domain information
>PRK06069 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08641 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>PRK12835 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK07395 L-aspartate oxidase; Provisional Back     alignment and domain information
>KOG2960 consensus Protein involved in thiamine biosynthesis and DNA damage tolerance [General function prediction only] Back     alignment and domain information
>PF02852 Pyr_redox_dim: Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain; InterPro: IPR004099 This entry represents a dimerisation domain that is usually found at the C-terminal of both class I and class II oxidoreductases, as well as in NADH oxidases and peroxidases [, , ] Back     alignment and domain information
>PRK08071 L-aspartate oxidase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query488
3fg2_P404 Crystal Structure Of Ferredoxin Reductase For The C 5e-35
3lxd_A415 Crystal Structure Of Ferredoxin Reductase Arr From 2e-33
3lb8_A436 Crystal Structure Of The Covalent Putidaredoxin Red 2e-33
1q1r_A431 Crystal Structure Of Putidaredoxin Reductase From P 2e-33
3ef6_A410 Crystal Structure Of Toluene 2,3-Dioxygenase Reduct 1e-24
2gr3_A408 Crystal Structure Of Ferredoxin Reductase, Bpha4 (O 3e-22
1d7y_A408 Crystal Structure Of Nadh-Dependent Ferredoxin Redu 3e-22
4fdc_B514 Crystal Structure Of The E493v Mutant Of Human Apop 5e-18
1gv4_A528 Murine Apoptosis-Inducing Factor (Aif) Length = 528 5e-18
3gd3_A535 Crystal Structure Of A Naturally Folded Murine Apop 6e-18
3gd4_A511 Crystal Structure Of The Reduced, Nad-Bound Form Of 6e-18
1m6i_A493 Crystal Structure Of Apoptosis Inducing Factor (Aif 1e-17
3iwa_A472 Crystal Structure Of A Fad-Dependent Pyridine Nucle 5e-17
1xhc_A367 Nadh Oxidase /nitrite Reductase From Pyrococcus Fur 8e-12
2cdu_A452 The Crystal Structure Of Water-Forming Nad(P)h Oxid 4e-11
3cgc_A480 Pyridine Nucleotide Complexes With Bacillus Anthrac 5e-11
1ebd_A455 Dihydrolipoamide Dehydrogenase Complexed With The B 3e-10
2eq7_A455 Crystal Structure Of Lipoamide Dehydrogenase From T 1e-09
3cgb_A480 Pyridine Nucleotide Complexes With Bacillus Anthrac 4e-09
3ntd_A 565 Structure Of The Shewanella Loihica Pv-4 Nadh-Depen 3e-08
4gcm_A312 Crystal Structure Of A Thioredoxine Reductase (Trxb 3e-08
1nhr_A447 An L40c Mutation Converts The Cysteine-Sulfenic Aci 5e-08
1joa_A447 Nadh Peroxidase With Cysteine-Sulfenic Acid Length 6e-08
1nhq_A447 Crystallographic Analyses Of Nadh Peroxidase Cys42a 6e-08
1nhs_A447 An L40c Mutation Converts The Cysteine-Sulfenic Aci 6e-08
1nhp_A447 Crystallographic Analyses Of Nadh Peroxidase Cys42a 6e-08
2woi_A495 Trypanothione Reductase From Trypanosoma Brucei Len 7e-08
2wba_A492 Properties Of Trypanothione Reductase From T. Bruce 8e-08
4dna_A463 Crystal Structure Of Putative Glutathione Reductase 1e-07
1h6v_A499 Mammalian Thioredoxin Reductase Length = 499 1e-07
3ean_A499 Crystal Structure Of Recombinant Rat Selenoprotein 1e-07
2bc1_A490 Structural Analysis Of Streptococcus Pyogenes Nadh 2e-07
2bc0_A490 Structural Analysis Of Streptococcus Pyogenes Nadh 2e-07
2v3a_A384 Crystal Structure Of Rubredoxin Reductase From Pseu 3e-07
1f8w_A447 Crystal Structure Of Nadh Peroxidase Mutant: R303m 4e-07
2hqm_A479 Crystal Structure Of Glutathione Reductase Glr1 Fro 4e-07
1zy8_A474 The Crystal Structure Of Dihydrolipoamide Dehydroge 5e-07
2zz0_A513 Crystal Structure Of Human Thioredoxin Reductase I 5e-07
2cfy_A521 Crystal Structure Of Human Thioredoxin Reductase 1 5e-07
1zmc_A474 Crystal Structure Of Human Dihydrolipoamide Dehydro 5e-07
3rnm_A495 The Crystal Structure Of The Subunit Binding Of Hum 5e-07
2j3n_A519 X-Ray Structure Of Human Thioredoxin Reductase 1 Le 5e-07
3qfa_A519 Crystal Structure Of The Human Thioredoxin Reductas 5e-07
3nta_A 574 Structure Of The Shewanella Loihica Pv-4 Nadh-Depen 7e-07
3nt6_A 574 Structure Of The Shewanella Loihica Pv-4 Nadh-Depen 8e-07
3klj_A385 Crystal Structure Of Nadh:rubredoxin Oxidoreductase 1e-06
1nda_A491 The Structure Of Trypanosoma Cruzi Trypanothione Re 1e-06
1gxf_A492 Crystal Structure Of Trypanosoma Cruzi Trypanothion 1e-06
1aog_A485 Trypanosoma Cruzi Trypanothione Reductase (Oxidized 1e-06
1bzl_A486 Crystal Structure Of Trypanosoma Cruzi Trypanothion 2e-06
1ger_A450 The Structure Of Glutathione Reductase From Escheri 2e-06
1dxl_A470 Dihydrolipoamide Dehydrogenase Of Glycine Decarboxy 1e-05
4eqw_A437 Crystal Structure Of The Y361f, Y419f Mutant Of Sta 1e-05
4eqs_A437 Crystal Structure Of The Y419f Mutant Of Staphyloco 1e-05
4eqr_A437 Crystal Structure Of The Y361f Mutant Of Staphyloco 1e-05
4emw_A436 Crystal Structure Of Staphylococcus Aureus Bound Wi 1e-05
4em3_A437 Crystal Structure Of Staphylococcus Aureus Bound Wi 1e-05
1yqz_A438 Structure Of Coenzyme A-Disulfide Reductase From St 1e-05
4eqx_A437 Crystal Structure Of The C43s Mutant Of Staphylococ 2e-05
3dgz_A488 Crystal Structure Of Mouse Mitochondrial Thioredoxi 2e-05
1zdl_A517 Crystal Structure Of Mouse Thioredoxin Reductase Ty 2e-05
3icr_A 588 Crystal Structure Of Oxidized Bacillus Anthracis Co 3e-05
1ges_A450 Anatomy Of An Engineered Nad-Binding Site Length = 8e-05
3ab1_A360 Crystal Structure Of Ferredoxin Nadp+ Oxidoreductas 8e-05
3oc4_A452 Crystal Structure Of A Pyridine Nucleotide-Disulfid 1e-04
3urh_A491 Crystal Structure Of A Dihydrolipoamide Dehydrogena 1e-04
3l8k_A466 Crystal Structure Of A Dihydrolipoyl Dehydrogenase 1e-04
1onf_A500 Crystal Structure Of Plasmodium Falciparum Glutathi 1e-04
1lvl_A458 The Refined Structure Of Pseudomonas Putida Lipoami 2e-04
4b1b_A542 Crystal Structure Of Plasmodium Falciparum Oxidised 7e-04
2r9z_A463 Glutathione Amide Reductase From Chromatium Gracile 7e-04
>pdb|3FG2|P Chain P, Crystal Structure Of Ferredoxin Reductase For The Cyp199a2 System From Rhodopseudomonas Palustris Length = 404 Back     alignment and structure

Iteration: 1

Score = 145 bits (366), Expect = 5e-35, Method: Compositional matrix adjust. Identities = 101/343 (29%), Positives = 164/343 (47%), Gaps = 27/343 (7%) Query: 53 EFVIVGGGNAAGYAARTFVEHGMADGRLCIVSKEAYAPYERPALTKGYLFPLDKKPARLP 112 + V++ G AG+ + GR+ +++ E + PY+RP L+K YL Sbjct: 2 DTVLIAGAGHAGFQVAVSLRQAKYPGRIALINDEKHLPYQRPPLSKAYL----------- 50 Query: 113 GFHTCVGSGGERQT----PE-WYKEKGIEMIYQDPVTSIDIEKQTLITNSGKLLKYGSLI 167 SGG+ + PE +++++ IE+I D + SID E + L+ SG ++YG L+ Sbjct: 51 ------KSGGDPNSLMFRPEKFFQDQAIELI-SDRMVSIDREGRKLLLASGTAIEYGHLV 103 Query: 168 VATGCTASRFPEKIGGYLPGVHYIRDVADADALISSLEKAKKXXXXXXXYIGMEVAAAAV 227 +ATG +R + LP V Y+R + +++ L + K +IG+E AA A Sbjct: 104 LATGAR-NRMLDVPNASLPDVLYLRTLDESEVLRQRMPDKKHVVVIGAGFIGLEFAATAR 162 Query: 228 GWKLDTTIIFPENHLLQRLFTPSLAQRYEQLYQQNGVKFVKGASIKNLEAGSDGRVAAVK 287 L+ ++ ++ R+ TP ++ + + G++ G + A D RV V Sbjct: 163 AKGLEVDVVELAPRVMARVVTPEISSYFHDRHSGAGIRMHYGVRATEIAAEGD-RVTGVV 221 Query: 288 LEDGSTIDADTIVIGIGAKPTVSPFERVGLNSSVGGIQVDGQFRTRMPGIFAIGDVAAFP 347 L DG+T+ D +V+G+G P V + GI VD Q T P I AIGD A F Sbjct: 222 LSDGNTLPCDLVVVGVGVIPNVE-IAAAAGLPTAAGIIVDQQLLTSDPHISAIGDCALFE 280 Query: 348 LKMYDRTARVEHVDHARQSAQHCIKALLSAQTHTYDYLPYFYS 390 + T RVE V +A A+ C+ A L+ YD P+F+S Sbjct: 281 SVRFGETMRVESVQNATDQAR-CVAARLTGDAKPYDGYPWFWS 322
>pdb|3LXD|A Chain A, Crystal Structure Of Ferredoxin Reductase Arr From Novosphingobium Aromaticivorans Length = 415 Back     alignment and structure
>pdb|3LB8|A Chain A, Crystal Structure Of The Covalent Putidaredoxin Reductase- Putidaredoxin Complex Length = 436 Back     alignment and structure
>pdb|1Q1R|A Chain A, Crystal Structure Of Putidaredoxin Reductase From Pseudomonas Putida Length = 431 Back     alignment and structure
>pdb|3EF6|A Chain A, Crystal Structure Of Toluene 2,3-Dioxygenase Reductase Length = 410 Back     alignment and structure
>pdb|2GR3|A Chain A, Crystal Structure Of Ferredoxin Reductase, Bpha4 (Oxidized Form) Length = 408 Back     alignment and structure
>pdb|1D7Y|A Chain A, Crystal Structure Of Nadh-Dependent Ferredoxin Reductase, Bpha4 Length = 408 Back     alignment and structure
>pdb|4FDC|B Chain B, Crystal Structure Of The E493v Mutant Of Human Apoptosis Inducing Factor (Aif) Length = 514 Back     alignment and structure
>pdb|1GV4|A Chain A, Murine Apoptosis-Inducing Factor (Aif) Length = 528 Back     alignment and structure
>pdb|3GD3|A Chain A, Crystal Structure Of A Naturally Folded Murine Apoptosis Inducing Factor Length = 535 Back     alignment and structure
>pdb|3GD4|A Chain A, Crystal Structure Of The Reduced, Nad-Bound Form Of Murine Apoptosis Inducing Factor Length = 511 Back     alignment and structure
>pdb|1M6I|A Chain A, Crystal Structure Of Apoptosis Inducing Factor (Aif) Length = 493 Back     alignment and structure
>pdb|3IWA|A Chain A, Crystal Structure Of A Fad-Dependent Pyridine Nucleotide-Disulphide Oxidoreductase From Desulfovibrio Vulgaris Length = 472 Back     alignment and structure
>pdb|1XHC|A Chain A, Nadh Oxidase /nitrite Reductase From Pyrococcus Furiosus Pfu-1140779- 001 Length = 367 Back     alignment and structure
>pdb|2CDU|A Chain A, The Crystal Structure Of Water-Forming Nad(P)h Oxidase From Lactobacillus Sanfranciscensis Length = 452 Back     alignment and structure
>pdb|3CGC|A Chain A, Pyridine Nucleotide Complexes With Bacillus Anthracis Coenzyme A- Disulfide Reductase: A Structural Analysis Of Dual Nad(p)h Specificity Length = 480 Back     alignment and structure
>pdb|1EBD|A Chain A, Dihydrolipoamide Dehydrogenase Complexed With The Binding Domain Of The Dihydrolipoamide Acetylase Length = 455 Back     alignment and structure
>pdb|2EQ7|A Chain A, Crystal Structure Of Lipoamide Dehydrogenase From Thermus Thermophilus Hb8 With Psbdo Length = 455 Back     alignment and structure
>pdb|3CGB|A Chain A, Pyridine Nucleotide Complexes With Bacillus Anthracis Coenzyme A- Disulfide Reductase: A Structural Analysis Of Dual Nad(P)h Specificity Length = 480 Back     alignment and structure
>pdb|3NTD|A Chain A, Structure Of The Shewanella Loihica Pv-4 Nadh-Dependent Persulfide Reductase C531s Mutant Length = 565 Back     alignment and structure
>pdb|4GCM|A Chain A, Crystal Structure Of A Thioredoxine Reductase (Trxb) From Staphylococcus Aureus Subsp. Aureus Mu50 At 1.80 A Resolution Length = 312 Back     alignment and structure
>pdb|1NHR|A Chain A, An L40c Mutation Converts The Cysteine-Sulfenic Acid Redox Centre In Enterococcal Nadh Peroxidase To A Disulfide Length = 447 Back     alignment and structure
>pdb|1JOA|A Chain A, Nadh Peroxidase With Cysteine-Sulfenic Acid Length = 447 Back     alignment and structure
>pdb|1NHQ|A Chain A, Crystallographic Analyses Of Nadh Peroxidase Cys42ala And Cys42ser Mutants: Active Site Structure, Mechanistic Implications, And An Unusual Environment Of Arg303 Length = 447 Back     alignment and structure
>pdb|1NHS|A Chain A, An L40c Mutation Converts The Cysteine-Sulfenic Acid Redox Centre In Enterococcal Nadh Peroxidase To A Disulfide Length = 447 Back     alignment and structure
>pdb|1NHP|A Chain A, Crystallographic Analyses Of Nadh Peroxidase Cys42ala And Cys42ser Mutants: Active Site Structure, Mechanistic Implications, And An Unusual Environment Of Arg303 Length = 447 Back     alignment and structure
>pdb|2WOI|A Chain A, Trypanothione Reductase From Trypanosoma Brucei Length = 495 Back     alignment and structure
>pdb|2WBA|A Chain A, Properties Of Trypanothione Reductase From T. Brucei Length = 492 Back     alignment and structure
>pdb|4DNA|A Chain A, Crystal Structure Of Putative Glutathione Reductase From Sinorhizobium Meliloti 1021 Length = 463 Back     alignment and structure
>pdb|1H6V|A Chain A, Mammalian Thioredoxin Reductase Length = 499 Back     alignment and structure
>pdb|3EAN|A Chain A, Crystal Structure Of Recombinant Rat Selenoprotein Thioredoxin Reductase 1 With Reduced C-Terminal Tail Length = 499 Back     alignment and structure
>pdb|2BC1|A Chain A, Structural Analysis Of Streptococcus Pyogenes Nadh Oxidase: C44s Nox Length = 490 Back     alignment and structure
>pdb|2BC0|A Chain A, Structural Analysis Of Streptococcus Pyogenes Nadh Oxidase: Wild-Type Nox Length = 490 Back     alignment and structure
>pdb|2V3A|A Chain A, Crystal Structure Of Rubredoxin Reductase From Pseudomonas Aeruginosa. Length = 384 Back     alignment and structure
>pdb|1F8W|A Chain A, Crystal Structure Of Nadh Peroxidase Mutant: R303m Length = 447 Back     alignment and structure
>pdb|2HQM|A Chain A, Crystal Structure Of Glutathione Reductase Glr1 From The Yeast Saccharomyces Cerevisiae Length = 479 Back     alignment and structure
>pdb|1ZY8|A Chain A, The Crystal Structure Of Dihydrolipoamide Dehydrogenase And Dihydrolipoamide Dehydrogenase-Binding Protein (Didomain) Subcomplex Of Human Pyruvate Dehydrogenase Complex. Length = 474 Back     alignment and structure
>pdb|2ZZ0|A Chain A, Crystal Structure Of Human Thioredoxin Reductase I (Secys 498 Cys) Length = 513 Back     alignment and structure
>pdb|2CFY|A Chain A, Crystal Structure Of Human Thioredoxin Reductase 1 Length = 521 Back     alignment and structure
>pdb|1ZMC|A Chain A, Crystal Structure Of Human Dihydrolipoamide Dehydrogenase Complexed To Nad+ Length = 474 Back     alignment and structure
>pdb|3RNM|A Chain A, The Crystal Structure Of The Subunit Binding Of Human Dihydrolipoamide Transacylase (E2b) Bound To Human Dihydrolipoamide Dehydrogenase (E3) Length = 495 Back     alignment and structure
>pdb|2J3N|A Chain A, X-Ray Structure Of Human Thioredoxin Reductase 1 Length = 519 Back     alignment and structure
>pdb|3QFA|A Chain A, Crystal Structure Of The Human Thioredoxin Reductase-Thioredoxin Complex Length = 519 Back     alignment and structure
>pdb|3NTA|A Chain A, Structure Of The Shewanella Loihica Pv-4 Nadh-Dependent Persulfide Reductase Length = 574 Back     alignment and structure
>pdb|3NT6|A Chain A, Structure Of The Shewanella Loihica Pv-4 Nadh-Dependent Persulfide Reductase C43sC531S DOUBLE MUTANT Length = 574 Back     alignment and structure
>pdb|3KLJ|A Chain A, Crystal Structure Of Nadh:rubredoxin Oxidoreductase From Clostridium Acetobutylicum Length = 385 Back     alignment and structure
>pdb|1NDA|A Chain A, The Structure Of Trypanosoma Cruzi Trypanothione Reductase In The Oxidized And Nadph Reduced State Length = 491 Back     alignment and structure
>pdb|1GXF|A Chain A, Crystal Structure Of Trypanosoma Cruzi Trypanothione Reductase In Complex With The Inhibitor Quinacrine Mustard Length = 492 Back     alignment and structure
>pdb|1AOG|A Chain A, Trypanosoma Cruzi Trypanothione Reductase (Oxidized Form) Length = 485 Back     alignment and structure
>pdb|1BZL|A Chain A, Crystal Structure Of Trypanosoma Cruzi Trypanothione Reductase In Complex With Trypanothione, And The Structure- Based Discovery Of New Natural Product Inhibitors Length = 486 Back     alignment and structure
>pdb|1GER|A Chain A, The Structure Of Glutathione Reductase From Escherichia Coli At 1.86 Angstroms Resolution: Comparison With The Enzyme From Human Erythrocytes Length = 450 Back     alignment and structure
>pdb|1DXL|A Chain A, Dihydrolipoamide Dehydrogenase Of Glycine Decarboxylase From Pisum Sativum Length = 470 Back     alignment and structure
>pdb|4EQW|A Chain A, Crystal Structure Of The Y361f, Y419f Mutant Of Staphylococcus Aureus Coadr Length = 437 Back     alignment and structure
>pdb|4EQS|A Chain A, Crystal Structure Of The Y419f Mutant Of Staphylococcus Aureus Coadr Length = 437 Back     alignment and structure
>pdb|4EQR|A Chain A, Crystal Structure Of The Y361f Mutant Of Staphylococcus Aureus Coadr Length = 437 Back     alignment and structure
>pdb|4EMW|A Chain A, Crystal Structure Of Staphylococcus Aureus Bound With The Covalent Inhibitor Etvc-Coa Length = 436 Back     alignment and structure
>pdb|4EM3|A Chain A, Crystal Structure Of Staphylococcus Aureus Bound With The Covalent Inhibitor Mevs-Coa Length = 437 Back     alignment and structure
>pdb|1YQZ|A Chain A, Structure Of Coenzyme A-Disulfide Reductase From Staphylococcus Aureus Refined At 1.54 Angstrom Resolution Length = 438 Back     alignment and structure
>pdb|4EQX|A Chain A, Crystal Structure Of The C43s Mutant Of Staphylococcus Aureus Coadr Length = 437 Back     alignment and structure
>pdb|3DGZ|A Chain A, Crystal Structure Of Mouse Mitochondrial Thioredoxin Reductase, C- Terminal 3-Residue Truncation Length = 488 Back     alignment and structure
>pdb|1ZDL|A Chain A, Crystal Structure Of Mouse Thioredoxin Reductase Type 2 Length = 517 Back     alignment and structure
>pdb|3ICR|A Chain A, Crystal Structure Of Oxidized Bacillus Anthracis Coadr-Rhd Length = 588 Back     alignment and structure
>pdb|1GES|A Chain A, Anatomy Of An Engineered Nad-Binding Site Length = 450 Back     alignment and structure
>pdb|3AB1|A Chain A, Crystal Structure Of Ferredoxin Nadp+ Oxidoreductase Length = 360 Back     alignment and structure
>pdb|3OC4|A Chain A, Crystal Structure Of A Pyridine Nucleotide-Disulfide Family Oxidoreductase From The Enterococcus Faecalis V583 Length = 452 Back     alignment and structure
>pdb|3URH|A Chain A, Crystal Structure Of A Dihydrolipoamide Dehydrogenase From Sinorhizobium Meliloti 1021 Length = 491 Back     alignment and structure
>pdb|3L8K|A Chain A, Crystal Structure Of A Dihydrolipoyl Dehydrogenase From Sulfolobus Solfataricus Length = 466 Back     alignment and structure
>pdb|1ONF|A Chain A, Crystal Structure Of Plasmodium Falciparum Glutathione Reductase Length = 500 Back     alignment and structure
>pdb|1LVL|A Chain A, The Refined Structure Of Pseudomonas Putida Lipoamide Dehydrogenase Complexed With Nad+ At 2.45 Angstroms Resolution Length = 458 Back     alignment and structure
>pdb|4B1B|A Chain A, Crystal Structure Of Plasmodium Falciparum Oxidised Thioredoxin Reductase At 2.9 Angstrom Length = 542 Back     alignment and structure
>pdb|2R9Z|A Chain A, Glutathione Amide Reductase From Chromatium Gracile Length = 463 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query488
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 1e-108
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 1e-104
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 1e-102
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 1e-101
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 1e-101
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 1e-101
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 7e-67
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 2e-61
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 7e-05
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 1e-53
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 4e-48
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 2e-47
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 9e-46
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 3e-45
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 9e-45
3ics_A 588 Coenzyme A-disulfide reductase; pyridine nucleotid 7e-44
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 7e-44
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 1e-43
1yqz_A438 Coenzyme A disulfide reductase; oxidoreductase; HE 3e-42
3ntd_A 565 FAD-dependent pyridine nucleotide-disulphide oxido 2e-40
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 1e-26
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 1e-26
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 2e-26
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 5e-26
4dna_A463 Probable glutathione reductase; structural genomic 1e-25
1fec_A490 Trypanothione reductase; redox-active center, oxid 2e-25
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 1e-24
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 9e-24
3h8l_A409 NADH oxidase; membrane protein, complete form, ros 2e-23
3h8l_A 409 NADH oxidase; membrane protein, complete form, ros 3e-05
3h28_A430 Sulfide-quinone reductase; monotopic membrane prot 5e-23
3h28_A 430 Sulfide-quinone reductase; monotopic membrane prot 1e-07
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 2e-22
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 2e-22
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 4e-22
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 9e-22
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 1e-21
4fk1_A304 Putative thioredoxin reductase; structural genomic 2e-21
3sx6_A437 Sulfide-quinone reductase, putative; sulfide:quino 4e-21
3sx6_A 437 Sulfide-quinone reductase, putative; sulfide:quino 4e-07
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 8e-21
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 2e-20
3l8k_A466 Dihydrolipoyl dehydrogenase; redox-active center, 2e-20
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 4e-20
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 5e-19
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 7e-19
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 1e-18
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 7e-18
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 1e-17
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 2e-17
1ojt_A482 Surface protein; redox-active center, glycolysis, 3e-17
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 3e-17
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 7e-17
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 1e-16
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 2e-16
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 3e-16
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 3e-16
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 7e-16
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 2e-15
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 2e-15
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 3e-15
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 7e-15
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 1e-14
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 3e-14
1fcd_A401 Flavocytochrome C sulfide dehydrogenase (flavin- b 1e-13
1fcd_A 401 Flavocytochrome C sulfide dehydrogenase (flavin- b 9e-04
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 5e-13
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 1e-11
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 4e-11
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 1e-10
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 9e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-09
3r9u_A315 Thioredoxin reductase; structural genomics, center 1e-08
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 4e-08
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 4e-07
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 1e-06
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 1e-06
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 5e-06
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 5e-06
1lqt_A456 FPRA; NADP+ derivative, oxidoreductase, structural 3e-04
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 3e-04
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 4e-04
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Length = 493 Back     alignment and structure
 Score =  328 bits (843), Expect = e-108
 Identities = 103/436 (23%), Positives = 177/436 (40%), Gaps = 41/436 (9%)

Query: 50  ENREFVIVGGGNAAGYAARTFVEHGMADGRLCIVSKEAYAPYERPALTKGYLFPLDKKPA 109
            +  F+++GGG AA  AAR+         R+ IVS++   PY RP L+K         P 
Sbjct: 10  SHVPFLLIGGGTAAFAAARSIRARD-PGARVLIVSEDPELPYMRPPLSKELW--FSDDPN 66

Query: 110 RLPGFHTCVGSGGER----QTPEWY---------KEKGIEMIYQDPVTSIDIEKQTLITN 156
                     +G ER    Q P +Y         +  G+ ++    V  +D+    +  N
Sbjct: 67  VTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMVKLN 126

Query: 157 SGKLLKYGSLIVATGCTASRFP--EKIGGYLPG-VHYIRDVADADALISSLEKAKKVVVV 213
            G  + Y   ++ATG T       ++ G  +       R + D  +L     + K + ++
Sbjct: 127 DGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITII 186

Query: 214 GGGYIGMEVAAA----AVGWKLDTTIIFPENHLLQRLFTPSLAQRYEQLYQQNGVKFVKG 269
           GGG++G E+A A    A     +   +FPE   + ++    L+    +  ++ GVK +  
Sbjct: 187 GGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPN 246

Query: 270 ASIKNLEAGSDGRVAAVKLEDGSTIDADTIVIGIGAKPTVSPFERVGL--NSSVGGIQVD 327
           A ++++          +KL+DG  ++ D IV  +G +P V   +  GL  +S  GG +V+
Sbjct: 247 AIVQSVGV--SSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVN 304

Query: 328 GQFRTRMPGIFAIGDVAAFPLKMYDRTARVEHVDHARQSAQHCIKALLSAQTHTYDYLPY 387
            + + R   I+  GD A F      R  RVEH DHA  S +   + +  A    Y +   
Sbjct: 305 AELQAR-SNIWVAGDAACFYDIKLGRR-RVEHHDHAVVSGRLAGENMTGAAKP-YWHQSM 361

Query: 388 FYSRVFEYEGSPRKVWWQFFGDNVGETIEIGNFDPKIA-----TFWIDSGKLKGVLVESG 442
           F+S +   +     V ++  G        +G F    A     +    SG       E+ 
Sbjct: 362 FWSDLG-PD-----VGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETE 415

Query: 443 SPEEFQLLPTLARSQP 458
           S      +P    + P
Sbjct: 416 SEASEITIPPSTPAVP 431


>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Length = 431 Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Length = 404 Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Length = 408 Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Length = 415 Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} Length = 410 Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Length = 384 Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Length = 385 Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Length = 385 Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Length = 367 Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Length = 452 Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Length = 452 Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Length = 447 Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Length = 472 Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Length = 490 Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Length = 588 Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Length = 449 Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Length = 480 Back     alignment and structure
>1yqz_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.54A {Staphylococcus aureus} Length = 438 Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Length = 565 Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Length = 500 Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Length = 484 Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Length = 450 Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Length = 495 Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Length = 463 Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Length = 490 Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Length = 479 Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Length = 463 Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Length = 409 Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Length = 409 Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Length = 483 Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Length = 488 Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Length = 478 Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Length = 523 Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Length = 499 Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Length = 304 Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Length = 437 Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Length = 437 Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Length = 519 Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Length = 335 Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Length = 466 Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Length = 360 Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Length = 598 Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Length = 455 Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Length = 458 Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Length = 464 Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Length = 467 Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Length = 455 Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Length = 482 Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Length = 464 Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Length = 474 Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Length = 332 Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Length = 491 Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Length = 470 Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Length = 478 Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Length = 476 Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Length = 468 Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Length = 297 Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Length = 521 Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Length = 492 Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Length = 319 Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Length = 310 Back     alignment and structure
>1fcd_A Flavocytochrome C sulfide dehydrogenase (flavin- binding subunit); electron transport(flavocytochrome); HET: FAD HEM; 2.53A {Allochromatium vinosum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Length = 401 Back     alignment and structure
>1fcd_A Flavocytochrome C sulfide dehydrogenase (flavin- binding subunit); electron transport(flavocytochrome); HET: FAD HEM; 2.53A {Allochromatium vinosum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Length = 401 Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Length = 1025 Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Length = 323 Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Length = 690 Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Length = 311 Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Length = 357 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Length = 315 Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Length = 325 Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Length = 671 Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Length = 456 Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Length = 729 Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Length = 335 Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Length = 369 Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Length = 456 Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Length = 333 Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Length = 320 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query488
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 100.0
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 100.0
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 100.0
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 100.0
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 100.0
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 100.0
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 100.0
4eqs_A437 Coenzyme A disulfide reductase; oxidoreductase; HE 100.0
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 100.0
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 100.0
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 100.0
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 100.0
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 100.0
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 100.0
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 100.0
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 100.0
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 100.0
3ntd_A 565 FAD-dependent pyridine nucleotide-disulphide oxido 100.0
3ics_A 588 Coenzyme A-disulfide reductase; pyridine nucleotid 100.0
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 100.0
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 100.0
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 100.0
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 100.0
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 100.0
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 100.0
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 100.0
1ojt_A482 Surface protein; redox-active center, glycolysis, 100.0
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 100.0
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 100.0
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 100.0
3l8k_A466 Dihydrolipoyl dehydrogenase; redox-active center, 100.0
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 100.0
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 100.0
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 100.0
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 100.0
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 100.0
1fec_A490 Trypanothione reductase; redox-active center, oxid 100.0
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 100.0
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 100.0
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 100.0
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 100.0
4dna_A463 Probable glutathione reductase; structural genomic 100.0
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 100.0
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 100.0
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 100.0
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 100.0
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 100.0
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 100.0
4g6h_A502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 100.0
4b1b_A542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 100.0
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 100.0
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 100.0
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 100.0
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 100.0
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 100.0
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 100.0
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 100.0
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 100.0
3hyw_A430 Sulfide-quinone reductase; monotopic membrane prot 100.0
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 100.0
3vrd_B401 FCCB subunit, flavocytochrome C flavin subunit; su 100.0
3h8l_A409 NADH oxidase; membrane protein, complete form, ros 100.0
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 100.0
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 100.0
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 100.0
3sx6_A437 Sulfide-quinone reductase, putative; sulfide:quino 100.0
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 100.0
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 100.0
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 100.0
3r9u_A315 Thioredoxin reductase; structural genomics, center 100.0
4fk1_A304 Putative thioredoxin reductase; structural genomic 100.0
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 100.0
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 100.0
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 100.0
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 100.0
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 100.0
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 100.0
3h28_A430 Sulfide-quinone reductase; monotopic membrane prot 100.0
1cjc_A460 Protein (adrenodoxin reductase); flavoenzyme, MAD 99.97
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 99.97
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 99.97
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 99.97
1lqt_A456 FPRA; NADP+ derivative, oxidoreductase, structural 99.97
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 99.97
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 99.97
1y56_A493 Hypothetical protein PH1363; dehydrogenase, protei 99.97
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 99.96
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 99.96
3gwf_A540 Cyclohexanone monooxygenase; flavoprotein biocatal 99.95
3uox_A545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 99.93
4ap3_A549 Steroid monooxygenase; oxidoreductase, baeyer-vill 99.93
1w4x_A542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 99.92
2ywl_A180 Thioredoxin reductase related protein; uncharacter 99.88
4b63_A501 L-ornithine N5 monooxygenase; oxidoreductase, side 99.81
2e5v_A472 L-aspartate oxidase; archaea, oxidoreductase; HET: 99.71
2cul_A232 Glucose-inhibited division protein A-related PROT 99.61
3fpz_A326 Thiazole biosynthetic enzyme; FAD, mitochondrion, 99.55
2gqf_A401 Hypothetical protein HI0933; structural genomics, 99.48
3k7m_X431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 99.23
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 99.18
1kf6_A 602 Fumarate reductase flavoprotein; respiration, fuma 99.12
2ywl_A180 Thioredoxin reductase related protein; uncharacter 99.12
2bry_A497 NEDD9 interacting protein with calponin homology a 99.07
2zxi_A 637 TRNA uridine 5-carboxymethylaminomethyl modificat 99.04
1chu_A540 Protein (L-aspartate oxidase); flavoenzyme, NAD bi 98.98
3dme_A369 Conserved exported protein; structural genomics, P 98.98
4dgk_A501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 98.96
3v76_A417 Flavoprotein; structural genomics, PSI-biology, NE 98.92
3pl8_A 623 Pyranose 2-oxidase; substrate complex, H167A mutan 98.91
2bry_A497 NEDD9 interacting protein with calponin homology a 98.9
2cul_A232 Glucose-inhibited division protein A-related PROT 98.89
3ces_A 651 MNMG, tRNA uridine 5-carboxymethylaminomethyl modi 98.88
3alj_A379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 98.84
3nlc_A549 Uncharacterized protein VP0956; FAD-binding protei 98.83
3nix_A421 Flavoprotein/dehydrogenase; structural genomics, P 98.81
3pvc_A689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 98.8
2e4g_A 550 Tryptophan halogenase; flavin-binding, rebeccamyci 98.79
2i0z_A447 NAD(FAD)-utilizing dehydrogenases; structural geno 98.77
2gag_B405 Heterotetrameric sarcosine oxidase beta-subunit; f 98.77
1s3e_A520 Amine oxidase [flavin-containing] B; human monoami 98.77
1d4d_A572 Flavocytochrome C fumarate reductase; oxidoreducta 98.77
3ps9_A676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 98.75
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 98.74
3axb_A448 Putative oxidoreductase; dinucleotide-binding fold 98.74
2vou_A397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 98.72
3dje_A438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 98.71
2x3n_A399 Probable FAD-dependent monooxygenase; oxidoreducta 98.7
3i3l_A591 Alkylhalidase CMLS; flavin-dependent halogenase, c 98.7
3nlc_A549 Uncharacterized protein VP0956; FAD-binding protei 98.7
3fmw_A570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 98.68
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 98.67
2xdo_A398 TETX2 protein; tetracycline degradation, tigecycli 98.66
3qj4_A342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 98.62
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 98.62
2gf3_A389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 98.62
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 98.62
3nrn_A421 Uncharacterized protein PF1083; alpha-beta protein 98.59
3ihg_A535 RDME; flavoenzyme, anthracycline, polyketide biosy 98.58
3nyc_A381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 98.58
3e1t_A512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 98.57
1y56_B382 Sarcosine oxidase; dehydrogenase, protein-protein 98.56
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 98.55
3oz2_A397 Digeranylgeranylglycerophospholipid reductase; str 98.54
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 98.54
3rp8_A407 Flavoprotein monooxygenase; FAD-binding protein, o 98.54
3v76_A417 Flavoprotein; structural genomics, PSI-biology, NE 98.53
2qa1_A500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 98.53
1qo8_A566 Flavocytochrome C3 fumarate reductase; oxidoreduct 98.5
1y0p_A571 Fumarate reductase flavoprotein subunit; flavocyto 98.5
2qa2_A499 CABE, polyketide oxygenase CABE; FAD, angucycline, 98.5
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 98.49
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 98.49
2gmh_A 584 Electron transfer flavoprotein-ubiquinone oxidored 98.49
3atr_A453 Conserved archaeal protein; saturating double bond 98.49
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 98.49
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 98.48
4ap3_A 549 Steroid monooxygenase; oxidoreductase, baeyer-vill 98.48
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 98.47
1k0i_A394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 98.46
3sx6_A 437 Sulfide-quinone reductase, putative; sulfide:quino 98.45
3alj_A379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 98.45
3gwf_A 540 Cyclohexanone monooxygenase; flavoprotein biocatal 98.44
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 98.44
2uzz_A372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 98.43
2gqf_A401 Hypothetical protein HI0933; structural genomics, 98.43
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 98.42
4hb9_A412 Similarities with probable monooxygenase; flavin, 98.39
3hyw_A 430 Sulfide-quinone reductase; monotopic membrane prot 98.39
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 98.39
1qo8_A566 Flavocytochrome C3 fumarate reductase; oxidoreduct 98.38
3cp8_A 641 TRNA uridine 5-carboxymethylaminomethyl modificati 98.38
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 98.37
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 98.36
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 98.35
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 98.35
2xve_A 464 Flavin-containing monooxygenase; oxidoreductase; H 98.34
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 98.34
2i0z_A447 NAD(FAD)-utilizing dehydrogenases; structural geno 98.34
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 98.33
3oz2_A397 Digeranylgeranylglycerophospholipid reductase; str 98.33
3uox_A 545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 98.33
3vrd_B 401 FCCB subunit, flavocytochrome C flavin subunit; su 98.33
2oln_A397 NIKD protein; flavoprotein, rossmann fold, oxidore 98.32
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 98.32
3h8l_A 409 NADH oxidase; membrane protein, complete form, ros 98.32
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 98.31
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 98.31
4at0_A510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 98.31
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 98.31
4eqs_A437 Coenzyme A disulfide reductase; oxidoreductase; HE 98.3
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 98.3
4fk1_A304 Putative thioredoxin reductase; structural genomic 98.3
3ef6_A 410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 98.3
1q1r_A 431 Putidaredoxin reductase; glutathione reductase fol 98.3
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 98.29
3fg2_P 404 Putative rubredoxin reductase; ferredoxin reductas 98.29
3c96_A410 Flavin-containing monooxygenase; FAD, oxidoreducta 98.29
2aqj_A538 Tryptophan halogenase, pRNA; flavin-dependent halo 98.28
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 98.28
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 98.28
2x3n_A399 Probable FAD-dependent monooxygenase; oxidoreducta 98.27
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 98.26
3h28_A 430 Sulfide-quinone reductase; monotopic membrane prot 98.26
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 98.24
1y0p_A571 Fumarate reductase flavoprotein subunit; flavocyto 98.24
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 98.24
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 98.24
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 98.23
3ics_A588 Coenzyme A-disulfide reductase; pyridine nucleotid 98.23
2qcu_A501 Aerobic glycerol-3-phosphate dehydrogenase; glycer 98.22
1fec_A490 Trypanothione reductase; redox-active center, oxid 98.22
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 98.21
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 98.21
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 98.2
2wdq_A 588 Succinate dehydrogenase flavoprotein subunit; succ 98.2
4b1b_A542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 98.19
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 98.18
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 98.18
1ojt_A482 Surface protein; redox-active center, glycolysis, 98.18
2vou_A397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 98.18
3c4n_A405 Uncharacterized protein DR_0571; alpha-beta protei 98.17
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 98.16
1k0i_A394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 98.16
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 98.16
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 98.15
3kd9_A 449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 98.15
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 98.15
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 98.15
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 98.15
1w4x_A 542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 98.14
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 98.14
2dkh_A 639 3-hydroxybenzoate hydroxylase; flavoprotein, monoo 98.14
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 98.13
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 98.12
2h88_A 621 Succinate dehydrogenase flavoprotein subunit; comp 98.12
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 98.11
3ces_A 651 MNMG, tRNA uridine 5-carboxymethylaminomethyl modi 98.1
2r0c_A549 REBC; flavin adenine dinucleotide, monooxygenase, 98.1
2weu_A511 Tryptophan 5-halogenase; regioselectivity, antifun 98.1
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 98.1
3oc4_A 452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 98.1
1y56_B382 Sarcosine oxidase; dehydrogenase, protein-protein 98.1
2zxi_A 637 TRNA uridine 5-carboxymethylaminomethyl modificat 98.09
3da1_A 561 Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 98.09
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 98.09
1pj5_A 830 N,N-dimethylglycine oxidase; channelling, FAD bind 98.08
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 98.08
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 98.08
3r9u_A315 Thioredoxin reductase; structural genomics, center 98.07
4hb9_A412 Similarities with probable monooxygenase; flavin, 98.07
2bs2_A 660 Quinol-fumarate reductase flavoprotein subunit A; 98.06
3gyx_A 662 Adenylylsulfate reductase; oxidoreductase; HET: FA 98.06
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 98.05
3iwa_A 472 FAD-dependent pyridine nucleotide-disulphide oxido 98.05
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 98.05
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 98.05
3atr_A 453 Conserved archaeal protein; saturating double bond 98.05
2gmh_A 584 Electron transfer flavoprotein-ubiquinone oxidored 98.04
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 98.02
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 98.01
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 98.01
3cp8_A 641 TRNA uridine 5-carboxymethylaminomethyl modificati 98.0
3i3l_A 591 Alkylhalidase CMLS; flavin-dependent halogenase, c 97.99
2gjc_A326 Thiazole biosynthetic enzyme, mitochondrial; gluta 97.99
4dna_A463 Probable glutathione reductase; structural genomic 97.98
3e1t_A 512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 97.98
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 97.98
2uzz_A372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 97.97
3qj4_A342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 97.97
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 97.95
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 97.94
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 97.93
3rp8_A407 Flavoprotein monooxygenase; FAD-binding protein, o 97.93
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 97.92
2xdo_A398 TETX2 protein; tetracycline degradation, tigecycli 97.91
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 97.9
3ihg_A 535 RDME; flavoenzyme, anthracycline, polyketide biosy 97.9
2gjc_A326 Thiazole biosynthetic enzyme, mitochondrial; gluta 97.88
3fmw_A 570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 97.88
4gde_A513 UDP-galactopyranose mutase; flavin adenine dinucle 97.86
2aqj_A 538 Tryptophan halogenase, pRNA; flavin-dependent halo 97.86
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 97.86
4gut_A776 Lysine-specific histone demethylase 1B; histone de 97.85
1pn0_A 665 Phenol 2-monooxygenase; two dimers, TLS refinement 97.82
4at0_A510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 97.81
4g6h_A 502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 97.81
3l8k_A 466 Dihydrolipoyl dehydrogenase; redox-active center, 97.79
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 97.78
2qa2_A 499 CABE, polyketide oxygenase CABE; FAD, angucycline, 97.76
3i6d_A470 Protoporphyrinogen oxidase; protein-inhibitor comp 97.76
1c0p_A363 D-amino acid oxidase; alpha-beta-alpha motif, flav 97.75
3c96_A410 Flavin-containing monooxygenase; FAD, oxidoreducta 97.75
1y56_A493 Hypothetical protein PH1363; dehydrogenase, protei 97.7
3c4n_A405 Uncharacterized protein DR_0571; alpha-beta protei 97.7
2qa1_A 500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 97.7
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 97.68
2e1m_A376 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 97.68
3ihm_A430 Styrene monooxygenase A; rossman fold, anti-parall 97.68
2oln_A397 NIKD protein; flavoprotein, rossmann fold, oxidore 97.65
1pj5_A 830 N,N-dimethylglycine oxidase; channelling, FAD bind 97.64
2b9w_A424 Putative aminooxidase; isomerase, conjugated linol 97.63
2weu_A511 Tryptophan 5-halogenase; regioselectivity, antifun 97.63
3nks_A477 Protoporphyrinogen oxidase; FAD containing protein 97.63
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 97.62
3ka7_A425 Oxidoreductase; structural genomics, PSI-2, protei 97.61
1rsg_A516 FMS1 protein; FAD binding motif, oxidoreductase; H 97.61
2pyx_A 526 Tryptophan halogenase; structural genomics, JOI fo 97.6
2bcg_G453 Secretory pathway GDP dissociation inhibitor; RABG 97.6
1v0j_A399 UDP-galactopyranose mutase; flavoprotein, isomeras 97.6
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 97.59
1cjc_A 460 Protein (adrenodoxin reductase); flavoenzyme, MAD 97.59
2yg5_A453 Putrescine oxidase; oxidoreductase, flavin; HET: F 97.59
3ka7_A425 Oxidoreductase; structural genomics, PSI-2, protei 97.58
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 97.58
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 97.58
2jae_A489 L-amino acid oxidase; oxidoreductase, dimerisation 97.54
3hdq_A397 UDP-galactopyranose mutase; substrate and inhibito 97.52
1lqt_A 456 FPRA; NADP+ derivative, oxidoreductase, structural 97.52
2pyx_A526 Tryptophan halogenase; structural genomics, JOI fo 97.49
3lov_A475 Protoporphyrinogen oxidase; structural genomics, J 97.48
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 97.46
2qcu_A 501 Aerobic glycerol-3-phosphate dehydrogenase; glycer 97.45
2wdq_A 588 Succinate dehydrogenase flavoprotein subunit; succ 97.45
4dsg_A484 UDP-galactopyranose mutase; rossmann fold, flavin 97.43
3c4a_A381 Probable tryptophan hydroxylase VIOD; alpha-beta p 97.42
2ivd_A478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 97.41
3g3e_A351 D-amino-acid oxidase; FAD, flavoprotein, oxidoredu 97.39
3da1_A 561 Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 97.39
2e5v_A 472 L-aspartate oxidase; archaea, oxidoreductase; HET: 97.38
1sez_A504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 97.37
2iid_A498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 97.34
2vvm_A495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 97.33
2bi7_A384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 97.33
3g5s_A443 Methylenetetrahydrofolate--tRNA-(uracil-5-)- methy 97.3
1i8t_A367 UDP-galactopyranose mutase; rossman fold, FAD, con 97.26
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 97.24
3c4a_A381 Probable tryptophan hydroxylase VIOD; alpha-beta p 97.23
2dkh_A 639 3-hydroxybenzoate hydroxylase; flavoprotein, monoo 97.21
1kf6_A 602 Fumarate reductase flavoprotein; respiration, fuma 97.13
1d5t_A433 Guanine nucleotide dissociation inhibitor; ultra-h 97.13
2rgh_A 571 Alpha-glycerophosphate oxidase; flavoprotein oxida 97.1
2r0c_A 549 REBC; flavin adenine dinucleotide, monooxygenase, 97.07
3p1w_A475 Rabgdi protein; GDI RAB, malaria, structural genom 97.03
3ayj_A 721 Pro-enzyme of L-phenylalanine oxidase; amino acid 97.03
2rgh_A 571 Alpha-glycerophosphate oxidase; flavoprotein oxida 96.97
1chu_A 540 Protein (L-aspartate oxidase); flavoenzyme, NAD bi 96.97
1jnr_A 643 Adenylylsulfate reductase; oxidoreductase; HET: FA 96.96
2h88_A 621 Succinate dehydrogenase flavoprotein subunit; comp 96.95
2z3y_A 662 Lysine-specific histone demethylase 1; chromatin, 96.92
2xag_A 852 Lysine-specific histone demethylase 1; amine oxida 96.87
4gde_A 513 UDP-galactopyranose mutase; flavin adenine dinucle 96.8
2bs2_A 660 Quinol-fumarate reductase flavoprotein subunit A; 96.76
1b37_A472 Protein (polyamine oxidase); flavin-dependent amin 96.66
1pn0_A 665 Phenol 2-monooxygenase; two dimers, TLS refinement 96.59
1kdg_A 546 CDH, cellobiose dehydrogenase; GMC oxidoreductase, 96.56
4gut_A776 Lysine-specific histone demethylase 1B; histone de 96.55
3i6d_A 470 Protoporphyrinogen oxidase; protein-inhibitor comp 96.5
1ju2_A536 HydroxynitrIle lyase; flavin, GMC oxidoreductase, 96.46
1jnr_A 643 Adenylylsulfate reductase; oxidoreductase; HET: FA 96.4
3t37_A526 Probable dehydrogenase; BET alpha beta fold, ADP b 96.25
3q9t_A 577 Choline dehydrogenase and related flavoproteins; g 96.23
3gyx_A 662 Adenylylsulfate reductase; oxidoreductase; HET: FA 96.1
3qvp_A 583 Glucose oxidase; oxidoreductase; HET: NAG BMA MAN 95.98
4b63_A 501 L-ornithine N5 monooxygenase; oxidoreductase, side 95.96
1n4w_A504 CHOD, cholesterol oxidase; flavoenzyme, steroid me 95.95
1coy_A507 Cholesterol oxidase; oxidoreductase(oxygen recepto 95.84
3p1w_A475 Rabgdi protein; GDI RAB, malaria, structural genom 95.8
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 95.78
3lk7_A 451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 95.75
1gpe_A 587 Protein (glucose oxidase); oxidoreductase(flavopro 95.68
2jbv_A546 Choline oxidase; alcohol oxidation, flavoenyzme ox 95.67
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 95.64
3fim_B 566 ARYL-alcohol oxidase; AAO, lignin degradation, oxi 95.5
3eag_A326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME 95.42
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 95.21
1id1_A153 Putative potassium channel protein; RCK domain, E. 95.12
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 95.1
4dgk_A 501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 95.03
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 94.98
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 94.44
1lss_A140 TRK system potassium uptake protein TRKA homolog; 94.26
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 93.9
3i83_A320 2-dehydropantoate 2-reductase; structural genomics 93.88
1vg0_A650 RAB proteins geranylgeranyltransferase component A 93.62
2iid_A 498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 93.54
3nrn_A 421 Uncharacterized protein PF1083; alpha-beta protein 93.38
3c85_A183 Putative glutathione-regulated potassium-efflux S 93.27
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 93.19
3fpz_A326 Thiazole biosynthetic enzyme; FAD, mitochondrion, 92.89
1f0y_A302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 92.89
3ihm_A 430 Styrene monooxygenase A; rossman fold, anti-parall 92.75
4hv4_A 494 UDP-N-acetylmuramate--L-alanine ligase; MURC, yers 92.71
2x5o_A439 UDP-N-acetylmuramoylalanine--D-glutamate ligase; A 92.68
3dme_A369 Conserved exported protein; structural genomics, P 92.64
2x5o_A 439 UDP-N-acetylmuramoylalanine--D-glutamate ligase; A 92.6
3lk7_A451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 92.57
3k7m_X 431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 92.56
1kyq_A274 Met8P, siroheme biosynthesis protein Met8; homodim 92.54
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 92.5
3nks_A 477 Protoporphyrinogen oxidase; FAD containing protein 92.48
2b9w_A 424 Putative aminooxidase; isomerase, conjugated linol 92.39
2e1m_A376 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 92.33
4ffl_A363 PYLC; amino acid, biosynthesis of pyrrolysine, iso 92.29
2vvm_A495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 92.25
3g5s_A 443 Methylenetetrahydrofolate--tRNA-(uracil-5-)- methy 92.23
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 92.07
2bcg_G453 Secretory pathway GDP dissociation inhibitor; RABG 92.02
1rsg_A 516 FMS1 protein; FAD binding motif, oxidoreductase; H 91.99
1vg0_A 650 RAB proteins geranylgeranyltransferase component A 91.96
3nix_A 421 Flavoprotein/dehydrogenase; structural genomics, P 91.91
2gf3_A 389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 91.78
2jae_A 489 L-amino acid oxidase; oxidoreductase, dimerisation 91.71
3hwr_A318 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A 91.67
1s3e_A 520 Amine oxidase [flavin-containing] B; human monoami 91.63
2ivd_A 478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 91.56
2a9f_A398 Putative malic enzyme ((S)-malate:NAD+ oxidoreduct 91.47
1pzg_A331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 91.45
1c0p_A363 D-amino acid oxidase; alpha-beta-alpha motif, flav 91.45
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 91.39
1vl6_A388 Malate oxidoreductase; TM0542, NAD-dependent malic 91.38
3nyc_A381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 91.36
1d5t_A433 Guanine nucleotide dissociation inhibitor; ultra-h 91.29
1y6j_A318 L-lactate dehydrogenase; southeast collaboratory f 91.28
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 91.24
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 91.18
2bi7_A384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 91.09
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 91.07
3hn2_A312 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str 91.07
3hn7_A 524 UDP-N-acetylmuramate-L-alanine ligase; ATP-binding 90.88
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 90.74
1sez_A 504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 90.73
3tl2_A315 Malate dehydrogenase; center for structural genomi 90.72
3pqe_A326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 90.67
3hdq_A397 UDP-galactopyranose mutase; substrate and inhibito 90.63
2yg5_A 453 Putrescine oxidase; oxidoreductase, flavin; HET: F 90.63
3k96_A356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 90.52
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 90.42
3ego_A307 Probable 2-dehydropantoate 2-reductase; structural 90.28
2gag_B 405 Heterotetrameric sarcosine oxidase beta-subunit; f 90.26
3i83_A320 2-dehydropantoate 2-reductase; structural genomics 90.26
3dje_A 438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 90.25
1id1_A153 Putative potassium channel protein; RCK domain, E. 90.16
3d0o_A317 L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly 90.12
3eag_A326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME 90.05
2ew2_A316 2-dehydropantoate 2-reductase, putative; alpha-str 90.04
1v0j_A 399 UDP-galactopyranose mutase; flavoprotein, isomeras 89.88
1pjq_A457 CYSG, siroheme synthase; rossman fold, nucleotide 89.82
1pjq_A 457 CYSG, siroheme synthase; rossman fold, nucleotide 89.81
3ps9_A 676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 89.78
3fi9_A343 Malate dehydrogenase; structural genomics, oxidore 89.59
3g3e_A351 D-amino-acid oxidase; FAD, flavoprotein, oxidoredu 89.55
3pvc_A 689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 89.54
3gvi_A324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 89.43
1i8t_A367 UDP-galactopyranose mutase; rossman fold, FAD, con 89.43
2e4g_A 550 Tryptophan halogenase; flavin-binding, rebeccamyci 89.39
3hn2_A312 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str 89.27
1bg6_A359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 89.23
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 89.17
4huj_A220 Uncharacterized protein; PSI-biology, nysgrc, stru 89.16
3lov_A 475 Protoporphyrinogen oxidase; structural genomics, J 89.07
3rui_A340 Ubiquitin-like modifier-activating enzyme ATG7; au 89.04
2ew2_A316 2-dehydropantoate 2-reductase, putative; alpha-str 88.94
3ghy_A335 Ketopantoate reductase protein; oxidoreductase, NA 88.89
2z3y_A 662 Lysine-specific histone demethylase 1; chromatin, 88.83
1ldn_A316 L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA 88.73
4g65_A461 TRK system potassium uptake protein TRKA; structur 88.66
1zud_1251 Adenylyltransferase THIF; thiamin, thiazole, prote 88.65
2xag_A 852 Lysine-specific histone demethylase 1; amine oxida 88.62
3ghy_A335 Ketopantoate reductase protein; oxidoreductase, NA 88.55
1x13_A401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 88.49
3h8v_A292 Ubiquitin-like modifier-activating enzyme 5; rossm 88.42
1lss_A140 TRK system potassium uptake protein TRKA homolog; 88.41
1lld_A319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 88.38
3p7m_A321 Malate dehydrogenase; putative dehydrogenase, enzy 88.2
3ius_A286 Uncharacterized conserved protein; APC63810, silic 88.15
1l7d_A384 Nicotinamide nucleotide transhydrogenase, subunit 87.9
4dsg_A 484 UDP-galactopyranose mutase; rossmann fold, flavin 87.88
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 87.84
2dpo_A319 L-gulonate 3-dehydrogenase; structural genomics, N 87.81
3ado_A319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 87.81
3l9w_A413 Glutathione-regulated potassium-efflux system Pro 87.69
3g17_A294 Similar to 2-dehydropantoate 2-reductase; structur 87.68
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 87.53
2hjr_A328 Malate dehydrogenase; malaria, structural genomics 87.48
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 87.39
3c24_A286 Putative oxidoreductase; YP_511008.1, structural g 87.35
3ado_A319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 87.33
2uyy_A316 N-PAC protein; long-chain dehydrogenase, cytokine; 87.33
3i6i_A346 Putative leucoanthocyanidin reductase 1; rossmann 87.3
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 87.26
1kyq_A274 Met8P, siroheme biosynthesis protein Met8; homodim 87.25
3vtf_A444 UDP-glucose 6-dehydrogenase; two discrete alpha/be 87.23
1kjq_A391 GART 2, phosphoribosylglycinamide formyltransferas 87.23
3gg2_A450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 87.22
3axb_A 448 Putative oxidoreductase; dinucleotide-binding fold 87.07
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 87.07
3qha_A296 Putative oxidoreductase; seattle structural genomi 87.06
2v6b_A304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 86.87
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 86.85
2ewd_A317 Lactate dehydrogenase,; protein-substrate_cofactor 86.8
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
Probab=100.00  E-value=2.8e-58  Score=463.98  Aligned_cols=396  Identities=29%  Similarity=0.506  Sum_probs=349.3

Q ss_pred             CCCCeEEEEcCchHHHHHHHHHHHcCCCCCcEEEEcCCCCCCCCCCCCCccccCCCCCCCCCCCCcccccCCCCCCCCHh
Q 011351           49 NENREFVIVGGGNAAGYAARTFVEHGMADGRLCIVSKEAYAPYERPALTKGYLFPLDKKPARLPGFHTCVGSGGERQTPE  128 (488)
Q Consensus        49 ~~~~~vvIIGgG~AGl~aA~~L~~~g~~~~~V~lie~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  128 (488)
                      +++++|||||||+||++||.+|++.|+ +.+|+|||++++.+|.+|++++.++.... ....+           .....+
T Consensus         7 ~~~~~vvIIGaG~aGl~aA~~L~~~g~-~~~V~lie~~~~~~y~~~~l~~~~~~~~~-~~~~~-----------~~~~~~   73 (415)
T 3lxd_A            7 AERADVVIVGAGHGGAQAAIALRQNGF-EGRVLVIGREPEIPYERPPLSKEYLAREK-TFERI-----------CIRPAQ   73 (415)
T ss_dssp             CCEEEEEEECCSHHHHHHHHHHHHTTC-CSCEEEEESSSSCCBCSGGGGTTTTTTSS-CSGGG-----------BSSCHH
T ss_pred             CCCCcEEEECChHHHHHHHHHHHccCc-CCCEEEEecCCCCCcCcccCCHHHHcCCC-CHHHh-----------ccCCHH
Confidence            346899999999999999999999997 56799999999999999988875554321 11111           245678


Q ss_pred             HHHHCCCeEEeCCcEEEEeCCCcEEEeCCCcEEEeccEEeccCCCCCcCCCCCCCCCCcEEEecCHHHHHHHHHhhhc-C
Q 011351          129 WYKEKGIEMIYQDPVTSIDIEKQTLITNSGKLLKYGSLIVATGCTASRFPEKIGGYLPGVHYIRDVADADALISSLEK-A  207 (488)
Q Consensus       129 ~~~~~~i~~~~~~~v~~id~~~~~v~~~~g~~i~yd~lVlAtG~~~~~~~~~~g~~~~gv~~~~~~~~~~~~~~~~~~-~  207 (488)
                      ++.+.+++++.+++|+.++++.+.+.+.+++.+.||+||+|||+.+. .++++|.+.++++++++..++..+...+.. +
T Consensus        74 ~~~~~~i~~~~~~~v~~id~~~~~v~~~~g~~~~~d~lvlAtG~~~~-~~~i~g~~~~~v~~~~~~~d~~~l~~~~~~~~  152 (415)
T 3lxd_A           74 FWEDKAVEMKLGAEVVSLDPAAHTVKLGDGSAIEYGKLIWATGGDPR-RLSCVGADLAGVHAVRTKEDADRLMAELDAGA  152 (415)
T ss_dssp             HHHHTTEEEEETCCEEEEETTTTEEEETTSCEEEEEEEEECCCEECC-CCBTTSSCCBTEECCCSHHHHHHHHHHHHTTC
T ss_pred             HHHHCCcEEEeCCEEEEEECCCCEEEECCCCEEEeeEEEEccCCccC-CCCCCCccccCEEEEcCHHHHHHHHHHhhhcC
Confidence            89999999999989999999999999999999999999999999886 456677777889999999999888887777 9


Q ss_pred             CeEEEECCCHHHHHHHHHHHhCCCcEEEEecCCcCcccccCHHHHHHHHHHHHHcCcEEEcCCeEEEEEeCCCCcEEEEE
Q 011351          208 KKVVVVGGGYIGMEVAAAAVGWKLDTTIIFPENHLLQRLFTPSLAQRYEQLYQQNGVKFVKGASIKNLEAGSDGRVAAVK  287 (488)
Q Consensus       208 ~~vvVvG~G~~g~e~A~~l~~~g~~v~lv~~~~~~l~~~~~~~~~~~~~~~l~~~GV~v~~~~~v~~i~~~~~~~v~~v~  287 (488)
                      ++++|||+|.+|+|+|..+.+.|.+|+++++.++++++.+++.+.+.+.+.+++.||++++++.|++++.+ ++++..|.
T Consensus       153 ~~vvViGgG~~g~e~A~~l~~~g~~Vtvv~~~~~~l~~~~~~~~~~~l~~~l~~~GV~i~~~~~v~~i~~~-~~~v~~v~  231 (415)
T 3lxd_A          153 KNAVVIGGGYIGLEAAAVLTKFGVNVTLLEALPRVLARVAGEALSEFYQAEHRAHGVDLRTGAAMDCIEGD-GTKVTGVR  231 (415)
T ss_dssp             CEEEEECCSHHHHHHHHHHHHTTCEEEEEESSSSTTTTTSCHHHHHHHHHHHHHTTCEEEETCCEEEEEES-SSBEEEEE
T ss_pred             CeEEEECCCHHHHHHHHHHHhcCCeEEEEecCCchhhhhcCHHHHHHHHHHHHhCCCEEEECCEEEEEEec-CCcEEEEE
Confidence            99999999999999999999999999999999999998889999999999999999999999999999864 56777899


Q ss_pred             eCCCcEEEcCEEEEeecCccCChhhhhcCCcccCCCEEeCCCCCCCCCCEEEEceecccCCccC-CcccccccHHHHHHH
Q 011351          288 LEDGSTIDADTIVIGIGAKPTVSPFERVGLNSSVGGIQVDGQFRTRMPGIFAIGDVAAFPLKMY-DRTARVEHVDHARQS  366 (488)
Q Consensus       288 l~~g~~i~~D~vi~a~G~~p~~~~~~~~gl~~~~g~i~vd~~~~t~~~~Ifa~GD~a~~~~~~~-~~~~~~~~~~~A~~~  366 (488)
                      +++|++++||.||+|+|.+|++++++.+|+..+ ++|.||++++|+.|+|||+|||+..+.... |...+.++|..|..|
T Consensus       232 l~dG~~i~aD~Vv~a~G~~p~~~l~~~~gl~~~-~gi~vd~~~~t~~~~iyA~GD~a~~~~~~~~g~~~~~~~~~~A~~q  310 (415)
T 3lxd_A          232 MQDGSVIPADIVIVGIGIVPCVGALISAGASGG-NGVDVDEFCRTSLTDVYAIGDCAAHANDFADGAVIRLESVQNANDM  310 (415)
T ss_dssp             ESSSCEEECSEEEECSCCEESCHHHHHTTCCCS-SSEECCTTCBCSSTTEEECGGGEEEECGGGTTCEECCCSHHHHHHH
T ss_pred             eCCCCEEEcCEEEECCCCccChHHHHhCCCCcC-CCEEECCCCCcCCCCEEEEEeeeeecCcccCCcceeechHHHHHHH
Confidence            999999999999999999999999999999887 469999999999999999999999887666 777778899999999


Q ss_pred             HHHHHHHHhcCCCCCCCCCCceeEeccccCCCCcceeeEEeeCCCC--cEEEEccCC-CcEEEEEEECCEEEEEEeecCC
Q 011351          367 AQHCIKALLSAQTHTYDYLPYFYSRVFEYEGSPRKVWWQFFGDNVG--ETIEIGNFD-PKIATFWIDSGKLKGVLVESGS  443 (488)
Q Consensus       367 g~~~a~~i~~~~~~~~~~~p~~~~~~~~~~g~~~~~~~~~~g~~~~--~~~~~~~~~-~~~~~~~~~~~~~~g~~~~~~~  443 (488)
                      |+.+|+||++. ..+|..+||||+++|+..       ++++|...+  +++..++.+ .+|.++|+++|+|+|+++ .|+
T Consensus       311 g~~aa~~i~g~-~~~~~~~p~~~~~~~~~~-------~~~~G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~-~~~  381 (415)
T 3lxd_A          311 ATAAAKDICGA-PVPYKATPWFWSNQYDLK-------LQTVGLSTGHDNAVLRGDPATRSFSVVYLKGGKVVALDC-VNM  381 (415)
T ss_dssp             HHHHHHHHTTC-CCCCCCCCEEEEEETTEE-------EEEEECCTTCSEEEEEEEGGGTEEEEEEEETTEEEEEEE-ESC
T ss_pred             HHHHHHHhcCC-CCCCCCCCeeEeeeCCcE-------EEEEeCCCCCCEEEEEecCCCCeEEEEEEECCEEEEEEE-ECC
Confidence            99999999975 457999999999999864       888997643  566666664 679999999999999986 899


Q ss_pred             hHHhhHHHHHHhcCCCCChhhhcCCC
Q 011351          444 PEEFQLLPTLARSQPFVDKAKLQQAS  469 (488)
Q Consensus       444 ~~~~~~~~~~~~~~~~~~~~~~~~~~  469 (488)
                      +.....+++||.++..+++..|.++.
T Consensus       382 ~~~~~~~~~~~~~~~~~~~~~l~~~~  407 (415)
T 3lxd_A          382 VKDYVQGKKLVEARAQIAPEQLADAG  407 (415)
T ss_dssp             HHHHHHHHHHHHHTCCCCHHHHTCTT
T ss_pred             hHHHHHHHHHHHCCCCCCHHHhcCCC
Confidence            99999999999999999988887764



>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* Back     alignment and structure
>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Back     alignment and structure
>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Back     alignment and structure
>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* Back     alignment and structure
>1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Back     alignment and structure
>3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Back     alignment and structure
>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Back     alignment and structure
>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* Back     alignment and structure
>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* Back     alignment and structure
>3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Back     alignment and structure
>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A* Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A* Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Back     alignment and structure
>4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Back     alignment and structure
>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A* Back     alignment and structure
>1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Back     alignment and structure
>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Back     alignment and structure
>2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina} Back     alignment and structure
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Back     alignment and structure
>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Back     alignment and structure
>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina} Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* Back     alignment and structure
>2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* Back     alignment and structure
>4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* Back     alignment and structure
>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Back     alignment and structure
>3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* Back     alignment and structure
>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} Back     alignment and structure
>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Back     alignment and structure
>3g5s_A Methylenetetrahydrofolate--tRNA-(uracil-5-)- methyltransferase TRMFO; tRNA methyltransferase FAD folate, FAD, flavoprotein; HET: MSE FAD GSH; 1.05A {Thermus thermophilus} PDB: 3g5q_A* 3g5r_A* Back     alignment and structure
>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* Back     alignment and structure
>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* Back     alignment and structure
>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Back     alignment and structure
>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Back     alignment and structure
>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} Back     alignment and structure
>3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A* Back     alignment and structure
>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* Back     alignment and structure
>1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* Back     alignment and structure
>1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A* Back     alignment and structure
>2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... Back     alignment and structure
>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Back     alignment and structure
>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Back     alignment and structure
>4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Back     alignment and structure
>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* Back     alignment and structure
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Back     alignment and structure
>1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* Back     alignment and structure
>1kdg_A CDH, cellobiose dehydrogenase; GMC oxidoreductase, PHBH fold, alpha/beta structure, rossman 6-hydroxylated FAD, oxidoreductase; HET: NAG MAN 6FA EMT; 1.50A {Phanerochaete chrysosporium} SCOP: c.3.1.2 d.16.1.1 PDB: 1naa_A* Back     alignment and structure
>4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A* Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Back     alignment and structure
>1ju2_A HydroxynitrIle lyase; flavin, GMC oxidoreductase, almond, cyanogenesis; HET: NAG NDG FUC BMA MAN FAD; 1.47A {Prunus dulcis} SCOP: c.3.1.2 d.16.1.1 PDB: 3gdp_A* 3gdn_A* Back     alignment and structure
>1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A* Back     alignment and structure
>3t37_A Probable dehydrogenase; BET alpha beta fold, ADP binding, oxidoreductase; HET: FAD; 2.19A {Mesorhizobium loti} Back     alignment and structure
>3q9t_A Choline dehydrogenase and related flavoproteins; glucose-methanol-choline oxidoreductase family, formate OXID formyl-FAD, oxidoreductase; HET: FAY; 2.24A {Aspergillus oryzae} Back     alignment and structure
>3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} Back     alignment and structure
>3qvp_A Glucose oxidase; oxidoreductase; HET: NAG BMA MAN FAD; 1.20A {Aspergillus niger} PDB: 1gal_A* 1cf3_A* 3qvr_A* Back     alignment and structure
>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* Back     alignment and structure
>1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A* Back     alignment and structure
>1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A* Back     alignment and structure
>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>1gpe_A Protein (glucose oxidase); oxidoreductase(flavoprotein); HET: NAG BMA MAN FAD; 1.80A {Penicillium amagasakiense} SCOP: c.3.1.2 d.16.1.1 Back     alignment and structure
>2jbv_A Choline oxidase; alcohol oxidation, flavoenyzme oxidase, covalently linked FAD, C4A-adduct, flavoprotein, oxidoreductase; HET: FAO; 1.86A {Arthrobacter globiformis} PDB: 3nne_A* 3ljp_A* Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>3fim_B ARYL-alcohol oxidase; AAO, lignin degradation, oxidoreductase, flavoprotein; HET: FAD; 2.55A {Pleurotus eryngii} Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R* Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>3fpz_A Thiazole biosynthetic enzyme; FAD, mitochondrion, N thiamine biosynthesis, transit peptide, biosynthetic protei; HET: AHZ; 1.82A {Saccharomyces cerevisiae} Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Back     alignment and structure
>4hv4_A UDP-N-acetylmuramate--L-alanine ligase; MURC, yersinia pestis peptidoglycan synthesis; HET: AMP; 2.25A {Yersinia pestis} PDB: 2f00_A Back     alignment and structure
>2x5o_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; ATP-binding, cell cycle, cell division, cell shape, cell WAL biogenesis/degradation; HET: KCX VSV; 1.46A {Escherichia coli} PDB: 2wjp_A* 2xpc_A* 2y1o_A* 2jff_A* 2jfh_A* 2uuo_A* 2uup_A* 2vtd_A* 2vte_A* 2jfg_A* 2y66_A* 2y67_A* 2y68_A* 4uag_A* 1e0d_A* 1uag_A* 1eeh_A* 3uag_A* 2uag_A* Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
>2x5o_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; ATP-binding, cell cycle, cell division, cell shape, cell WAL biogenesis/degradation; HET: KCX VSV; 1.46A {Escherichia coli} PDB: 2wjp_A* 2xpc_A* 2y1o_A* 2jff_A* 2jfh_A* 2uuo_A* 2uup_A* 2vtd_A* 2vte_A* 2jfg_A* 2y66_A* 2y67_A* 2y68_A* 4uag_A* 1e0d_A* 1uag_A* 1eeh_A* 3uag_A* 2uag_A* Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Back     alignment and structure
>1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Back     alignment and structure
>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>4ffl_A PYLC; amino acid, biosynthesis of pyrrolysine, isopeptide bond for ATP-grAsp fold, ligase, ATP-binding, L-lysine and 3R-methyl ornithine; HET: LYS ADP ATP; 1.50A {Methanosarcina barkeri} PDB: 4ffm_A* 4ffn_A* 4ffo_A* 4ffp_A* 4ffr_A* Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Back     alignment and structure
>3g5s_A Methylenetetrahydrofolate--tRNA-(uracil-5-)- methyltransferase TRMFO; tRNA methyltransferase FAD folate, FAD, flavoprotein; HET: MSE FAD GSH; 1.05A {Thermus thermophilus} PDB: 3g5q_A* 3g5r_A* Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Back     alignment and structure
>1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R* Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Back     alignment and structure
>3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Back     alignment and structure
>2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Back     alignment and structure
>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Back     alignment and structure
>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} Back     alignment and structure
>3hn7_A UDP-N-acetylmuramate-L-alanine ligase; ATP-binding, nucleotide-binding, structural genomics, joint for structural genomics, JCSG; HET: MSE; 1.65A {Psychrobacter arcticus 273-4} Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Back     alignment and structure
>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* Back     alignment and structure
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Back     alignment and structure
>1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} SCOP: c.2.1.11 c.90.1.1 e.37.1.1 PDB: 1pjs_A* 1pjt_A* Back     alignment and structure
>1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} SCOP: c.2.1.11 c.90.1.1 e.37.1.1 PDB: 1pjs_A* 1pjt_A* Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} Back     alignment and structure
>3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Back     alignment and structure
>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A Back     alignment and structure
>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Back     alignment and structure
>3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} Back     alignment and structure
>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Back     alignment and structure
>1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Back     alignment and structure
>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Back     alignment and structure
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 Back     alignment and structure
>3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum} Back     alignment and structure
>1kjq_A GART 2, phosphoribosylglycinamide formyltransferase 2, 5'-; ATP-grAsp, purine biosynthesis, nucleotide; HET: ADP MPO; 1.05A {Escherichia coli} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 PDB: 1kj9_A* 1kji_A* 1kjj_A* 1kj8_A* 1eyz_A* 1ez1_A* Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 488
d1q1ra2133 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseud 2e-24
d1d7ya2121 c.3.1.5 (A:116-236) NADH-dependent ferredoxin redu 3e-24
d1m6ia2137 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF 5e-23
d1nhpa2123 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus 5e-22
d1xhca2122 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductas 7e-18
d1gesa2116 c.3.1.5 (A:147-262) Glutathione reductase {Escheri 3e-17
d1d7ya1183 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredo 2e-16
d1d7ya1183 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredo 3e-08
d1onfa2117 c.3.1.5 (A:154-270) Glutathione reductase {Plasmod 7e-16
d1q1ra1185 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductas 1e-15
d1q1ra1185 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductas 8e-04
d1aoga2117 c.3.1.5 (A:170-286) Trypanothione reductase {Trypa 5e-14
d1mo9a2121 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl co 2e-13
d1h6va2122 c.3.1.5 (A:171-292) Mammalian thioredoxin reductas 1e-12
d1m6ia1213 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing f 2e-12
d1m6ia1213 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing f 2e-09
d1nhpa1198 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enter 2e-12
d1feca2117 c.3.1.5 (A:170-286) Trypanothione reductase {Crith 6e-12
d1lvla2115 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase 9e-11
d3grsa2125 c.3.1.5 (A:166-290) Glutathione reductase {Human ( 1e-09
d1djqa2156 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, 3e-09
d1trba1190 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase 7e-09
d1ebda2117 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase 7e-09
d1ojta2125 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase 1e-08
d3lada2119 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase 1e-08
d1v59a2122 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase 1e-08
d1mo9a1261 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketop 1e-08
d1xhca1167 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite 3e-08
d1xhca1167 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite 1e-05
d1ebda1223 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehyd 1e-07
d1fcda1186 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulf 2e-07
d1dxla2123 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase 1e-06
d3grsa1221 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase 2e-06
d1dxla1221 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehyd 3e-06
d1ps9a2162 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-t 7e-06
d1fl2a1184 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide 9e-06
d1feca1240 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductas 1e-05
d1djqa3233 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehyd 1e-05
d1vdca1192 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase 2e-05
d2gjca1311 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Th 5e-05
d1gesa1217 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase 9e-05
d1ojta1229 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide deh 9e-05
d1v59a1233 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehyd 1e-04
d1lvla1220 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehyd 5e-04
d1gtea4196 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine de 0.002
d1xdia1233 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehyd 0.002
d1gtea3153 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenas 0.003
d1aoga1238 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductas 0.003
d1b5qa1347 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Mai 0.003
d3lada1229 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehyd 0.004
d2bcgg1297 c.3.1.3 (G:5-301) Guanine nucleotide dissociation 0.004
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Length = 133 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD/NAD-linked reductases, N-terminal and central domains
domain: Putidaredoxin reductase
species: Pseudomonas putida [TaxId: 303]
 Score = 96.1 bits (238), Expect = 2e-24
 Identities = 42/128 (32%), Positives = 69/128 (53%), Gaps = 1/128 (0%)

Query: 178 PEKIGGYLPGVHYIRDVADADALISSLEKAKKVVVVGGGYIGMEVAAAAVGWKLDTTIIF 237
                G      Y+R + DA+ +   L    ++VV+GGGYIG+EVAA A+   +  T++ 
Sbjct: 6   ASGAVGKANNFRYLRTLEDAECIRRQLIADNRLVVIGGGYIGLEVAATAIKANMHVTLLD 65

Query: 238 PENHLLQRLFTPSLAQRYEQLYQQNGVKFVKGASIKNLEAGSDG-RVAAVKLEDGSTIDA 296
               +L+R+  P ++  YE L+++ GV    G  +   E  +D  +V AV  EDG+ + A
Sbjct: 66  TAARVLERVTAPPVSAFYEHLHREAGVDIRTGTQVCGFEMSTDQQKVTAVLCEDGTRLPA 125

Query: 297 DTIVIGIG 304
           D ++ GIG
Sbjct: 126 DLVIAGIG 133


>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Length = 121 Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Length = 137 Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Length = 123 Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Length = 122 Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Length = 116 Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Length = 183 Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Length = 183 Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Length = 117 Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Length = 185 Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Length = 185 Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Length = 117 Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Length = 121 Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 122 Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Length = 213 Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Length = 213 Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Length = 198 Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Length = 117 Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Length = 115 Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Length = 156 Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Length = 190 Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Length = 117 Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Length = 125 Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Length = 119 Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 122 Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Length = 261 Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Length = 167 Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Length = 167 Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Length = 223 Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Length = 186 Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Length = 123 Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Length = 221 Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 162 Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Length = 184 Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Length = 240 Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Length = 233 Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 192 Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 311 Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Length = 217 Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Length = 229 Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 233 Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Length = 220 Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Length = 196 Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 233 Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Length = 153 Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Length = 238 Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Length = 347 Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Length = 229 Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 297 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query488
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 99.91
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 99.9
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 99.9
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 99.87
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 99.87
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 99.87
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 99.84
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 99.8
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 99.76
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 99.76
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 99.76
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 99.73
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 99.72
d1mo9a1261 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 99.71
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 99.7
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 99.69
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 99.68
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 99.68
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 99.68
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 99.67
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 99.67
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 99.66
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 99.65
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 99.65
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 99.64
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 99.63
d1xdia1233 Dihydrolipoamide dehydrogenase {Mycobacterium tube 99.63
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 99.63
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 99.61
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 99.61
d1h6va1235 Mammalian thioredoxin reductase {Rat (Rattus norve 99.59
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 99.59
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 99.57
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 99.55
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 99.54
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 99.54
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 99.53
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 99.51
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 99.48
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 99.43
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 99.41
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 99.36
d1feca1240 Trypanothione reductase {Crithidia fasciculata [Ta 99.32
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 99.31
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 99.28
d1aoga1238 Trypanothione reductase {Trypanosoma cruzi [TaxId: 99.25
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 99.23
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 99.23
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 99.23
d1q1ra3103 Putidaredoxin reductase {Pseudomonas putida [TaxId 99.23
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 99.21
d1d7ya397 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 99.18
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 99.18
d1ps9a2162 2,4-dienoyl-CoA reductase, C-terminal domain {Esch 99.17
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 99.17
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 99.13
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 99.12
d1trba2126 Thioredoxin reductase {Escherichia coli [TaxId: 56 99.12
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 99.12
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 99.1
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 99.07
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 99.06
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 99.06
d1onfa1259 Glutathione reductase {Plasmodium falciparum [TaxI 99.06
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 99.05
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 99.04
d1d4ca2322 Flavocytochrome c3 (respiratory fumarate reductase 99.02
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 99.0
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 98.99
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 98.98
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 98.98
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 98.98
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 98.97
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 98.97
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 98.95
d1onfa1259 Glutathione reductase {Plasmodium falciparum [TaxI 98.94
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 98.94
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 98.94
d1fl2a2126 Alkyl hydroperoxide reductase subunit F (AhpF), C- 98.93
d2gmha1380 Electron transfer flavoprotein-ubiquinone oxidored 98.93
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 98.87
d2cula1230 GidA-related protein TTHA1897 {Thermus thermophilu 98.86
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 98.86
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 98.85
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 98.85
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 98.84
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 98.84
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 98.82
d1qo8a2317 Flavocytochrome c3 (respiratory fumarate reductase 98.82
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 98.81
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 98.81
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 98.81
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 98.81
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 98.8
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 98.8
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 98.79
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 98.79
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 98.78
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 98.76
d1vdca2130 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 98.72
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 98.7
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 98.68
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 98.63
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 98.62
d2bs2a2336 Fumarate reductase {Wolinella succinogenes [TaxId: 98.59
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 98.57
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 98.56
d2bs2a2336 Fumarate reductase {Wolinella succinogenes [TaxId: 98.52
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 98.52
d1d4ca2322 Flavocytochrome c3 (respiratory fumarate reductase 98.51
d1qo8a2317 Flavocytochrome c3 (respiratory fumarate reductase 98.5
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 98.49
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 98.47
d1kf6a2311 Fumarate reductase {Escherichia coli [TaxId: 562]} 98.45
d1chua2305 L-aspartate oxidase {Escherichia coli [TaxId: 562] 98.41
d1cjca1225 Adrenodoxin reductase of mitochondrial p450 system 98.39
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 98.38
d1h6va1235 Mammalian thioredoxin reductase {Rat (Rattus norve 98.38
d1neka2330 Succinate dehydogenase {Escherichia coli [TaxId: 5 98.35
d1mo9a1261 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 98.34
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 98.26
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 98.24
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 98.22
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 98.21
d2dw4a2449 Lysine-specific histone demethylase 1, LSD1 {Human 98.21
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 98.21
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 98.2
d2cula1230 GidA-related protein TTHA1897 {Thermus thermophilu 98.19
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 98.18
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 98.17
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 98.17
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 98.13
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 98.12
d1kf6a2311 Fumarate reductase {Escherichia coli [TaxId: 562]} 98.11
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 98.1
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 98.09
d1ps9a2162 2,4-dienoyl-CoA reductase, C-terminal domain {Esch 98.06
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 98.06
d1lqta1216 Ferredoxin:NADP reductase FprA {Mycobacterium tube 98.03
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 97.98
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 97.98
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 97.97
d1neka2330 Succinate dehydogenase {Escherichia coli [TaxId: 5 97.95
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 97.92
d1aoga1238 Trypanothione reductase {Trypanosoma cruzi [TaxId: 97.85
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 97.85
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 97.83
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 97.82
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 97.79
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 97.75
d1feca1240 Trypanothione reductase {Crithidia fasciculata [Ta 97.73
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 97.72
d1w4xa2235 Phenylacetone monooxygenase {Thermobifida fusca [T 97.69
d2f5va1379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 97.68
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 97.64
d1xdia1233 Dihydrolipoamide dehydrogenase {Mycobacterium tube 97.63
d2gjca1311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 97.6
d1pn0a1360 Phenol hydroxylase {Soil-living yeast (Trichosporo 97.58
d1trba2126 Thioredoxin reductase {Escherichia coli [TaxId: 56 97.43
d1chua2305 L-aspartate oxidase {Escherichia coli [TaxId: 562] 97.43
d2f5va1379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 97.41
d1fl2a2126 Alkyl hydroperoxide reductase subunit F (AhpF), C- 97.39
d1v59a3123 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 97.39
d1jnra2356 Adenylylsulfate reductase A subunit {Archaeon Arch 97.36
d3coxa1370 Cholesterol oxidase of GMC family {Brevibacterium 97.23
d1n4wa1367 Cholesterol oxidase of GMC family {Streptomyces sp 97.23
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 97.2
d3lada3124 Dihydrolipoamide dehydrogenase {Azotobacter vinela 97.15
d2gjca1311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 97.15
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 97.12
d1xdia2118 Dihydrolipoamide dehydrogenase {Mycobacterium tube 97.11
d1kdga1360 Flavoprotein domain of flavocytochrome cellobiose 97.11
d1jnra2356 Adenylylsulfate reductase A subunit {Archaeon Arch 97.02
d1vdca2130 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 97.0
d1gpea1391 Glucose oxidase {Penicillium amagasakiense [TaxId: 97.0
d1dxla3123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 96.94
d1lvla3123 Dihydrolipoamide dehydrogenase {Pseudomonas putida 96.92
d1ebda3115 Dihydrolipoamide dehydrogenase {Bacillus stearothe 96.85
d1ojta3128 Dihydrolipoamide dehydrogenase {Neisseria meningit 96.84
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 96.79
d1cf3a1385 Glucose oxidase {Aspergillus niger [TaxId: 5061]} 96.76
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 96.76
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 96.72
d1ju2a1351 Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxI 96.65
d1m6ia3131 Apoptosis-inducing factor (AIF) {Human (Homo sapie 96.58
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 96.52
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 96.33
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 96.24
d2dw4a2 449 Lysine-specific histone demethylase 1, LSD1 {Human 96.17
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 96.11
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 96.02
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 95.99
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 95.93
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 95.9
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 95.83
d1a9xa3127 Carbamoyl phosphate synthetase (CPS), large subuni 95.82
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 95.82
d1fcda2141 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 95.81
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 95.81
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 95.72
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 95.68
d1a9xa4121 Carbamoyl phosphate synthetase (CPS), large subuni 95.61
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 95.61
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 95.57
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 95.56
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 95.48
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 95.41
d1kdga1360 Flavoprotein domain of flavocytochrome cellobiose 95.3
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 95.28
d1w4xa2235 Phenylacetone monooxygenase {Thermobifida fusca [T 95.25
d1onfa3119 Glutathione reductase {Plasmodium falciparum [TaxI 95.09
d3grsa3115 Glutathione reductase {Human (Homo sapiens) [TaxId 95.01
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 94.98
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 94.82
d1pn0a1360 Phenol hydroxylase {Soil-living yeast (Trichosporo 94.79
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 94.78
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 94.76
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 94.75
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 94.57
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 94.47
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 94.42
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 94.23
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 94.2
d1gesa3115 Glutathione reductase {Escherichia coli [TaxId: 56 94.17
d1feca3128 Trypanothione reductase {Crithidia fasciculata [Ta 94.13
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 94.1
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 94.07
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 94.06
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 93.72
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 93.62
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 93.58
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 93.53
d1h6va3133 Mammalian thioredoxin reductase {Rat (Rattus norve 93.44
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 93.39
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 93.39
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 93.2
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 93.19
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 93.07
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 92.85
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 92.46
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 92.42
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 92.36
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 92.0
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 91.95
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 91.95
d1n4wa1367 Cholesterol oxidase of GMC family {Streptomyces sp 91.94
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 91.92
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 91.63
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 91.47
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 91.47
d1fcda2141 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 91.46
d3coxa1370 Cholesterol oxidase of GMC family {Brevibacterium 91.32
d1a9xa4121 Carbamoyl phosphate synthetase (CPS), large subuni 91.01
d1id1a_153 Rck domain from putative potassium channel Kch {Es 90.98
d1j6ua189 UDP-N-acetylmuramate-alanine ligase MurC {Thermoto 90.91
d2gmha1380 Electron transfer flavoprotein-ubiquinone oxidored 90.89
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 90.85
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 90.79
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 90.75
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 90.34
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 90.2
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 89.88
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 89.62
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 89.31
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 89.3
d1mo9a3140 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 89.29
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 89.22
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 89.1
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 88.83
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 88.68
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 88.47
d1id1a_153 Rck domain from putative potassium channel Kch {Es 88.11
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 88.02
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 88.01
d1dlja2196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 87.96
d1gtea1182 Dihydropyrimidine dehydrogenase, N-terminal domain 87.86
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 87.81
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 87.8
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 87.71
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 87.69
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 87.37
d1lqta1216 Ferredoxin:NADP reductase FprA {Mycobacterium tube 87.36
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 87.27
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 86.95
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 86.77
d1vl6a1222 Malate oxidoreductase (malic enzyme) {Thermotoga m 86.67
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 86.33
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 85.82
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 85.74
d1cjca1225 Adrenodoxin reductase of mitochondrial p450 system 85.45
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 85.4
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 85.39
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 85.32
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 84.92
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 84.75
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 84.6
d1nhpa3126 NADH peroxidase {Enterococcus faecalis [TaxId: 135 84.33
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 84.19
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 83.82
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 83.8
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 83.67
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 83.57
d1gpea1391 Glucose oxidase {Penicillium amagasakiense [TaxId: 83.29
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 82.91
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 82.89
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 82.77
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 82.65
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 82.63
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 82.55
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 82.29
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 82.26
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 82.23
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 82.21
d2hjsa1144 Usg-1 protein homolog PA3116 {Pseudomonas aerugino 82.2
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 81.9
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 81.48
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 81.08
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 80.65
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 80.52
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 80.48
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 80.38
d1xgka_350 Negative transcriptional regulator NmrA {Aspergill 80.11
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD/NAD-linked reductases, N-terminal and central domains
domain: Apoptosis-inducing factor (AIF)
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.91  E-value=6.8e-25  Score=196.97  Aligned_cols=113  Identities=32%  Similarity=0.485  Sum_probs=94.7

Q ss_pred             HHHcCcEEEcCCeEEEEEeCCCCcEEEEEeCCCcEEEcCEEEEeecCccC-ChhhhhcCCccc--CCCEEeCCCCCCCCC
Q 011351          259 YQQNGVKFVKGASIKNLEAGSDGRVAAVKLEDGSTIDADTIVIGIGAKPT-VSPFERVGLNSS--VGGIQVDGQFRTRMP  335 (488)
Q Consensus       259 l~~~GV~v~~~~~v~~i~~~~~~~v~~v~l~~g~~i~~D~vi~a~G~~p~-~~~~~~~gl~~~--~g~i~vd~~~~t~~~  335 (488)
                      +++.||+++++++|++|+.+ +.   .|.++||++++||.+|+|+|..|+ .++....++..+  .++|.||+++||+ |
T Consensus        93 ~~~~gI~~~~g~~V~~id~~-~~---~V~l~dG~~i~~d~lViAtG~~~~~~~l~~~~gl~~~~~~~~i~vd~~l~~~-~  167 (213)
T d1m6ia1          93 IENGGVAVLTGKKVVQLDVR-DN---MVKLNDGSQITYEKCLIATGGTEPNVELAKTGGLEIDSDFGGFRVNAELQAR-S  167 (213)
T ss_dssp             STTCEEEEEETCCEEEEEGG-GT---EEEETTSCEEEEEEEEECCCEEEECCTTHHHHTCCBCTTTCSEECCTTCEEE-T
T ss_pred             HHHCCeEEEeCCEEEEeecc-Cc---eeeeccceeeccceEEEeeeeecchhhhhhccchhhhhhhhhhhhhHhcCcC-C
Confidence            34678999999999999754 22   578999999999999999997654 456677777653  5789999999998 9


Q ss_pred             CEEEEceecccCCccCCcccccccHHHHHHHHHHHHHHHhcC
Q 011351          336 GIFAIGDVAAFPLKMYDRTARVEHVDHARQSAQHCIKALLSA  377 (488)
Q Consensus       336 ~Ifa~GD~a~~~~~~~~~~~~~~~~~~A~~~g~~~a~~i~~~  377 (488)
                      +|||+|||+.++....+. .++++|+.|+.||+.+|+||++.
T Consensus       168 ~VyA~GD~a~~~~~~~g~-~~i~~~~~A~~~gr~aa~ni~g~  208 (213)
T d1m6ia1         168 NIWVAGDAACFYDIKLGR-RRVEHHDHAVVSGRLAGENMTGA  208 (213)
T ss_dssp             TEEECGGGEEEEETTTEE-ECCCCHHHHHHHHHHHHHHHTSC
T ss_pred             ceEEeeeeeeeccccCCc-EEeeEhHHHHHHHHHHHHHhcCC
Confidence            999999999988766554 46789999999999999999974



>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q1ra3 d.87.1.1 (A:320-422) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1d7ya3 d.87.1.1 (A:309-405) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cjca1 c.3.1.1 (A:107-331) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1lqta1 c.3.1.1 (A:109-324) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v59a3 d.87.1.1 (A:356-478) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d3lada3 d.87.1.1 (A:349-472) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1xdia2 d.87.1.1 (A:349-466) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Back     information, alignment and structure
>d1dxla3 d.87.1.1 (A:348-470) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1lvla3 d.87.1.1 (A:336-458) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ebda3 d.87.1.1 (A:347-461) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ojta3 d.87.1.1 (A:471-598) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Back     information, alignment and structure
>d1m6ia3 d.87.1.1 (A:478-608) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1a9xa3 c.30.1.1 (A:1-127) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1fcda2 c.3.1.5 (A:115-255) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1onfa3 d.87.1.1 (A:377-495) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d3grsa3 d.87.1.1 (A:364-478) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1gesa3 d.87.1.1 (A:336-450) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1feca3 d.87.1.1 (A:358-485) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1h6va3 d.87.1.1 (A:367-499) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fcda2 c.3.1.5 (A:115-255) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mo9a3 d.87.1.1 (A:384-523) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1gtea1 a.1.2.2 (A:2-183) Dihydropyrimidine dehydrogenase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1lqta1 c.3.1.1 (A:109-324) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1vl6a1 c.2.1.7 (A:155-376) Malate oxidoreductase (malic enzyme) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1cjca1 c.3.1.1 (A:107-331) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1nhpa3 d.87.1.1 (A:322-447) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure