Citrus Sinensis ID: 011393

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------

MSFIKDIIDSLGSIFSNDSSPFESERNPSSSTMDGVAGTSITNERTAYKLKGYFELAKEEIAKAVRAEEWGLVDDAIIHYKNAQRILTEASSTPVPSYISTSEHEKVKSYRQKISKWQSQVSDRLQALNRRAGGTSTSKSTSPHAQTAAVSSTSNFRKNISPNSPRSSRNNPVVRNQTEKTGSSKPLAEAGNGYDSKLVEMINTAIVDRSPSVKWEDVAGLEKAKQALMEMVILPAKRRDLFTGLRRPARGLLLFGPPGNGKTMLAKAVASESQATFFNVSASSLTSKWVGEGEKLVRTLFMVAISRQPCVIFIDEIDSIMSTRMANENDASRRLKSEFLIQFDGVTSNPNDLVIVMGATNKPQELDDAVLRRLVKRIYVPLPDENVRRLLLKHKLKGQAFSLPGGDLERLVRETEGYSGSDLQALCEEAAMMPIRELGTNILTVKANQLRPLRYEDFQKAMAVIRPSLNKSKWEELEQWNREFGSN

cccHHHHHHHHcccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHccccccccccccccccccEEEccccccHHHHHHHHHHHcccEEEEEEcccccccccccHHHHHHHHHHHHHHccccEEEEEHHHHHHcccccccHHHHHHHHHHHHHHHcccccccccEEEEEEcccccccccHHHHHccccccccccccHHHHHHHHHHHHccccccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHccccccHHHHHHHHHHHHHHccc

cHHHHHHHHHHHHHcccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccccccccccccHHHHccccccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccccHHHHccHHHHHHHHHHHHHcccccHHHHHcccccccEEEEEccccccHHHHHHHHHHHcccEEEEEccccHHcccccHHHHHHHHHHHHHHHHcccEEEEEcHHHHccccccccccHHHHHHHHHHHHHcccccccccEEEEEEEcccHHHHHHHHHHHHHcEEEcccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccccccHHHcccccHHHHHHHHHHccccccHHHHHHHHHHHHHcccc

MSFIKDIIDSlgsifsndsspfesernpssstmdgvagtsitnERTAYKLKGYFELAKEEIAKAVRAEEWGLVDDAIIHYKNAQRIlteasstpvpsyistseheKVKSYRQKISKWQSQVSDRLQALNRraggtstskstsphaqtaavsstsnfrknispnsprssrnnpvvrnqtektgsskplaeagngydsKLVEMINTAivdrspsvkwedvAGLEKAKQALMEMVILPAkrrdlftglrrparglllfgppgngkTMLAKAVASESQATFFNVSassltskwvgeGEKLVRTLFMVAISRQPCVIFIDEIDSIMSTRMANENDASRRLKSEFLIQfdgvtsnpnDLVIVMGatnkpqelDDAVLRRLVKRIYVPLPDENVRRLLLKHKLKgqafslpggdlERLVRetegysgsdlQALCEEAAMMPIRELGTNIltvkanqlrplryEDFQKAMAVIrpslnkskWEELEQWNREFGSN

MSFIKDiidslgsifsndsspfesernpssstmdgvagtsitnERTAYKLKGYFELAKEEIAKAVRAEEWGLVDDAIIHYKNAqrilteasstpvpsyistsehekvKSYRQKISKWQSQVSDRLQALNRRAggtstskstsphaqtaavsstsnfrknispnsprssrnnpvvrnqtektgsskplaeagngydSKLVEMINTAivdrspsvkweDVAGLEKAKQALMEMVILPAKRRDLFTGLRRPARGLLLFGPPGNGKTMLAKAVASESQATFFNvsassltskwvGEGEKLVRTLFMVAISRQPCVIFIDEIDSIMSTRMANENDASRRLKSEFLIQFDGVTSNPNDLVIVMGAtnkpqeldDAVLRRLVKRiyvplpdenVRRLLLKHKlkgqafslpggdlERLVRETEGYSGSDLQALCEEAAMMPIRELGTNILTVKANQLRPLRYEDFQKAMAvirpslnkskweeleqwnrefgsn

MSFIKDIIDSLGSIFSNDSSPFESERNPSSSTMDGVAGTSITNERTAYKLKGYFELAKEEIAKAVRAEEWGLVDDAIIHYKNAQRILTEASSTPVPSYISTSEHEKVKSYRQKISKWQSQVSDRLQALNRRAGGTSTSKSTSPHAQTAAVSSTSNFRKNIspnsprssrnnpvvrnQTEKTGSSKPLAEAGNGYDSKLVEMINTAIVDRSPSVKWEDVAGLEKAKQALMEMVILPAKRRDLFTGLRRPARGLLLFGPPGNGKTMLAKAVASESQATFFNVSASSLTSKWVGEGEKLVRTLFMVAISRQPCVIFIDEIDSIMSTRMANENDASRRLKSEFLIQFDGVTSNPNDLVIVMGATNKPQELDDAVLRRLVKRIYVPLPDENVRRLLLKHKLKGQAFSLPGGDLERLVRETEGYSGSDLQALCEEAAMMPIRELGTNILTVKANQLRPLRYEDFQKAMAVIRPSLNKSKWEELEQWNREFGSN

*****************************************TNERTAYKLKGYFELAKEEIAKAVRAEEWGLVDDAIIHYKNAQRILT************************************************************************************************************KLVEMINTAIVDRSPSVKWEDVAGLEKAKQALMEMVILPAKRRDLFTGLRRPARGLLLFGPPGNGKTMLAKAVASESQATFFNVSASSLTSKWVGEGEKLVRTLFMVAISRQPCVIFIDEIDSIMS*************KSEFLIQFDGVTSNPNDLVIVMGATNKPQELDDAVLRRLVKRIYVPLPDENVRRLLLKHKLKGQAFSLPGGDLERLVRETEGYSGSDLQALCEEAAMMPIRELGTNILTVKANQLRPLRYEDFQKAMAVIRP********************

**FI***IDS*******************************************FELAKEEIAKAVRAEEWGLVDDAIIHYK*********************************************************************************************************************VEMINTAIVDRSPSVKWEDVAGLEKAKQALMEMVILPAKRRDLFTGLRRPARGLLLFGPPGNGKTMLAKAVASESQATFFNVSASSLTSKWVGEGEKLVRTLFMVAISRQPCVIFIDEID*******************EFLIQFDGVTSNPNDLVIVMGATNKPQELDDAVLRRLVKRIYVPLPDENVRRLLLKHKLKGQAFSLPGGDLERLVRETEGYSGSDLQALCEEAAMMPIRE***************LRYEDFQKAMAVIRP****SKWEELEQWNREFG**

MSFIKDIIDSLGSIFSND******************AGTSITNERTAYKLKGYFELAKEEIAKAVRAEEWGLVDDAIIHYKNAQRILTEA*****************************QVSDRLQALN*******************************************************KPLAEAGNGYDSKLVEMINTAIVDRSPSVKWEDVAGLEKAKQALMEMVILPAKRRDLFTGLRRPARGLLLFGPPGNGKTMLAKAVASESQATFFNVSASSLTSKWVGEGEKLVRTLFMVAISRQPCVIFIDEIDSIMSTRMANENDASRRLKSEFLIQFDGVTSNPNDLVIVMGATNKPQELDDAVLRRLVKRIYVPLPDENVRRLLLKHKLKGQAFSLPGGDLERLVRETEGYSGSDLQALCEEAAMMPIRELGTNILTVKANQLRPLRYEDFQKAMAVIRPSLNKSKWEELEQWNREFGSN

*SFIKDIIDSLGSIF************************SITNERTAYKLKGYFELAKEEIAKAVRAEEWGLVDDAIIHYKNAQRILTEASSTPVP********************************************************************************************EAGNGYDSKLVEMINTAIVDRSPSVKWEDVAGLEKAKQALMEMVILPAKRRDLFTGLRRPARGLLLFGPPGNGKTMLAKAVASESQATFFNVSASSLTSKWVGEGEKLVRTLFMVAISRQPCVIFIDEIDSIMST******DASRRLKSEFLIQFDGVTSNPNDLVIVMGATNKPQELDDAVLRRLVKRIYVPLPDENVRRLLLKHKLKGQAFSLPGGDLERLVRETEGYSGSDLQALCEEAAMMPIRELGTNILTVKANQLRPLRYEDFQKAMAVIRPSLNKSKWEELEQWNREFGS*

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		487	2.2.26 [Sep-21-2011]
Q5ZK92		613	Spastin OS=Gallus gallus	yes	no	0.685	0.544	0.519	2e-94
Q6AZT2		600	Spastin OS=Xenopus laevis	N/A	no	0.597	0.485	0.595	4e-94
B4NBP4		777	Spastin OS=Drosophila wil	N/A	no	0.743	0.465	0.489	3e-93
Q05AS3		603	Spastin OS=Xenopus tropic	no	no	0.597	0.482	0.599	2e-91
B3M301		770	Spastin OS=Drosophila ana	N/A	no	0.743	0.470	0.489	3e-90
Q9QYY8		614	Spastin OS=Mus musculus G	yes	no	0.597	0.473	0.589	3e-90
B2RYN7		581	Spastin OS=Rattus norvegi	yes	no	0.597	0.500	0.589	5e-90
Q6GX84		677	Fidgetin-like protein 1 O	yes	no	0.679	0.488	0.465	5e-90
Q9UBP0		616	Spastin OS=Homo sapiens G	yes	no	0.597	0.472	0.585	1e-89
A2VDN5		614	Spastin OS=Bos taurus GN=	yes	no	0.597	0.473	0.589	2e-89

>sp\|Q5ZK92\|SPAST_CHICK Spastin OS=Gallus gallus GN=SPAST PE=2 SV=1	Back alignment and function desciption

 Score =  347 bits (889), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 187/360 (51%), Positives = 243/360 (67%), Gaps = 26/360 (7%)

Query: 134 GTSTSKSTSPHAQTAAVSSTS---NFRKNISPNSP----RSSRNNPVVRNQTEKTGSSKP 186
           G ST+  + P A  A  +  +   N R N  P++P    R  ++  V RN          
Sbjct: 268 GISTASVSRPAANPATSTHKAAPKNSRTN-KPSTPTPAARKKKDTKVFRN---------- 316

Query: 187 LAEAGNGYDSKLVEMINTAIVDRSPSVKWEDVAGLEKAKQALMEMVILPAKRRDLFTGLR 246
                   DS L  +I   IVD  P+VK++D+AG E AKQAL E+VILP+ R +LFTGLR
Sbjct: 317 -------VDSNLANLILNEIVDSGPAVKFDDIAGQELAKQALQEIVILPSLRPELFTGLR 369

Query: 247 RPARGLLLFGPPGNGKTMLAKAVASESQATFFNVSASSLTSKWVGEGEKLVRTLFMVAIS 306
            PARGLLLFGPPGNGKTMLAKAVA+ES ATFFN+SA+SLTSK+VGEGEKLVR LF VA  
Sbjct: 370 APARGLLLFGPPGNGKTMLAKAVAAESNATFFNISAASLTSKYVGEGEKLVRALFAVARE 429

Query: 307 RQPCVIFIDEIDSIMSTRMANENDASRRLKSEFLIQFDGVTSNPNDLVIVMGATNKPQEL 366
            QP +IFIDE+DS++  R   E+DASRRLK+EFLI+FDGV S+  D ++VMGATN+PQEL
Sbjct: 430 LQPSIIFIDEVDSLLCERREGEHDASRRLKTEFLIEFDGVQSSGEDRILVMGATNRPQEL 489

Query: 367 DDAVLRRLVKRIYVPLPDENVRRLLLKHKLKGQAFSLPGGDLERLVRETEGYSGSDLQAL 426
           DDAVLRR  KR+YV LP+E  R +LLK+ L  Q   L   +L +L R T+GYSGSDL AL
Sbjct: 490 DDAVLRRFTKRVYVSLPNEETRLILLKNLLSKQGSPLTQKELAQLARMTDGYSGSDLTAL 549

Query: 427 CEEAAMMPIRELG-TNILTVKANQLRPLRYEDFQKAMAVIRPSLNKSKWEELEQWNREFG 485
            ++AA+ PIREL    +  + A+++R ++  DF +++  I+ SL+    E   +WN++FG
Sbjct: 550 VKDAALGPIRELKPEQVKNMSASEMRNIKLSDFTESLKKIKRSLSPQTLEAYIRWNKDFG 609

ATP-dependent microtubule severing protein. Microtubule severing may promote reorganization of cellular microtubule arrays and the release of microtubules from the centrosome following nucleation. Required for membrane traffic from the endoplasmic reticulum (ER) to the Golgi and for completion of the abscission stage of cytokinesis. Also plays a role in axon growth and the formation of axonal branches.
Gallus gallus (taxid: 9031)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 3

>sp\|Q6AZT2\|SPAST_XENLA Spastin OS=Xenopus laevis GN=spast PE=2 SV=1	Back alignment and function description

>sp\|B4NBP4\|SPAST_DROWI Spastin OS=Drosophila willistoni GN=spas PE=3 SV=1	Back alignment and function description

>sp\|Q05AS3\|SPAST_XENTR Spastin OS=Xenopus tropicalis GN=spast PE=2 SV=1	Back alignment and function description

>sp\|B3M301\|SPAST_DROAN Spastin OS=Drosophila ananassae GN=spas PE=3 SV=1	Back alignment and function description

>sp\|Q9QYY8\|SPAST_MOUSE Spastin OS=Mus musculus GN=Spast PE=2 SV=3	Back alignment and function description

>sp\|B2RYN7\|SPAST_RAT Spastin OS=Rattus norvegicus GN=Spast PE=2 SV=1	Back alignment and function description

>sp\|Q6GX84\|FIGL1_RAT Fidgetin-like protein 1 OS=Rattus norvegicus GN=Fignl1 PE=2 SV=1	Back alignment and function description

>sp\|Q9UBP0\|SPAST_HUMAN Spastin OS=Homo sapiens GN=SPAST PE=1 SV=1	Back alignment and function description

>sp\|A2VDN5\|SPAST_BOVIN Spastin OS=Bos taurus GN=SPAST PE=2 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		487
359489371		491	PREDICTED: spastin-like [Vitis vinifera]	1.0	0.991	0.806	0.0
255541358		518	Spastin, putative [Ricinus communis] gi\|	0.993	0.934	0.771	0.0
16518974		537	Tobacco mosaic virus helicase domain-bin	0.993	0.901	0.738	0.0
356568294		491	PREDICTED: spastin-like [Glycine max]	0.985	0.977	0.748	0.0
449432223		488	PREDICTED: spastin-like [Cucumis sativus	0.993	0.991	0.723	0.0
363806818		486	uncharacterized protein LOC100786789 [Gl	0.985	0.987	0.756	0.0
145361024		491	AAA-type ATPase-like protein [Arabidopsi	1.0	0.991	0.725	0.0
357506967		486	Spastin [Medicago truncatula] gi\|3554987	0.901	0.903	0.793	0.0
145331409		487	AAA-type ATPase-like protein [Arabidopsi	0.995	0.995	0.717	0.0
297828269		491	predicted protein [Arabidopsis lyrata su	1.0	0.991	0.720	0.0

>gi\|359489371\|ref\|XP_003633914.1\| PREDICTED: spastin-like [Vitis vinifera] gi\|296089089\|emb\|CBI38792.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

 Score =  817 bits (2111), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/491 (80%), Positives = 443/491 (90%), Gaps = 4/491 (0%)

Query: 1   MSFIKDIIDSLGSIFSNDSSPFESERNPSSS---TMDGVAGTSITNERTAYKLKGYFELA 57
           MSF+K IIDSLGSIFS+ +SP E++ +P+ S    MDGV GT ++N+R AYKLKGY++LA
Sbjct: 1   MSFLKGIIDSLGSIFSDSTSPDEAQSSPNFSDNGAMDGVVGTGVSNQRIAYKLKGYYDLA 60

Query: 58  KEEIAKAVRAEEWGLVDDAIIHYKNAQRILTEASSTPVPSYISTSEHEKVKSYRQKISKW 117
            EEIAKAVRAEEWGLVDDAI+HYKNAQRIL EASST  PS+IS+SE EKVKSYRQKISKW
Sbjct: 61  TEEIAKAVRAEEWGLVDDAIVHYKNAQRILIEASSTSTPSFISSSEQEKVKSYRQKISKW 120

Query: 118 QSQVSDRLQALNRRAGGTSTSKSTSPHAQTAAVSST-SNFRKNISPNSPRSSRNNPVVRN 176
           Q QV++RL+ L RRAGGTST+K+T    + A  SST SN R ++   SP ++R +P++R+
Sbjct: 121 QGQVAERLEILIRRAGGTSTNKNTLADTKPATTSSTKSNARTDVLQKSPLTNRRSPIMRS 180

Query: 177 QTEKTGSSKPLAEAGNGYDSKLVEMINTAIVDRSPSVKWEDVAGLEKAKQALMEMVILPA 236
           Q++K  SSKP+ E+G+GYD+KLVEMINT IVDRSPSVKW+DVAGLEKAKQAL+EMVILP 
Sbjct: 181 QSDKVVSSKPVQESGHGYDAKLVEMINTVIVDRSPSVKWDDVAGLEKAKQALLEMVILPT 240

Query: 237 KRRDLFTGLRRPARGLLLFGPPGNGKTMLAKAVASESQATFFNVSASSLTSKWVGEGEKL 296
           KR+DLFTGLRRPARGLLLFGPPGNGKTMLAKAVASES ATFFNVSASSLTSKWVGEGEKL
Sbjct: 241 KRKDLFTGLRRPARGLLLFGPPGNGKTMLAKAVASESAATFFNVSASSLTSKWVGEGEKL 300

Query: 297 VRTLFMVAISRQPCVIFIDEIDSIMSTRMANENDASRRLKSEFLIQFDGVTSNPNDLVIV 356
           VRTLFMVAISRQP VIF+DEIDSIMSTRM NEN+ASRRLKSEFL+QFDGVTSNP+DLVIV
Sbjct: 301 VRTLFMVAISRQPSVIFMDEIDSIMSTRMTNENEASRRLKSEFLVQFDGVTSNPDDLVIV 360

Query: 357 MGATNKPQELDDAVLRRLVKRIYVPLPDENVRRLLLKHKLKGQAFSLPGGDLERLVRETE 416
           +GATNKPQELDDAVLRRLVKRIYVPLPDENVRRLLLKHKLKGQAFSLPGGDLERLV+ETE
Sbjct: 361 IGATNKPQELDDAVLRRLVKRIYVPLPDENVRRLLLKHKLKGQAFSLPGGDLERLVQETE 420

Query: 417 GYSGSDLQALCEEAAMMPIRELGTNILTVKANQLRPLRYEDFQKAMAVIRPSLNKSKWEE 476
           GYSGSDLQALCEEAAMMPIRELGTNILTVKANQ+RPLRY DFQKAM VIRPSL K KW+E
Sbjct: 421 GYSGSDLQALCEEAAMMPIRELGTNILTVKANQVRPLRYGDFQKAMTVIRPSLQKGKWQE 480

Query: 477 LEQWNREFGSN 487
           LE WN+EFGSN
Sbjct: 481 LEDWNQEFGSN 491

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|255541358\|ref\|XP_002511743.1\| Spastin, putative [Ricinus communis] gi\|223548923\|gb\|EEF50412.1\| Spastin, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|16518974\|gb\|AAL25088.1\|AF426837_1 Tobacco mosaic virus helicase domain-binding protein [Nicotiana tabacum]	Back alignment and taxonomy information

>gi\|356568294\|ref\|XP_003552348.1\| PREDICTED: spastin-like [Glycine max]	Back alignment and taxonomy information

>gi\|449432223\|ref\|XP_004133899.1\| PREDICTED: spastin-like [Cucumis sativus] gi\|449519940\|ref\|XP_004166992.1\| PREDICTED: spastin-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|363806818\|ref\|NP_001242287.1\| uncharacterized protein LOC100786789 [Glycine max] gi\|255636469\|gb\|ACU18573.1\| unknown [Glycine max]	Back alignment and taxonomy information

>gi\|145361024\|ref\|NP_182074.4\| AAA-type ATPase-like protein [Arabidopsis thaliana] gi\|330255468\|gb\|AEC10562.1\| AAA-type ATPase-like protein [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|357506967\|ref\|XP_003623772.1\| Spastin [Medicago truncatula] gi\|355498787\|gb\|AES79990.1\| Spastin [Medicago truncatula]	Back alignment and taxonomy information

>gi\|145331409\|ref\|NP_001078063.1\| AAA-type ATPase-like protein [Arabidopsis thaliana] gi\|110739496\|dbj\|BAF01657.1\| hypothetical protein [Arabidopsis thaliana] gi\|330255469\|gb\|AEC10563.1\| AAA-type ATPase-like protein [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|297828269\|ref\|XP_002882017.1\| predicted protein [Arabidopsis lyrata subsp. lyrata] gi\|297327856\|gb\|EFH58276.1\| predicted protein [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		487
TAIR\|locus:2043619		491	AT2G45500 [Arabidopsis thalian	1.0	0.991	0.725	9.4e-185
UNIPROTKB\|Q5ZK92		613	SPAST "Spastin" [Gallus gallus	0.597	0.474	0.589	1.2e-87
UNIPROTKB\|F1PR99		624	SPAST "Uncharacterized protein	0.597	0.466	0.589	1.2e-87
UNIPROTKB\|Q05AS3		603	spast "Spastin" [Xenopus (Silu	0.597	0.482	0.599	1.9e-87
UNIPROTKB\|E1C6S3		592	SPAST "Spastin" [Gallus gallus	0.597	0.491	0.589	3.1e-87
UNIPROTKB\|F1NCJ3		600	SPAST "Spastin" [Gallus gallus	0.597	0.485	0.589	3.1e-87
MGI\|MGI:1858896		614	Spast "spastin" [Mus musculus	0.597	0.473	0.589	5e-87
DICTYBASE\|DDB_G0287165		655	DDB_G0287165 "spastin-like pro	0.782	0.581	0.455	1.6e-86
UNIPROTKB\|Q719N1		613	SPAST "Spastin" [Sus scrofa (t	0.597	0.474	0.589	5.7e-86
UNIPROTKB\|Q6AZT2		600	spast "Spastin" [Xenopus laevi	0.597	0.485	0.595	8e-85

TAIR\|locus:2043619 AT2G45500 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 1792 (635.9 bits), Expect = 9.4e-185, P = 9.4e-185
 Identities = 356/491 (72%), Positives = 410/491 (83%)

Query:     1 MSFIKDIIDSLGSIFSNDSS--PFESERNPSSSTMDGVAGTSITNERTAYKLKGYFELAK 58
             MSF++ IIDS  SI + +S   P  S  + SS +M+G+ G  +TNER AYKLKGYF+LAK
Sbjct:     1 MSFLRGIIDSFSSILNEESKKDPSVSSSSTSSESMNGIDGVPVTNERIAYKLKGYFDLAK 60

Query:    59 EEIAKAVRAEEWGLVDDAIIHYKNAQRILTEASSTPVPSYISTSEHEKVKSYRQKISKWQ 118
             EEIAK VRAEEWGL DDA++HY+NAQRI+ EA+STP PSYIS+SE EKV+SYR+KIS WQ
Sbjct:    61 EEIAKGVRAEEWGLHDDALLHYRNAQRIMNEATSTPSPSYISSSEKEKVRSYREKISNWQ 120

Query:   119 SQVSDRLQALNRRAG-GTSTSKSTSPHAQTAAVSST-SNFRKNIXXXXXXXXXXXXXXXX 176
             +QVS+RLQAL +R G G S +K T  +  +A+VSST S +RK +                
Sbjct:   121 NQVSERLQALGKRTGVGMSENKRTVAYPSSASVSSTASRYRKTLSQKTPVARGGVATPRN 180

Query:   177 QTEKTGSSKPLAEAGNGYDSKLVEMINTAIVDRSPSVKWEDVAGLEKAKQALMEMVILPA 236
               +   S KP+ E+GN YD KLVEMINT IVDRSPSVKW+DVAGL  AKQAL+EMVILPA
Sbjct:   181 PKDAAASPKPVKESGNVYDDKLVEMINTTIVDRSPSVKWDDVAGLNGAKQALLEMVILPA 240

Query:   237 KRRDLFTGLRRPARGLLLFGPPGNGKTMLAKAVASESQATFFNVSASSLTSKWVGEGEKL 296
             KRRDLFTGLRRPARGLLLFGPPGNGKTMLAKAVASESQATFFNVSASSLTSKWVGE EKL
Sbjct:   241 KRRDLFTGLRRPARGLLLFGPPGNGKTMLAKAVASESQATFFNVSASSLTSKWVGEAEKL 300

Query:   297 VRTLFMVAISRQPCVIFIDEIDSIMSTRMANENDASRRLKSEFLIQFDGVTSNPNDLVIV 356
             V+TLF VAISRQP VIF+DEIDSIMSTR  +EN+ASRRLKSEFLIQFDGVTSNP+DLVI+
Sbjct:   301 VKTLFQVAISRQPSVIFMDEIDSIMSTRSTSENEASRRLKSEFLIQFDGVTSNPDDLVII 360

Query:   357 MGATNKPQELDDAVLRRLVKRIYVPLPDENVRRLLLKHKLKGQAFSLPGGDLERLVRETE 416
             +GATNKPQELDDAVLRRLVKRIYVPLPD NVR+LL K KLK Q  SL  GD++++V+ETE
Sbjct:   361 IGATNKPQELDDAVLRRLVKRIYVPLPDSNVRKLLFKTKLKCQPHSLSDGDIDKIVKETE 420

Query:   417 GYSGSDLQALCEEAAMMPIRELGTNILTVKANQLRPLRYEDFQKAMAVIRPSLNKSKWEE 476
             GYSGSDLQALCEEAAMMPIRELG NILT++AN++R LRY+DF+K+MAVIRPSL+KSKWEE
Sbjct:   421 GYSGSDLQALCEEAAMMPIRELGANILTIQANKVRSLRYDDFRKSMAVIRPSLSKSKWEE 480

Query:   477 LEQWNREFGSN 487
             LE+WN EFGSN
Sbjct:   481 LERWNSEFGSN 491

GO:0000166 "nucleotide binding" evidence=IEA

GO:0005524 "ATP binding" evidence=IEA;ISS

GO:0005634 "nucleus" evidence=ISM

GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA

GO:0006635 "fatty acid beta-oxidation" evidence=RCA

GO:0016558 "protein import into peroxisome matrix" evidence=RCA

UNIPROTKB\|Q5ZK92 SPAST "Spastin" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

UNIPROTKB\|F1PR99 SPAST "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|Q05AS3 spast "Spastin" [Xenopus (Silurana) tropicalis (taxid:8364)]	Back alignment and assigned GO terms

UNIPROTKB\|E1C6S3 SPAST "Spastin" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

UNIPROTKB\|F1NCJ3 SPAST "Spastin" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

MGI\|MGI:1858896 Spast "spastin" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

DICTYBASE\|DDB_G0287165 DDB_G0287165 "spastin-like protein" [Dictyostelium discoideum (taxid:44689)]	Back alignment and assigned GO terms

UNIPROTKB\|Q719N1 SPAST "Spastin" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

UNIPROTKB\|Q6AZT2 spast "Spastin" [Xenopus laevis (taxid:8355)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	3.6.4	0.766

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		487
COG0464		494	COG0464, SpoVK, ATPases of the AAA+ class [Posttra	1e-83
PRK03992		389	PRK03992, PRK03992, proteasome-activating nucleoti	6e-64
COG1222		406	COG1222, RPT1, ATP-dependent 26S proteasome regula	8e-64
TIGR01243		733	TIGR01243, CDC48, AAA family ATPase, CDC48 subfami	1e-63
TIGR01242		364	TIGR01242, 26Sp45, 26S proteasome subunit P45 fami	1e-57
pfam00004		131	pfam00004, AAA, ATPase family associated with vari	4e-51
TIGR01241		495	TIGR01241, FtsH_fam, ATP-dependent metalloprotease	5e-50
PTZ00454		398	PTZ00454, PTZ00454, 26S protease regulatory subuni	5e-50
TIGR01243		733	TIGR01243, CDC48, AAA family ATPase, CDC48 subfami	2e-48
PTZ00361		438	PTZ00361, PTZ00361, 26 proteosome regulatory subun	2e-46
COG0465		596	COG0465, HflB, ATP-dependent Zn proteases [Posttra	1e-40
CHL00176		638	CHL00176, ftsH, cell division protein; Validated	2e-40
COG1223		368	COG1223, COG1223, Predicted ATPase (AAA+ superfami	2e-34
PRK10733		644	PRK10733, hflB, ATP-dependent metalloprotease; Rev	4e-33
TIGR03689		512	TIGR03689, pup_AAA, proteasome ATPase	1e-30
COG0464		494	COG0464, SpoVK, ATPases of the AAA+ class [Posttra	4e-29
cd02679		79	cd02679, MIT_spastin, MIT: domain contained within	3e-27
cd00009		151	cd00009, AAA, The AAA+ (ATPases Associated with a	4e-24
smart00745		77	smart00745, MIT, Microtubule Interacting and Traff	2e-18
CHL00195		489	CHL00195, ycf46, Ycf46; Provisional	5e-16
smart00382		148	smart00382, AAA, ATPases associated with a variety	1e-14
pfam04212		69	pfam04212, MIT, MIT (microtubule interacting and t	1e-10
PRK13342		413	PRK13342, PRK13342, recombination factor protein R	2e-09
COG0714		329	COG0714, COG0714, MoxR-like ATPases [General funct	4e-08
COG2256		436	COG2256, MGS1, ATPase related to the helicase subu	9e-08
TIGR00382		413	TIGR00382, clpX, endopeptidase Clp ATP-binding reg	2e-05
pfam05496		231	pfam05496, RuvB_N, Holliday junction DNA helicase	6e-05
pfam13401		124	pfam13401, AAA_22, AAA domain	6e-05
TIGR03922		557	TIGR03922, T7SS_EccA, type VII secretion AAA-ATPas	7e-05
pfam07724		168	pfam07724, AAA_2, AAA domain (Cdc48 subfamily)	1e-04
pfam00910		105	pfam00910, RNA_helicase, RNA helicase	1e-04
PRK00080		328	PRK00080, ruvB, Holliday junction DNA helicase Ruv	2e-04
COG0606		490	COG0606, COG0606, Predicted ATPase with chaperone	3e-04
PRK04195		482	PRK04195, PRK04195, replication factor C large sub	3e-04
cd02682		75	cd02682, MIT_AAA_Arch, MIT: domain contained withi	6e-04
pfam07728		135	pfam07728, AAA_5, AAA domain (dynein-related subfa	7e-04
PHA02544		316	PHA02544, 44, clamp loader, small subunit; Provisi	8e-04
COG1219		408	COG1219, ClpX, ATP-dependent protease Clp, ATPase	9e-04
pfam09336		62	pfam09336, Vps4_C, Vps4 C terminal oligomerisation	0.001
TIGR00635		305	TIGR00635, ruvB, Holliday junction DNA helicase, R	0.001
COG2255		332	COG2255, RuvB, Holliday junction resolvasome, heli	0.001
TIGR00763		775	TIGR00763, lon, ATP-dependent protease La	0.001
pfam01078		207	pfam01078, Mg_chelatase, Magnesium chelatase, subu	0.001
PRK08116		268	PRK08116, PRK08116, hypothetical protein; Validate	0.002
PRK13341		725	PRK13341, PRK13341, recombination factor protein R	0.002
COG1224		450	COG1224, TIP49, DNA helicase TIP49, TBP-interactin	0.004
PRK05342		412	PRK05342, clpX, ATP-dependent protease ATP-binding	0.004

>gnl\|CDD\|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

 Score =  266 bits (681), Expect = 1e-83
 Identities = 118/270 (43%), Positives = 162/270 (60%), Gaps = 16/270 (5%)

Query: 211 PSVKWEDVAGLEKAKQALMEMVILPAKRRDLFTGL-RRPARGLLLFGPPGNGKTMLAKAV 269
             V  +D+ GLE+AK+ L E +  P KR +LF  L  RP +G+LL+GPPG GKT+LAKAV
Sbjct: 237 EDVTLDDIGGLEEAKEELKEAIETPLKRPELFRKLGLRPPKGVLLYGPPGTGKTLLAKAV 296

Query: 270 ASESQATFFNVSASSLTSKWVGEGEKLVRTLFMVAISRQPCVIFIDEIDSIMSTRMANEN 329
           A ES++ F +V  S L SKWVGE EK +R LF  A    P +IFIDEIDS+ S R  +E+
Sbjct: 297 ALESRSRFISVKGSELLSKWVGESEKNIRELFEKARKLAPSIIFIDEIDSLASGRGPSED 356

Query: 330 DASRRLKSEFLIQFDGVTSNPNDLVIVMGATNKPQELDDAVLR--RLVKRIYVPLPDENV 387
            + RR+  + L + DG+     + V+V+ ATN+P +LD A+LR  R  + IYVPLPD   
Sbjct: 357 GSGRRVVGQLLTELDGI--EKAEGVLVIAATNRPDDLDPALLRPGRFDRLIYVPLPDLEE 414

Query: 388 RRLLLKHKLKGQAFSLPGG-DLERLVRETEGYSGSDLQALCEEAAMMPIRELGTNILTVK 446
           R  + K  L+ +   L    DLE L   TEGYSG+D+ AL  EAA+  +RE     +T+ 
Sbjct: 415 RLEIFKIHLRDKKPPLAEDVDLEELAEITEGYSGADIAALVREAALEALREARRREVTLD 474

Query: 447 ANQLRPLRYEDFQKAMAVIRPSLNKSKWEE 476
                     DF  A+  I+PS+   +W+E
Sbjct: 475 ----------DFLDALKKIKPSVTYEEWKE 494

Length = 494

>gnl\|CDD\|179699 PRK03992, PRK03992, proteasome-activating nucleotidase; Provisional	Back alignment and domain information

>gnl\|CDD\|224143 COG1222, RPT1, ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>gnl\|CDD\|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily	Back alignment and domain information

>gnl\|CDD\|130309 TIGR01242, 26Sp45, 26S proteasome subunit P45 family	Back alignment and domain information

>gnl\|CDD\|215649 pfam00004, AAA, ATPase family associated with various cellular activities (AAA)	Back alignment and domain information

>gnl\|CDD\|233327 TIGR01241, FtsH_fam, ATP-dependent metalloprotease FtsH	Back alignment and domain information

>gnl\|CDD\|240423 PTZ00454, PTZ00454, 26S protease regulatory subunit 6B-like protein; Provisional	Back alignment and domain information

>gnl\|CDD\|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily	Back alignment and domain information

>gnl\|CDD\|185575 PTZ00361, PTZ00361, 26 proteosome regulatory subunit 4-like protein; Provisional	Back alignment and domain information

>gnl\|CDD\|223541 COG0465, HflB, ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>gnl\|CDD\|214386 CHL00176, ftsH, cell division protein; Validated	Back alignment and domain information

>gnl\|CDD\|224144 COG1223, COG1223, Predicted ATPase (AAA+ superfamily) [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|182683 PRK10733, hflB, ATP-dependent metalloprotease; Reviewed	Back alignment and domain information

>gnl\|CDD\|200312 TIGR03689, pup_AAA, proteasome ATPase	Back alignment and domain information

>gnl\|CDD\|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>gnl\|CDD\|239142 cd02679, MIT_spastin, MIT: domain contained within Microtubule Interacting and Trafficking molecules	Back alignment and domain information

>gnl\|CDD\|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold	Back alignment and domain information

>gnl\|CDD\|197854 smart00745, MIT, Microtubule Interacting and Trafficking molecule domain	Back alignment and domain information

>gnl\|CDD\|177094 CHL00195, ycf46, Ycf46; Provisional	Back alignment and domain information

>gnl\|CDD\|214640 smart00382, AAA, ATPases associated with a variety of cellular activities	Back alignment and domain information

>gnl\|CDD\|146707 pfam04212, MIT, MIT (microtubule interacting and transport) domain	Back alignment and domain information

>gnl\|CDD\|237355 PRK13342, PRK13342, recombination factor protein RarA; Reviewed	Back alignment and domain information

>gnl\|CDD\|223786 COG0714, COG0714, MoxR-like ATPases [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|225165 COG2256, MGS1, ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|232949 TIGR00382, clpX, endopeptidase Clp ATP-binding regulatory subunit (clpX)	Back alignment and domain information

>gnl\|CDD\|203260 pfam05496, RuvB_N, Holliday junction DNA helicase ruvB N-terminus	Back alignment and domain information

>gnl\|CDD\|222104 pfam13401, AAA_22, AAA domain	Back alignment and domain information

>gnl\|CDD\|188437 TIGR03922, T7SS_EccA, type VII secretion AAA-ATPase EccA	Back alignment and domain information

>gnl\|CDD\|219536 pfam07724, AAA_2, AAA domain (Cdc48 subfamily)	Back alignment and domain information

>gnl\|CDD\|216186 pfam00910, RNA_helicase, RNA helicase	Back alignment and domain information

>gnl\|CDD\|234619 PRK00080, ruvB, Holliday junction DNA helicase RuvB; Reviewed	Back alignment and domain information

>gnl\|CDD\|223679 COG0606, COG0606, Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>gnl\|CDD\|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional	Back alignment and domain information

>gnl\|CDD\|239145 cd02682, MIT_AAA_Arch, MIT: domain contained within Microtubule Interacting and Trafficking molecules	Back alignment and domain information

>gnl\|CDD\|219538 pfam07728, AAA_5, AAA domain (dynein-related subfamily)	Back alignment and domain information

>gnl\|CDD\|222866 PHA02544, 44, clamp loader, small subunit; Provisional	Back alignment and domain information

>gnl\|CDD\|224140 COG1219, ClpX, ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>gnl\|CDD\|204202 pfam09336, Vps4_C, Vps4 C terminal oligomerisation domain	Back alignment and domain information

>gnl\|CDD\|129721 TIGR00635, ruvB, Holliday junction DNA helicase, RuvB subunit	Back alignment and domain information

>gnl\|CDD\|225164 COG2255, RuvB, Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|233119 TIGR00763, lon, ATP-dependent protease La	Back alignment and domain information

>gnl\|CDD\|144608 pfam01078, Mg_chelatase, Magnesium chelatase, subunit ChlI	Back alignment and domain information

>gnl\|CDD\|236153 PRK08116, PRK08116, hypothetical protein; Validated	Back alignment and domain information

>gnl\|CDD\|237354 PRK13341, PRK13341, recombination factor protein RarA/unknown domain fusion protein; Reviewed	Back alignment and domain information

>gnl\|CDD\|224145 COG1224, TIP49, DNA helicase TIP49, TBP-interacting protein [Transcription]	Back alignment and domain information

>gnl\|CDD\|235422 PRK05342, clpX, ATP-dependent protease ATP-binding subunit ClpX; Provisional	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		487
KOG0739		439	consensus AAA+-type ATPase [Posttranslational modi	100.0
KOG0738		491	consensus AAA+-type ATPase [Posttranslational modi	100.0
KOG0730		693	consensus AAA+-type ATPase [Posttranslational modi	100.0
COG1222		406	RPT1 ATP-dependent 26S proteasome regulatory subun	100.0
KOG0733		802	consensus Nuclear AAA ATPase (VCP subfamily) [Post	100.0
KOG0740		428	consensus AAA+-type ATPase [Posttranslational modi	100.0
KOG0736		953	consensus Peroxisome assembly factor 2 containing	100.0
KOG0737		386	consensus AAA+-type ATPase [Posttranslational modi	100.0
KOG0733		802	consensus Nuclear AAA ATPase (VCP subfamily) [Post	100.0
TIGR01243		733	CDC48 AAA family ATPase, CDC48 subfamily. This sub	100.0
KOG0734		752	consensus AAA+-type ATPase containing the peptidas	100.0
COG0464		494	SpoVK ATPases of the AAA+ class [Posttranslational	100.0
KOG0727		408	consensus 26S proteasome regulatory complex, ATPas	100.0
COG1223		368	Predicted ATPase (AAA+ superfamily) [General funct	100.0
KOG0652		424	consensus 26S proteasome regulatory complex, ATPas	100.0
KOG0735		952	consensus AAA+-type ATPase [Posttranslational modi	100.0
CHL00195		489	ycf46 Ycf46; Provisional	100.0
PTZ00454		398	26S protease regulatory subunit 6B-like protein; P	100.0
KOG0728		404	consensus 26S proteasome regulatory complex, ATPas	100.0
KOG0731		774	consensus AAA+-type ATPase containing the peptidas	100.0
KOG0726		440	consensus 26S proteasome regulatory complex, ATPas	100.0
PRK03992		389	proteasome-activating nucleotidase; Provisional	100.0
KOG0729		435	consensus 26S proteasome regulatory complex, ATPas	100.0
PTZ00361		438	26 proteosome regulatory subunit 4-like protein; P	100.0
COG0465		596	HflB ATP-dependent Zn proteases [Posttranslational	100.0
TIGR01241		495	FtsH_fam ATP-dependent metalloprotease FtsH. HflB(	100.0
TIGR01242		364	26Sp45 26S proteasome subunit P45 family. Many pro	100.0
KOG0730		693	consensus AAA+-type ATPase [Posttranslational modi	100.0
TIGR03689		512	pup_AAA proteasome ATPase. In the Actinobacteria,	100.0
KOG0732		1080	consensus AAA+-type ATPase containing the bromodom	100.0
CHL00176		638	ftsH cell division protein; Validated	100.0
TIGR01243		733	CDC48 AAA family ATPase, CDC48 subfamily. This sub	100.0
KOG0651		388	consensus 26S proteasome regulatory complex, ATPas	100.0
PRK10733		644	hflB ATP-dependent metalloprotease; Reviewed	99.98
KOG0741		744	consensus AAA+-type ATPase [Posttranslational modi	99.97
CHL00206		2281	ycf2 Ycf2; Provisional	99.97
PLN00020		413	ribulose bisphosphate carboxylase/oxygenase activa	99.97
CHL00181		287	cbbX CbbX; Provisional	99.92
TIGR02881		261	spore_V_K stage V sporulation protein K. Members o	99.91
TIGR02880		284	cbbX_cfxQ probable Rubsico expression protein CbbX	99.91
PF05496		233	RuvB_N: Holliday junction DNA helicase ruvB N-term	99.89
PRK14956		484	DNA polymerase III subunits gamma and tau; Provisi	99.88
KOG0742		630	consensus AAA+-type ATPase [Posttranslational modi	99.87
COG2256		436	MGS1 ATPase related to the helicase subunit of the	99.87
PRK00080		328	ruvB Holliday junction DNA helicase RuvB; Reviewed	99.87
PRK07003		830	DNA polymerase III subunits gamma and tau; Validat	99.87
PRK12323		700	DNA polymerase III subunits gamma and tau; Provisi	99.87
KOG0744		423	consensus AAA+-type ATPase [Posttranslational modi	99.87
PF00004		132	AAA: ATPase family associated with various cellula	99.87
KOG0736		953	consensus Peroxisome assembly factor 2 containing	99.87
KOG0735		952	consensus AAA+-type ATPase [Posttranslational modi	99.86
PRK14962		472	DNA polymerase III subunits gamma and tau; Provisi	99.86
PRK14960		702	DNA polymerase III subunits gamma and tau; Provisi	99.85
TIGR02639		731	ClpA ATP-dependent Clp protease ATP-binding subuni	99.85
PRK14949		944	DNA polymerase III subunits gamma and tau; Provisi	99.85
KOG0989		346	consensus Replication factor C, subunit RFC4 [Repl	99.85
PRK14958		509	DNA polymerase III subunits gamma and tau; Provisi	99.85
TIGR00635		305	ruvB Holliday junction DNA helicase, RuvB subunit.	99.85
TIGR02902		531	spore_lonB ATP-dependent protease LonB. Members of	99.84
COG2255		332	RuvB Holliday junction resolvasome, helicase subun	99.84
PRK07994		647	DNA polymerase III subunits gamma and tau; Validat	99.84
PRK14961		363	DNA polymerase III subunits gamma and tau; Provisi	99.84
PRK14964		491	DNA polymerase III subunits gamma and tau; Provisi	99.84
PRK06645		507	DNA polymerase III subunits gamma and tau; Validat	99.83
PLN03025		319	replication factor C subunit; Provisional	99.83
PRK08691		709	DNA polymerase III subunits gamma and tau; Validat	99.83
PRK14951		618	DNA polymerase III subunits gamma and tau; Provisi	99.83
PRK04195		482	replication factor C large subunit; Provisional	99.83
KOG0743		457	consensus AAA+-type ATPase [Posttranslational modi	99.82
PRK14963		504	DNA polymerase III subunits gamma and tau; Provisi	99.82
PRK14957		546	DNA polymerase III subunits gamma and tau; Provisi	99.82
PRK13342		413	recombination factor protein RarA; Reviewed	99.81
PRK07764		824	DNA polymerase III subunits gamma and tau; Validat	99.81
PRK14959		624	DNA polymerase III subunits gamma and tau; Provisi	99.81
PRK05896		605	DNA polymerase III subunits gamma and tau; Validat	99.81
PRK07133		725	DNA polymerase III subunits gamma and tau; Validat	99.81
PRK14969		527	DNA polymerase III subunits gamma and tau; Provisi	99.81
PRK14952		584	DNA polymerase III subunits gamma and tau; Provisi	99.81
TIGR00763		775	lon ATP-dependent protease La. This protein is ind	99.8
PRK12402		337	replication factor C small subunit 2; Reviewed	99.8
PRK05563		559	DNA polymerase III subunits gamma and tau; Validat	99.8
PRK08451		535	DNA polymerase III subunits gamma and tau; Validat	99.8
PRK14965		576	DNA polymerase III subunits gamma and tau; Provisi	99.79
TIGR02397		355	dnaX_nterm DNA polymerase III, subunit gamma and t	99.79
PRK14953		486	DNA polymerase III subunits gamma and tau; Provisi	99.79
PRK06305		451	DNA polymerase III subunits gamma and tau; Validat	99.78
PRK06647		563	DNA polymerase III subunits gamma and tau; Validat	99.78
TIGR03345		852	VI_ClpV1 type VI secretion ATPase, ClpV1 family. M	99.78
PHA02544		316	44 clamp loader, small subunit; Provisional	99.78
PRK09111		598	DNA polymerase III subunits gamma and tau; Validat	99.78
PRK14970		367	DNA polymerase III subunits gamma and tau; Provisi	99.77
PRK00149		450	dnaA chromosomal replication initiation protein; R	99.77
TIGR00362		405	DnaA chromosomal replication initiator protein Dna	99.77
COG2812		515	DnaX DNA polymerase III, gamma/tau subunits [DNA r	99.77
PRK00440		319	rfc replication factor C small subunit; Reviewed	99.77
KOG2004		906	consensus Mitochondrial ATP-dependent protease PIM	99.77
PRK13341		725	recombination factor protein RarA/unknown domain f	99.77
PRK14955		397	DNA polymerase III subunits gamma and tau; Provisi	99.76
KOG2028		554	consensus ATPase related to the helicase subunit o	99.76
COG0466		782	Lon ATP-dependent Lon protease, bacterial type [Po	99.76
PRK11034		758	clpA ATP-dependent Clp protease ATP-binding subuni	99.76
PRK14954		620	DNA polymerase III subunits gamma and tau; Provisi	99.75
PRK14948		620	DNA polymerase III subunits gamma and tau; Provisi	99.75
PRK10865		857	protein disaggregation chaperone; Provisional	99.75
PRK12422		445	chromosomal replication initiation protein; Provis	99.74
CHL00095		821	clpC Clp protease ATP binding subunit	99.74
PRK14950		585	DNA polymerase III subunits gamma and tau; Provisi	99.74
COG0464		494	SpoVK ATPases of the AAA+ class [Posttranslational	99.73
PRK07940		394	DNA polymerase III subunit delta'; Validated	99.73
PRK06893		229	DNA replication initiation factor; Validated	99.73
TIGR03346		852	chaperone_ClpB ATP-dependent chaperone ClpB. Membe	99.73
PRK14088		440	dnaA chromosomal replication initiation protein; P	99.73
PRK14971		614	DNA polymerase III subunits gamma and tau; Provisi	99.72
PRK14086		617	dnaA chromosomal replication initiation protein; P	99.72
PRK05342		412	clpX ATP-dependent protease ATP-binding subunit Cl	99.72
PRK08084		235	DNA replication initiation factor; Provisional	99.71
PRK08903		227	DnaA regulatory inactivator Hda; Validated	99.71
TIGR00390		441	hslU ATP-dependent protease HslVU, ATPase subunit.	99.71
TIGR03420		226	DnaA_homol_Hda DnaA regulatory inactivator Hda. Me	99.71
PF05673		249	DUF815: Protein of unknown function (DUF815); Inte	99.7
TIGR02928		365	orc1/cdc6 family replication initiation protein. M	99.7
TIGR02903		615	spore_lon_C ATP-dependent protease, Lon family. Me	99.69
PRK05201		443	hslU ATP-dependent protease ATP-binding subunit Hs	99.69
PF00308		219	Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013	99.68
PRK00411		394	cdc6 cell division control protein 6; Reviewed	99.68
KOG0991		333	consensus Replication factor C, subunit RFC2 [Repl	99.67
PRK08727		233	hypothetical protein; Validated	99.67
PRK10787		784	DNA-binding ATP-dependent protease La; Provisional	99.66
PTZ00112		1164	origin recognition complex 1 protein; Provisional	99.66
PRK14087		450	dnaA chromosomal replication initiation protein; P	99.66
PRK05642		234	DNA replication initiation factor; Validated	99.65
PRK06620		214	hypothetical protein; Validated	99.65
TIGR00382		413	clpX endopeptidase Clp ATP-binding regulatory subu	99.64
PRK11034		758	clpA ATP-dependent Clp protease ATP-binding subuni	99.64
COG0593		408	DnaA ATPase involved in DNA replication initiation	99.62
cd02679		79	MIT_spastin MIT: domain contained within Microtubu	99.61
PRK13407		334	bchI magnesium chelatase subunit I; Provisional	99.6
PRK07471		365	DNA polymerase III subunit delta'; Validated	99.59
COG0542		786	clpA ATP-binding subunits of Clp protease and DnaK	99.59
PRK09087		226	hypothetical protein; Validated	99.58
TIGR02639		731	ClpA ATP-dependent Clp protease ATP-binding subuni	99.58
PRK09112		351	DNA polymerase III subunit delta'; Validated	99.58
PRK05564		313	DNA polymerase III subunit delta'; Validated	99.57
TIGR02640		262	gas_vesic_GvpN gas vesicle protein GvpN. Members o	99.56
KOG1969		877	consensus DNA replication checkpoint protein CHL12	99.55
COG2607		287	Predicted ATPase (AAA+ superfamily) [General funct	99.53
CHL00081		350	chlI Mg-protoporyphyrin IX chelatase	99.52
COG1224		450	TIP49 DNA helicase TIP49, TBP-interacting protein	99.52
KOG2035		351	consensus Replication factor C, subunit RFC3 [Cell	99.5
TIGR03346		852	chaperone_ClpB ATP-dependent chaperone ClpB. Membe	99.5
TIGR03345		852	VI_ClpV1 type VI secretion ATPase, ClpV1 family. M	99.48
cd00009		151	AAA The AAA+ (ATPases Associated with a wide varie	99.48
TIGR02030		337	BchI-ChlI magnesium chelatase ATPase subunit I. Th	99.47
PRK07399		314	DNA polymerase III subunit delta'; Validated	99.47
PRK04132		846	replication factor C small subunit; Provisional	99.47
COG0542		786	clpA ATP-binding subunits of Clp protease and DnaK	99.47
COG1474		366	CDC6 Cdc6-related protein, AAA superfamily ATPase	99.46
CHL00095		821	clpC Clp protease ATP binding subunit	99.46
cd02677		75	MIT_SNX15 MIT: domain contained within Microtubule	99.46
cd02683		77	MIT_1 MIT: domain contained within Microtubule Int	99.46
TIGR00678		188	holB DNA polymerase III, delta' subunit. At positi	99.45
TIGR01650		327	PD_CobS cobaltochelatase, CobS subunit. This model	99.44
COG0470		325	HolB ATPase involved in DNA replication [DNA repli	99.44
PRK10865		857	protein disaggregation chaperone; Provisional	99.44
cd02684		75	MIT_2 MIT: domain contained within Microtubule Int	99.44
TIGR02974		329	phageshock_pspF psp operon transcriptional activat	99.42
smart00745		77	MIT Microtubule Interacting and Trafficking molecu	99.42
KOG0990		360	consensus Replication factor C, subunit RFC5 [Repl	99.41
TIGR02442		633	Cob-chelat-sub cobaltochelatase subunit. A number	99.41
PRK08058		329	DNA polymerase III subunit delta'; Validated	99.41
PRK11608		326	pspF phage shock protein operon transcriptional ac	99.41
cd02681		76	MIT_calpain7_1 MIT: domain contained within Microt	99.4
TIGR01817		534	nifA Nif-specific regulatory protein. This model r	99.4
PRK05707		328	DNA polymerase III subunit delta'; Validated	99.4
TIGR03015		269	pepcterm_ATPase putative secretion ATPase, PEP-CTE	99.38
PF04212		69	MIT: MIT (microtubule interacting and transport) d	99.38
COG1221		403	PspF Transcriptional regulators containing an AAA-	99.37
PF06068		398	TIP49: TIP49 C-terminus; InterPro: IPR010339 This	99.37
TIGR02329		526	propionate_PrpR propionate catabolism operon regul	99.36
COG1219		408	ClpX ATP-dependent protease Clp, ATPase subunit [P	99.35
COG3829		560	RocR Transcriptional regulator containing PAS, AAA	99.35
PRK15424		538	propionate catabolism operon regulatory protein Pr	99.35
PRK05022		509	anaerobic nitric oxide reductase transcription reg	99.35
PRK13531		498	regulatory ATPase RavA; Provisional	99.34
TIGR00602		637	rad24 checkpoint protein rad24. This family is bas	99.34
PRK11388		638	DNA-binding transcriptional regulator DhaR; Provis	99.33
PHA02244		383	ATPase-like protein	99.33
PRK10820		520	DNA-binding transcriptional regulator TyrR; Provis	99.33
COG2204		464	AtoC Response regulator containing CheY-like recei	99.33
cd02678		75	MIT_VPS4 MIT: domain contained within Microtubule	99.32
cd02682		75	MIT_AAA_Arch MIT: domain contained within Microtub	99.31
PRK15429		686	formate hydrogenlyase transcriptional activator Fh	99.31
COG0714		329	MoxR-like ATPases [General function prediction onl	99.3
PRK11331		459	5-methylcytosine-specific restriction enzyme subun	99.29
PF01078		206	Mg_chelatase: Magnesium chelatase, subunit ChlI; I	99.29
TIGR00764		608	lon_rel lon-related putative ATP-dependent proteas	99.29
PRK06871		325	DNA polymerase III subunit delta'; Validated	99.28
COG1220		444	HslU ATP-dependent protease HslVU (ClpYQ), ATPase	99.28
PRK07993		334	DNA polymerase III subunit delta'; Validated	99.27
PF07728		139	AAA_5: AAA domain (dynein-related subfamily); Inte	99.26
TIGR00368		499	Mg chelatase-related protein. The N-terminal end m	99.26
smart00350		509	MCM minichromosome maintenance proteins.	99.26
PF05621		302	TniB: Bacterial TniB protein; InterPro: IPR008868	99.25
KOG0745		564	consensus Putative ATP-dependent Clp-type protease	99.25
PF13177		162	DNA_pol3_delta2: DNA polymerase III, delta subunit	99.22
cd02656		75	MIT MIT: domain contained within Microtubule Inter	99.22
smart00382		148	AAA ATPases associated with a variety of cellular	99.22
PRK08769		319	DNA polymerase III subunit delta'; Validated	99.22
COG3604		550	FhlA Transcriptional regulator containing GAF, AAA	99.21
TIGR02031		589	BchD-ChlD magnesium chelatase ATPase subunit D. Th	99.19
smart00763		361	AAA_PrkA PrkA AAA domain. This is a family of PrkA	99.18
TIGR02915		445	PEP_resp_reg putative PEP-CTERM system response re	99.16
PRK06090		319	DNA polymerase III subunit delta'; Validated	99.16
KOG1942		456	consensus DNA helicase, TBP-interacting protein [R	99.15
PF07724		171	AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR	99.15
PRK06964		342	DNA polymerase III subunit delta'; Validated	99.14
cd02680		75	MIT_calpain7_2 MIT: domain contained within Microt	99.13
PF07726		131	AAA_3: ATPase family associated with various cellu	99.11
KOG0741		744	consensus AAA+-type ATPase [Posttranslational modi	99.09
PF03215		519	Rad17: Rad17 cell cycle checkpoint protein	99.07
PF00158		168	Sigma54_activat: Sigma-54 interaction domain; Inte	99.07
KOG1514		767	consensus Origin recognition complex, subunit 1, a	99.06
PRK10923		469	glnG nitrogen regulation protein NR(I); Provisiona	99.06
PRK09862		506	putative ATP-dependent protease; Provisional	99.05
PTZ00111		915	DNA replication licensing factor MCM4; Provisional	99.03
PRK11361		457	acetoacetate metabolism regulatory protein AtoC; P	99.01
COG0606		490	Predicted ATPase with chaperone activity [Posttran	99.01
PRK08116		268	hypothetical protein; Validated	99.01
PRK13765		637	ATP-dependent protease Lon; Provisional	99.0
PRK12377		248	putative replication protein; Provisional	98.99
KOG2680		454	consensus DNA helicase TIP49, TBP-interacting prot	98.97
PRK15115		444	response regulator GlrR; Provisional	98.96
PRK08699		325	DNA polymerase III subunit delta'; Validated	98.96
TIGR01818		463	ntrC nitrogen regulation protein NR(I). This model	98.94
PF01637		234	Arch_ATPase: Archaeal ATPase; InterPro: IPR011579	98.94
COG1239		423	ChlI Mg-chelatase subunit ChlI [Coenzyme metabolis	98.93
PRK07952		244	DNA replication protein DnaC; Validated	98.93
KOG1970		634	consensus Checkpoint RAD17-RFC complex, RAD17/RAD2	98.93
PRK05917		290	DNA polymerase III subunit delta'; Validated	98.92
KOG2227		529	consensus Pre-initiation complex, subunit CDC6, AA	98.88
PF14532		138	Sigma54_activ_2: Sigma-54 interaction domain; PDB:	98.85
PRK08181		269	transposase; Validated	98.84
PRK06835		329	DNA replication protein DnaC; Validated	98.81
COG3283		511	TyrR Transcriptional regulator of aromatic amino a	98.79
PRK13406		584	bchD magnesium chelatase subunit D; Provisional	98.76
PRK10365		441	transcriptional regulatory protein ZraR; Provision	98.75
PRK07276		290	DNA polymerase III subunit delta'; Validated	98.74
COG1241		682	MCM2 Predicted ATPase involved in replication cont	98.72
PF13173		128	AAA_14: AAA domain	98.7
PRK07132		299	DNA polymerase III subunit delta'; Validated	98.66
KOG0480		764	consensus DNA replication licensing factor, MCM6 c	98.65
KOG1968		871	consensus Replication factor C, subunit RFC1 (larg	98.65
PF01695		178	IstB_IS21: IstB-like ATP binding protein; InterPro	98.65
PRK06526		254	transposase; Provisional	98.64
PRK05818		261	DNA polymerase III subunit delta'; Validated	98.64
COG1484		254	DnaC DNA replication protein [DNA replication, rec	98.63
KOG0478		804	consensus DNA replication licensing factor, MCM4 c	98.6
PF13401		131	AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S	98.6
PRK08939		306	primosomal protein DnaI; Reviewed	98.59
KOG1051		898	consensus Chaperone HSP104 and related ATP-depende	98.58
PRK09183		259	transposase/IS protein; Provisional	98.58
PRK06921		266	hypothetical protein; Provisional	98.58
PF00493		331	MCM: MCM2/3/5 family This family extends the MCM d	98.55
PLN03210		1153	Resistant to P. syringae 6; Provisional	98.55
COG3284		606	AcoR Transcriptional activator of acetoin/glycerol	98.48
PF00931		287	NB-ARC: NB-ARC domain; InterPro: IPR002182 This is	98.46
KOG0482		721	consensus DNA replication licensing factor, MCM7 c	98.45
PF05729		166	NACHT: NACHT domain	98.45
PF09336		62	Vps4_C: Vps4 C terminal oligomerisation domain; In	98.44
PF12775		272	AAA_7: P-loop containing dynein motor region D3; P	98.41
cd01120		165	RecA-like_NTPases RecA-like NTPases. This family i	98.39
COG5271		4600	MDN1 AAA ATPase containing von Willebrand factor t	98.37
PF12774		231	AAA_6: Hydrolytic ATP binding site of dynein motor	98.31
COG3267		269	ExeA Type II secretory pathway, component ExeA (pr	98.29
KOG1051		898	consensus Chaperone HSP104 and related ATP-depende	98.28
TIGR02237		209	recomb_radB DNA repair and recombination protein R	98.25
KOG2170		344	consensus ATPase of the AAA+ superfamily [General	98.24
PF14516		331	AAA_35: AAA-like domain	98.22
PF03969		362	AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654	98.21
KOG4509		247	consensus Uncharacterized conserved protein [Funct	98.16
KOG0477		854	consensus DNA replication licensing factor, MCM2 c	98.13
PF00910		107	RNA_helicase: RNA helicase; InterPro: IPR000605 He	98.12
COG1618		179	Predicted nucleotide kinase [Nucleotide transport	98.11
PHA00729		226	NTP-binding motif containing protein	98.09
TIGR01618		220	phage_P_loop phage nucleotide-binding protein. Thi	98.07
KOG2228		408	consensus Origin recognition complex, subunit 4 [R	98.05
PRK06581		263	DNA polymerase III subunit delta'; Validated	98.03
PRK00771		437	signal recognition particle protein Srp54; Provisi	97.99
cd01124		187	KaiC KaiC is a circadian clock protein primarily f	97.98
KOG0481		729	consensus DNA replication licensing factor, MCM5 c	97.96
PHA02624		647	large T antigen; Provisional	97.94
COG1485		367	Predicted ATPase [General function prediction only	97.91
PRK15455		644	PrkA family serine protein kinase; Provisional	97.91
PF05707		193	Zot: Zonular occludens toxin (Zot); InterPro: IPR0	97.9
PRK08118		167	topology modulation protein; Reviewed	97.89
PRK09361		225	radB DNA repair and recombination protein RadB; Pr	97.89
PF13207		121	AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6	97.87
TIGR02688		449	conserved hypothetical protein TIGR02688. Members	97.86
PRK12723		388	flagellar biosynthesis regulator FlhF; Provisional	97.85
TIGR02012		321	tigrfam_recA protein RecA. This model describes or	97.84
PRK11823		446	DNA repair protein RadA; Provisional	97.84
PF13191		185	AAA_16: AAA ATPase domain; PDB: 2V1U_A.	97.84
PRK04296		190	thymidine kinase; Provisional	97.82
PRK04841		903	transcriptional regulator MalT; Provisional	97.82
cd01121		372	Sms Sms (bacterial radA) DNA repair protein. This	97.8
PF13604		196	AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL	97.77
PRK07261		171	topology modulation protein; Provisional	97.76
KOG2543		438	consensus Origin recognition complex, subunit 5 [R	97.76
cd00983		325	recA RecA is a bacterial enzyme which has roles in	97.74
) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309		127	Torsin: Torsin; InterPro: IPR010448 This family co	97.72
PTZ00202		550	tuzin; Provisional	97.72
COG1373		398	Predicted ATPase (AAA+ superfamily) [General funct	97.72
PRK08533		230	flagellar accessory protein FlaH; Reviewed	97.7
PRK14722		374	flhF flagellar biosynthesis regulator FlhF; Provis	97.7
PRK00131		175	aroK shikimate kinase; Reviewed	97.69
PRK13949		169	shikimate kinase; Provisional	97.67
PF03266		168	NTPase_1: NTPase; InterPro: IPR004948 This entry r	97.65
PF10443		431	RNA12: RNA12 protein; InterPro: IPR018850 Mitochon	97.64
KOG0479		818	consensus DNA replication licensing factor, MCM3 c	97.64
PF13671		143	AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1	97.63
PRK10867		433	signal recognition particle protein; Provisional	97.61
cd01129		264	PulE-GspE PulE/GspE The type II secretory pathway	97.6
cd01131		198	PilT Pilus retraction ATPase PilT. PilT is a nucle	97.59
KOG2709		560	consensus Uncharacterized conserved protein [Funct	97.59
PRK06067		234	flagellar accessory protein FlaH; Validated	97.57
cd00046		144	DEXDc DEAD-like helicases superfamily. A diverse f	97.57
PRK14974		336	cell division protein FtsY; Provisional	97.56
COG5271		4600	MDN1 AAA ATPase containing von Willebrand factor t	97.56
PF07693		325	KAP_NTPase: KAP family P-loop domain; InterPro: IP	97.55
PHA02774		613	E1; Provisional	97.54
cd01394		218	radB RadB. The archaeal protein radB shares simila	97.54
cd01123		235	Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r	97.54
PRK13695		174	putative NTPase; Provisional	97.54
PRK05800		170	cobU adenosylcobinamide kinase/adenosylcobinamide-	97.53
COG3854		308	SpoIIIAA ncharacterized protein conserved in bacte	97.52
TIGR03877		237	thermo_KaiC_1 KaiC domain protein, Ph0284 family.	97.51
PRK10536		262	hypothetical protein; Provisional	97.51
PRK13947		171	shikimate kinase; Provisional	97.5
PRK11889		436	flhF flagellar biosynthesis regulator FlhF; Provis	97.49
PRK03839		180	putative kinase; Provisional	97.46
PRK00625		173	shikimate kinase; Provisional	97.46
PRK09376		416	rho transcription termination factor Rho; Provisio	97.45
CHL00195		489	ycf46 Ycf46; Provisional	97.45
cd01393		226	recA_like RecA is a bacterial enzyme which has rol	97.44
PRK06762		166	hypothetical protein; Provisional	97.44
PRK09354		349	recA recombinase A; Provisional	97.43
cd00464		154	SK Shikimate kinase (SK) is the fifth enzyme in th	97.42
PRK05973		237	replicative DNA helicase; Provisional	97.42
COG4650		531	RtcR Sigma54-dependent transcription regulator con	97.41
COG0563		178	Adk Adenylate kinase and related kinases [Nucleoti	97.41
KOG3347		176	consensus Predicted nucleotide kinase/nuclear prot	97.4
PF06745		226	KaiC: KaiC; InterPro: IPR014774 This entry represe	97.4
TIGR01425		429	SRP54_euk signal recognition particle protein SRP5	97.38
PRK14532		188	adenylate kinase; Provisional	97.37
TIGR01420		343	pilT_fam pilus retraction protein PilT. This model	97.36
cd01128		249	rho_factor Transcription termination factor rho is	97.35
TIGR01359		183	UMP_CMP_kin_fam UMP-CMP kinase family. This subfam	97.35
cd00544		169	CobU Adenosylcobinamide kinase / adenosylcobinamid	97.34
PRK13900		332	type IV secretion system ATPase VirB11; Provisiona	97.34
PF00437		270	T2SE: Type II/IV secretion system protein; InterPr	97.33
TIGR00064		272	ftsY signal recognition particle-docking protein F	97.32
PRK04040		188	adenylate kinase; Provisional	97.32
TIGR00416		454	sms DNA repair protein RadA. The gene protuct code	97.32
TIGR03499		282	FlhF flagellar biosynthetic protein FlhF.	97.31
cd02021		150	GntK Gluconate kinase (GntK) catalyzes the phospho	97.31
cd03283		199	ABC_MutS-like MutS-like homolog in eukaryotes. The	97.3
cd01122		271	GP4d_helicase GP4d_helicase is a homohexameric 5'-	97.3
TIGR00959		428	ffh signal recognition particle protein. This mode	97.3
COG4088		261	Predicted nucleotide kinase [Nucleotide transport	97.29
PRK12724		432	flagellar biosynthesis regulator FlhF; Provisional	97.29
cd00227		175	CPT Chloramphenicol (Cm) phosphotransferase (CPT).	97.29
PF10236		309	DAP3: Mitochondrial ribosomal death-associated pro	97.29
PRK12726		407	flagellar biosynthesis regulator FlhF; Provisional	97.29
KOG2383		467	consensus Predicted ATPase [General function predi	97.28
PRK06217		183	hypothetical protein; Validated	97.27
TIGR02782		299	TrbB_P P-type conjugative transfer ATPase TrbB. Th	97.26
PRK13948		182	shikimate kinase; Provisional	97.26
COG0703		172	AroK Shikimate kinase [Amino acid transport and me	97.25
PF12780		268	AAA_8: P-loop containing dynein motor region D4; I	97.25
PRK05703		424	flhF flagellar biosynthesis regulator FlhF; Valida	97.24
PRK14531		183	adenylate kinase; Provisional	97.24
TIGR02525		372	plasmid_TraJ plasmid transfer ATPase TraJ. Members	97.24
cd01428		194	ADK Adenylate kinase (ADK) catalyzes the reversibl	97.23
COG5245		3164	DYN1 Dynein, heavy chain [Cytoskeleton]	97.23
cd02020		147	CMPK Cytidine monophosphate kinase (CMPK) catalyze	97.22
TIGR01313		163	therm_gnt_kin carbohydrate kinase, thermoresistant	97.22
PRK04132		846	replication factor C small subunit; Provisional	97.21
PRK14530		215	adenylate kinase; Provisional	97.21
COG1102		179	Cmk Cytidylate kinase [Nucleotide transport and me	97.2
cd01125		239	repA Hexameric Replicative Helicase RepA. RepA is	97.2
PRK13764		602	ATPase; Provisional	97.2
cd03281		213	ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS	97.2
PF13479		213	AAA_24: AAA domain	97.2
cd00984		242	DnaB_C DnaB helicase C terminal domain. The hexame	97.19
cd01130		186	VirB11-like_ATPase Type IV secretory pathway compo	97.19
cd02027		149	APSK Adenosine 5'-phosphosulfate kinase (APSK) cat	97.18
PRK08233		182	hypothetical protein; Provisional	97.18
PF04665		241	Pox_A32: Poxvirus A32 protein; InterPro: IPR006758	97.18
PRK04328		249	hypothetical protein; Provisional	97.18
PRK10416		318	signal recognition particle-docking protein FtsY;	97.18
TIGR02858		270	spore_III_AA stage III sporulation protein AA. Mem	97.17
PRK06547		172	hypothetical protein; Provisional	97.16
PF08433		270	KTI12: Chromatin associated protein KTI12 ; InterP	97.14
TIGR03574		249	selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem	97.14
PRK13946		184	shikimate kinase; Provisional	97.14
TIGR03878		259	thermo_KaiC_2 KaiC domain protein, AF_0795 family.	97.13
PRK13833		323	conjugal transfer protein TrbB; Provisional	97.13
PRK03731		171	aroL shikimate kinase II; Reviewed	97.13
PTZ00088		229	adenylate kinase 1; Provisional	97.13
PF13245		76	AAA_19: Part of AAA domain	97.12
COG2909		894	MalT ATP-dependent transcriptional regulator [Tran	97.11
cd03216		163	ABC_Carb_Monos_I This family represents the domain	97.11
COG4619		223	ABC-type uncharacterized transport system, ATPase	97.1
PF00448		196	SRP54: SRP54-type protein, GTPase domain; InterPro	97.1
PF05272		198	VirE: Virulence-associated protein E; InterPro: IP	97.1
TIGR00767		415	rho transcription termination factor Rho. Members	97.09
TIGR02533		486	type_II_gspE general secretory pathway protein E.	97.09
TIGR01448		720	recD_rel helicase, putative, RecD/TraA family. Thi	97.09
PRK05057		172	aroK shikimate kinase I; Reviewed	97.09
TIGR03880		224	KaiC_arch_3 KaiC domain protein, AF_0351 family. T	97.08
smart00487		201	DEXDc DEAD-like helicases superfamily.	97.08
PF08298		358	AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 Thi	97.08
PRK13851		344	type IV secretion system protein VirB11; Provision	97.08
PLN02200		234	adenylate kinase family protein	97.08
PRK14528		186	adenylate kinase; Provisional	97.05
PF09848		352	DUF2075: Uncharacterized conserved protein (DUF207	97.04
PRK04301		317	radA DNA repair and recombination protein RadA; Va	97.03
PLN03187		344	meiotic recombination protein DMC1 homolog; Provis	97.03
COG2804		500	PulE Type II secretory pathway, ATPase PulE/Tfp pi	97.02
TIGR01360		188	aden_kin_iso1 adenylate kinase, isozyme 1 subfamil	97.01
PRK02496		184	adk adenylate kinase; Provisional	97.01
cd03222		177	ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi	97.0
PRK13894		319	conjugal transfer ATPase TrbB; Provisional	97.0
PRK08154		309	anaerobic benzoate catabolism transcriptional regu	96.99
TIGR01351		210	adk adenylate kinases. Adenylate kinase (EC 2.7.4.	96.99
TIGR02236		310	recomb_radA DNA repair and recombination protein R	96.98
COG1936		180	Predicted nucleotide kinase (related to CMP and AM	96.98
PRK09519		790	recA DNA recombination protein RecA; Reviewed	96.98
TIGR02788		308	VirB11 P-type DNA transfer ATPase VirB11. The VirB	96.98
PRK10436		462	hypothetical protein; Provisional	96.98
PF13481		193	AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C.	96.97
cd03221		144	ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is	96.97
cd03115		173	SRP The signal recognition particle (SRP) mediates	96.96
TIGR02238		313	recomb_DMC1 meiotic recombinase Dmc1. This model d	96.95
PRK00279		215	adk adenylate kinase; Reviewed	96.95
cd03243		202	ABC_MutS_homologs The MutS protein initiates DNA m	96.94
TIGR02538		564	type_IV_pilB type IV-A pilus assembly ATPase PilB.	96.92
COG1066		456	Sms Predicted ATP-dependent serine protease [Postt	96.92
PF13238		129	AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB	96.91
cd00267		157	ABC_ATPase ABC (ATP-binding cassette) transporter	96.9
cd02019		69	NK Nucleoside/nucleotide kinase (NK) is a protein	96.89
PRK14527		191	adenylate kinase; Provisional	96.89
cd00561		159	CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B	96.88
PRK06696		223	uridine kinase; Validated	96.88
PRK00889		175	adenylylsulfate kinase; Provisional	96.87
TIGR02768		744	TraA_Ti Ti-type conjugative transfer relaxase TraA	96.86
TIGR03881		229	KaiC_arch_4 KaiC domain protein, PAE1156 family. M	96.86
smart00534		185	MUTSac ATPase domain of DNA mismatch repair MUTS f	96.86
PF06414		199	Zeta_toxin: Zeta toxin; InterPro: IPR010488 This e	96.85
cd03280		200	ABC_MutS2 MutS2 homologs in bacteria and eukaryote	96.85
PF13086		236	AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV	96.85
PRK08485		206	DNA polymerase III subunit delta'; Validated	96.83
TIGR02655		484	circ_KaiC circadian clock protein KaiC. Members of	96.82
PF01583		156	APS_kinase: Adenylylsulphate kinase; InterPro: IPR	96.82
PLN02674		244	adenylate kinase	96.81
PF13521		163	AAA_28: AAA domain; PDB: 1LW7_A.	96.79
PRK01184		184	hypothetical protein; Provisional	96.78
PTZ00035		337	Rad51 protein; Provisional	96.78
PRK14700		300	recombination factor protein RarA; Provisional	96.78
TIGR00150		133	HI0065_YjeE ATPase, YjeE family. Members of this f	96.77
PF00406		151	ADK: Adenylate kinase; InterPro: IPR000850 Adenyla	96.76
PF05970		364	PIF1: PIF1-like helicase; InterPro: IPR010285 This	96.76
COG1126		240	GlnQ ABC-type polar amino acid transport system, A	96.75
TIGR02239		316	recomb_RAD51 DNA repair protein RAD51. This eukary	96.75
COG1855		604	ATPase (PilT family) [General function prediction	96.75
PF08303		168	tRNA_lig_kinase: tRNA ligase kinase domain; InterP	96.74
PRK04182		180	cytidylate kinase; Provisional	96.73
PRK14730		195	coaE dephospho-CoA kinase; Provisional	96.73
PF10662		143	PduV-EutP: Ethanolamine utilisation - propanediol	96.72
PRK14526		211	adenylate kinase; Provisional	96.71
PHA02530		300	pseT polynucleotide kinase; Provisional	96.7
PRK13889		988	conjugal transfer relaxase TraA; Provisional	96.7
TIGR02173		171	cyt_kin_arch cytidylate kinase, putative. Proteins	96.7
COG4178		604	ABC-type uncharacterized transport system, permeas	96.67
PLN03186		342	DNA repair protein RAD51 homolog; Provisional	96.67
cd03238		176	ABC_UvrA The excision repair protein UvrA; Nucleot	96.66
TIGR01526		325	nadR_NMN_Atrans nicotinamide-nucleotide adenylyltr	96.66
PRK10263		1355	DNA translocase FtsK; Provisional	96.64
PRK10875		615	recD exonuclease V subunit alpha; Provisional	96.63
PRK06731		270	flhF flagellar biosynthesis regulator FlhF; Valida	96.62
COG2805		353	PilT Tfp pilus assembly protein, pilus retraction	96.62
PF01745		233	IPT: Isopentenyl transferase; InterPro: IPR002648	96.61
COG4608		268	AppF ABC-type oligopeptide transport system, ATPas	96.6
COG0541		451	Ffh Signal recognition particle GTPase [Intracellu	96.58
TIGR02524		358	dot_icm_DotB Dot/Icm secretion system ATPase DotB.	96.58
PRK05541		176	adenylylsulfate kinase; Provisional	96.58
PRK12608		380	transcription termination factor Rho; Provisional	96.57
PRK12339		197	2-phosphoglycerate kinase; Provisional	96.57
TIGR00152		188	dephospho-CoA kinase. This model produces scores i	96.57
PRK10078		186	ribose 1,5-bisphosphokinase; Provisional	96.56

>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

Probab=100.00  E-value=3.8e-75  Score=545.84  Aligned_cols=398  Identities=40%  Similarity=0.647  Sum_probs=346.5

Q ss_pred             HHHHHHHHHHHHHHHhhhCCCHHHHHHHHHHHHHHHHHHcCCC-CCCCcchhhHHHHHHHHHHHHHHHHHHHHHHHHHhh
Q 011393           52 GYFELAKEEIAKAVRAEEWGLVDDAIIHYKNAQRILTEASSTP-VPSYISTSEHEKVKSYRQKISKWQSQVSDRLQALNR  130 (487)
Q Consensus        52 ~~~~~A~~~i~~Av~~d~~g~~~~Al~~Y~~~i~~l~~~~~~~-~~~~~~~~~~~k~~~y~~rae~~k~~v~~rl~~L~~  130 (487)
                      .++++|++++++|+..|++++|++|+.+|++|++||+.+++|| .+++.++.++.|+.+|++|||+++..       |.+
T Consensus         5 ~~l~kaI~lv~kA~~eD~a~nY~eA~~lY~~aleYF~~~lKYE~~~~kaKd~IraK~~EYLdRAEkLK~y-------L~~   77 (439)
T KOG0739|consen    5 SFLQKAIDLVKKAIDEDNAKNYEEALRLYQNALEYFLHALKYEANNKKAKDSIRAKFTEYLDRAEKLKAY-------LKE   77 (439)
T ss_pred             hHHHHHHHHHHHHhhhcchhchHHHHHHHHHHHHHHHHHHHhhhcChhHHHHHHHHHHHHHHHHHHHHHH-------HHh
Confidence            4789999999999999999999999999999999999999999 66679999999999999999999988       443


Q ss_pred             hhCCCCCCCCCCccccccccccccccccCCCCCCCCCCCCCccccccccccCCCchhhhccCCCChHHHHHhhhccccCC
Q 011393          131 RAGGTSTSKSTSPHAQTAAVSSTSNFRKNISPNSPRSSRNNPVVRNQTEKTGSSKPLAEAGNGYDSKLVEMINTAIVDRS  210 (487)
Q Consensus       131 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~  210 (487)
                      ...+... ...+      +.+.              ...++         .+.+..-...+....++|...++..|+.+.
T Consensus        78 ~~~~~~k-~~~~------a~a~--------------~~~~k---------~~ds~~eg~d~~pe~kKLr~~L~sAIv~EK  127 (439)
T KOG0739|consen   78 KEKGAGK-KGDE------AVAT--------------VPKGK---------KKDSDGEGEDDEPEKKKLRSALNSAIVREK  127 (439)
T ss_pred             hccCCCC-CCcc------ccCC--------------CCCCC---------CCCccccccCCChhHHHHHHHhhhhhhccC
Confidence            2211110 0000      0000              00000         000000011122345789999999999999


Q ss_pred             CCCCcccccChHHHHHHHHHHhhccccChhhhhccCCCCceeEEeCCCCCcHHHHHHHHHHHcCCeEEEEecCccchhcc
Q 011393          211 PSVKWEDVAGLEKAKQALMEMVILPAKRRDLFTGLRRPARGLLLFGPPGNGKTMLAKAVASESQATFFNVSASSLTSKWV  290 (487)
Q Consensus       211 ~~~~~~di~G~~~~k~~L~~~v~~~~~~~~~~~~~~~~~~~iLL~GppGtGKT~la~aiA~~~~~~~~~v~~~~l~~~~~  290 (487)
                      |++.|+||+|++.+|++|++.|++|..+|++|++.+.|+++|||||||||||++||+|+|.+.+.+||.|+.++++++|+
T Consensus       128 PNVkWsDVAGLE~AKeALKEAVILPIKFPqlFtGkR~PwrgiLLyGPPGTGKSYLAKAVATEAnSTFFSvSSSDLvSKWm  207 (439)
T KOG0739|consen  128 PNVKWSDVAGLEGAKEALKEAVILPIKFPQLFTGKRKPWRGILLYGPPGTGKSYLAKAVATEANSTFFSVSSSDLVSKWM  207 (439)
T ss_pred             CCCchhhhccchhHHHHHHhheeecccchhhhcCCCCcceeEEEeCCCCCcHHHHHHHHHhhcCCceEEeehHHHHHHHh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             chhHHHHHHHHHHHHhcCCcEEEechhhhhhccCCCCcchHHHHHHHHHHHHhcCCCCCCCCcEEEEEecCCCCCCCHHH
Q 011393          291 GEGEKLVRTLFMVAISRQPCVIFIDEIDSIMSTRMANENDASRRLKSEFLIQFDGVTSNPNDLVIVMGATNKPQELDDAV  370 (487)
Q Consensus       291 g~~~~~i~~~f~~a~~~~p~Il~IDEiD~l~~~~~~~~~~~~~~~~~~ll~~l~~~~~~~~~~vivI~ttn~~~~ld~al  370 (487)
                      |++++.++.+|+.|+.+.|+||||||||+|++.|++++.++.+|+..+||.+|.|+..+ .+.|+|+++||.||.||.++
T Consensus       208 GESEkLVknLFemARe~kPSIIFiDEiDslcg~r~enEseasRRIKTEfLVQMqGVG~d-~~gvLVLgATNiPw~LDsAI  286 (439)
T KOG0739|consen  208 GESEKLVKNLFEMARENKPSIIFIDEIDSLCGSRSENESEASRRIKTEFLVQMQGVGND-NDGVLVLGATNIPWVLDSAI  286 (439)
T ss_pred             ccHHHHHHHHHHHHHhcCCcEEEeehhhhhccCCCCCchHHHHHHHHHHHHhhhccccC-CCceEEEecCCCchhHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999854 56799999999999999999


Q ss_pred             HcccccEEEccCCCHHHHHHHHHHHhccCCCCCChhhHHHHHHHcCCCCHHHHHHHHHHHHHHhHHhhccch--------
Q 011393          371 LRRLVKRIYVPLPDENVRRLLLKHKLKGQAFSLPGGDLERLVRETEGYSGSDLQALCEEAAMMPIRELGTNI--------  442 (487)
Q Consensus       371 ~~Rf~~~i~i~~Pd~~~r~~il~~~l~~~~~~l~~~~l~~La~~t~G~s~~dL~~lv~~A~~~a~~~~~~~~--------  442 (487)
                      +|||.++|++|+|+...|..+|+.++...+..+++.++..|+++|+||||+||.-+|++|.|.++|+.+...        
T Consensus       287 RRRFekRIYIPLPe~~AR~~MF~lhlG~tp~~LT~~d~~eL~~kTeGySGsDisivVrDalmePvRkvqsAthFk~v~~~  366 (439)
T KOG0739|consen  287 RRRFEKRIYIPLPEAHARARMFKLHLGDTPHVLTEQDFKELARKTEGYSGSDISIVVRDALMEPVRKVQSATHFKKVSGP  366 (439)
T ss_pred             HHHhhcceeccCCcHHHhhhhheeccCCCccccchhhHHHHHhhcCCCCcCceEEEehhhhhhhHHHhhhhhhhhccCCC
Confidence            999999999999999999999999999999999999999999999999999999999999999999875311        


Q ss_pred             ------h-------------------cccc--ccCCCCcHHHHHHHHHhhCCCCCHHHHHHHHHHHHHhCCC
Q 011393          443 ------L-------------------TVKA--NQLRPLRYEDFQKAMAVIRPSLNKSKWEELEQWNREFGSN  487 (487)
Q Consensus       443 ------~-------------------~~~~--~~~~~l~~~df~~al~~~~ps~s~~~i~~~~~w~~~~g~~  487 (487)
                            .                   ....  .-.+++|+.||..++...+|+++.+++...++|++.||+|
T Consensus       367 s~~~~~~~lltpcspgd~ga~em~w~dv~~dkl~eP~vt~~D~~k~l~~tkPTvn~~Dl~k~~~Ft~dFGqE  438 (439)
T KOG0739|consen  367 SNPSEVDDLLTPCSPGDPGAIEMSWMDVPADKLLEPPVTMRDFLKSLSRTKPTVNEDDLLKHEKFTEDFGQE  438 (439)
T ss_pred             CChhhhccccCCCCCCCcchhhhhhccCCHhhccCCCccHHHHHHHHhhcCCCCCHHHHHHHHHHHHhhccC
Confidence                  0                   0001  1136799999999999999999999999999999999986

>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0740 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily	Back alignment and domain information

>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only]	Back alignment and domain information

>KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>CHL00195 ycf46 Ycf46; Provisional	Back alignment and domain information

>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional	Back alignment and domain information

>KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0726 consensus 26S proteasome regulatory complex, ATPase RPT2 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK03992 proteasome-activating nucleotidase; Provisional	Back alignment and domain information

>KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional	Back alignment and domain information

>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH	Back alignment and domain information

>TIGR01242 26Sp45 26S proteasome subunit P45 family	Back alignment and domain information

>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR03689 pup_AAA proteasome ATPase	Back alignment and domain information

>KOG0732 consensus AAA+-type ATPase containing the bromodomain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>CHL00176 ftsH cell division protein; Validated	Back alignment and domain information

>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily	Back alignment and domain information

>KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK10733 hflB ATP-dependent metalloprotease; Reviewed	Back alignment and domain information

>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>CHL00206 ycf2 Ycf2; Provisional	Back alignment and domain information

>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional	Back alignment and domain information

>CHL00181 cbbX CbbX; Provisional	Back alignment and domain information

>TIGR02881 spore_V_K stage V sporulation protein K	Back alignment and domain information

>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX	Back alignment and domain information

>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair	Back alignment and domain information

>PRK14956 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed	Back alignment and domain information

>PRK07003 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK12323 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport	Back alignment and domain information

>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK14962 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14960 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA	Back alignment and domain information

>PRK14949 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair]	Back alignment and domain information

>PRK14958 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit	Back alignment and domain information

>TIGR02902 spore_lonB ATP-dependent protease LonB	Back alignment and domain information

>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK07994 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14961 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14964 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK06645 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PLN03025 replication factor C subunit; Provisional	Back alignment and domain information

>PRK08691 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14951 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK04195 replication factor C large subunit; Provisional	Back alignment and domain information

>KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK14963 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14957 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK13342 recombination factor protein RarA; Reviewed	Back alignment and domain information

>PRK07764 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14959 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK05896 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK07133 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14969 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14952 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR00763 lon ATP-dependent protease La	Back alignment and domain information

>PRK12402 replication factor C small subunit 2; Reviewed	Back alignment and domain information

>PRK05563 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK08451 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14965 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau	Back alignment and domain information

>PRK14953 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK06305 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK06647 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family	Back alignment and domain information

>PHA02544 44 clamp loader, small subunit; Provisional	Back alignment and domain information

>PRK09111 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14970 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK00149 dnaA chromosomal replication initiation protein; Reviewed	Back alignment and domain information

>TIGR00362 DnaA chromosomal replication initiator protein DnaA	Back alignment and domain information

>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK00440 rfc replication factor C small subunit; Reviewed	Back alignment and domain information

>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed	Back alignment and domain information

>PRK14955 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair]	Back alignment and domain information

>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional	Back alignment and domain information

>PRK14954 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14948 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK10865 protein disaggregation chaperone; Provisional	Back alignment and domain information

>PRK12422 chromosomal replication initiation protein; Provisional	Back alignment and domain information

>CHL00095 clpC Clp protease ATP binding subunit	Back alignment and domain information

>PRK14950 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK07940 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK06893 DNA replication initiation factor; Validated	Back alignment and domain information

>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB	Back alignment and domain information

>PRK14088 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PRK14971 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14086 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional	Back alignment and domain information

>PRK08084 DNA replication initiation factor; Provisional	Back alignment and domain information

>PRK08903 DnaA regulatory inactivator Hda; Validated	Back alignment and domain information

>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit	Back alignment and domain information

>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda	Back alignment and domain information

>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function	Back alignment and domain information

>TIGR02928 orc1/cdc6 family replication initiation protein	Back alignment and domain information

>TIGR02903 spore_lon_C ATP-dependent protease, Lon family	Back alignment and domain information

>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional	Back alignment and domain information

>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication	Back alignment and domain information

>PRK00411 cdc6 cell division control protein 6; Reviewed	Back alignment and domain information

>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair]	Back alignment and domain information

>PRK08727 hypothetical protein; Validated	Back alignment and domain information

>PRK10787 DNA-binding ATP-dependent protease La; Provisional	Back alignment and domain information

>PTZ00112 origin recognition complex 1 protein; Provisional	Back alignment and domain information

>PRK14087 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PRK05642 DNA replication initiation factor; Validated	Back alignment and domain information

>PRK06620 hypothetical protein; Validated	Back alignment and domain information

>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX)	Back alignment and domain information

>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional	Back alignment and domain information

>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair]	Back alignment and domain information

>cd02679 MIT_spastin MIT: domain contained within Microtubule Interacting and Trafficking molecules	Back alignment and domain information

>PRK13407 bchI magnesium chelatase subunit I; Provisional	Back alignment and domain information

>PRK07471 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK09087 hypothetical protein; Validated	Back alignment and domain information

>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA	Back alignment and domain information

>PRK09112 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK05564 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN	Back alignment and domain information

>KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair]	Back alignment and domain information

>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only]	Back alignment and domain information

>CHL00081 chlI Mg-protoporyphyrin IX chelatase	Back alignment and domain information

>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription]	Back alignment and domain information

>KOG2035 consensus Replication factor C, subunit RFC3 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair]	Back alignment and domain information

>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB	Back alignment and domain information

>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family	Back alignment and domain information

>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold	Back alignment and domain information

>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I	Back alignment and domain information

>PRK07399 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK04132 replication factor C small subunit; Provisional	Back alignment and domain information

>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>CHL00095 clpC Clp protease ATP binding subunit	Back alignment and domain information

>cd02677 MIT_SNX15 MIT: domain contained within Microtubule Interacting and Trafficking molecules	Back alignment and domain information

>cd02683 MIT_1 MIT: domain contained within Microtubule Interacting and Trafficking molecules	Back alignment and domain information

>TIGR00678 holB DNA polymerase III, delta' subunit	Back alignment and domain information

>TIGR01650 PD_CobS cobaltochelatase, CobS subunit	Back alignment and domain information

>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK10865 protein disaggregation chaperone; Provisional	Back alignment and domain information

>cd02684 MIT_2 MIT: domain contained within Microtubule Interacting and Trafficking molecules	Back alignment and domain information

>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF	Back alignment and domain information

>smart00745 MIT Microtubule Interacting and Trafficking molecule domain	Back alignment and domain information

>KOG0990 consensus Replication factor C, subunit RFC5 [Replication, recombination and repair]	Back alignment and domain information

>TIGR02442 Cob-chelat-sub cobaltochelatase subunit	Back alignment and domain information

>PRK08058 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional	Back alignment and domain information

>cd02681 MIT_calpain7_1 MIT: domain contained within Microtubule Interacting and Trafficking molecules	Back alignment and domain information

>TIGR01817 nifA Nif-specific regulatory protein	Back alignment and domain information

>PRK05707 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily	Back alignment and domain information

>PF04212 MIT: MIT (microtubule interacting and transport) domain; InterPro: IPR007330 The MIT domain is found in vacuolar sorting proteins, spastin (probable ATPase involved in the assembly or function of nuclear protein complexes), and a sorting nexin, which may play a role in intracellular trafficking	Back alignment and domain information

>COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms]	Back alignment and domain information

>PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins	Back alignment and domain information

>TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR	Back alignment and domain information

>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms]	Back alignment and domain information

>PRK15424 propionate catabolism operon regulatory protein PrpR; Provisional	Back alignment and domain information

>PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional	Back alignment and domain information

>PRK13531 regulatory ATPase RavA; Provisional	Back alignment and domain information

>TIGR00602 rad24 checkpoint protein rad24	Back alignment and domain information

>PRK11388 DNA-binding transcriptional regulator DhaR; Provisional	Back alignment and domain information

>PHA02244 ATPase-like protein	Back alignment and domain information

>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional	Back alignment and domain information

>COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms]	Back alignment and domain information

>cd02678 MIT_VPS4 MIT: domain contained within Microtubule Interacting and Trafficking molecules	Back alignment and domain information

>cd02682 MIT_AAA_Arch MIT: domain contained within Microtubule Interacting and Trafficking molecules	Back alignment and domain information

>PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional	Back alignment and domain information

>COG0714 MoxR-like ATPases [General function prediction only]	Back alignment and domain information

>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional	Back alignment and domain information

>PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX	Back alignment and domain information

>TIGR00764 lon_rel lon-related putative ATP-dependent protease	Back alignment and domain information

>PRK06871 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>COG1220 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK07993 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids []	Back alignment and domain information

>TIGR00368 Mg chelatase-related protein	Back alignment and domain information

>smart00350 MCM minichromosome maintenance proteins	Back alignment and domain information

>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins	Back alignment and domain information

>KOG0745 consensus Putative ATP-dependent Clp-type protease (AAA+ ATPase superfamily) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A	Back alignment and domain information

>cd02656 MIT MIT: domain contained within Microtubule Interacting and Trafficking molecules	Back alignment and domain information

>smart00382 AAA ATPases associated with a variety of cellular activities	Back alignment and domain information

>PRK08769 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>COG3604 FhlA Transcriptional regulator containing GAF, AAA-type ATPase, and DNA binding domains [Transcription / Signal transduction mechanisms]	Back alignment and domain information

>TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D	Back alignment and domain information

>smart00763 AAA_PrkA PrkA AAA domain	Back alignment and domain information

>TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator	Back alignment and domain information

>PRK06090 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>KOG1942 consensus DNA helicase, TBP-interacting protein [Replication, recombination and repair]	Back alignment and domain information

>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids []	Back alignment and domain information

>PRK06964 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>cd02680 MIT_calpain7_2 MIT: domain contained within Microtubule Interacting and Trafficking molecules	Back alignment and domain information

>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model	Back alignment and domain information

>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF03215 Rad17: Rad17 cell cycle checkpoint protein	Back alignment and domain information

>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor	Back alignment and domain information

>KOG1514 consensus Origin recognition complex, subunit 1, and related proteins [Replication, recombination and repair]	Back alignment and domain information

>PRK10923 glnG nitrogen regulation protein NR(I); Provisional	Back alignment and domain information

>PRK09862 putative ATP-dependent protease; Provisional	Back alignment and domain information

>PTZ00111 DNA replication licensing factor MCM4; Provisional	Back alignment and domain information

>PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional	Back alignment and domain information

>COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK08116 hypothetical protein; Validated	Back alignment and domain information

>PRK13765 ATP-dependent protease Lon; Provisional	Back alignment and domain information

>PRK12377 putative replication protein; Provisional	Back alignment and domain information

>KOG2680 consensus DNA helicase TIP49, TBP-interacting protein [Transcription]	Back alignment and domain information

>PRK15115 response regulator GlrR; Provisional	Back alignment and domain information

>PRK08699 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>TIGR01818 ntrC nitrogen regulation protein NR(I)	Back alignment and domain information

>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP	Back alignment and domain information

>COG1239 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolism]	Back alignment and domain information

>PRK07952 DNA replication protein DnaC; Validated	Back alignment and domain information

>KOG1970 consensus Checkpoint RAD17-RFC complex, RAD17/RAD24 component [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair]	Back alignment and domain information

>PRK05917 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>KOG2227 consensus Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase [Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H	Back alignment and domain information

>PRK08181 transposase; Validated	Back alignment and domain information

>PRK06835 DNA replication protein DnaC; Validated	Back alignment and domain information

>COG3283 TyrR Transcriptional regulator of aromatic amino acids metabolism [Transcription / Amino acid transport and metabolism]	Back alignment and domain information

>PRK13406 bchD magnesium chelatase subunit D; Provisional	Back alignment and domain information

>PRK10365 transcriptional regulatory protein ZraR; Provisional	Back alignment and domain information

>PRK07276 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>COG1241 MCM2 Predicted ATPase involved in replication control, Cdc46/Mcm family [DNA replication, recombination, and repair]	Back alignment and domain information

>PF13173 AAA_14: AAA domain	Back alignment and domain information

>PRK07132 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>KOG0480 consensus DNA replication licensing factor, MCM6 component [Replication, recombination and repair]	Back alignment and domain information

>KOG1968 consensus Replication factor C, subunit RFC1 (large subunit) [Replication, recombination and repair]	Back alignment and domain information

>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif	Back alignment and domain information

>PRK06526 transposase; Provisional	Back alignment and domain information

>PRK05818 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair]	Back alignment and domain information

>KOG0478 consensus DNA replication licensing factor, MCM4 component [Replication, recombination and repair]	Back alignment and domain information

>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B	Back alignment and domain information

>PRK08939 primosomal protein DnaI; Reviewed	Back alignment and domain information

>KOG1051 consensus Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK09183 transposase/IS protein; Provisional	Back alignment and domain information

>PRK06921 hypothetical protein; Provisional	Back alignment and domain information

>PF00493 MCM: MCM2/3/5 family This family extends the MCM domain of Prosite	Back alignment and domain information

>PLN03210 Resistant to P	Back alignment and domain information

>COG3284 AcoR Transcriptional activator of acetoin/glycerol metabolism [Secondary metabolites biosynthesis, transport, and catabolism / Transcription]	Back alignment and domain information

>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals []	Back alignment and domain information

>KOG0482 consensus DNA replication licensing factor, MCM7 component [Replication, recombination and repair]	Back alignment and domain information

>PF05729 NACHT: NACHT domain	Back alignment and domain information

>PF09336 Vps4_C: Vps4 C terminal oligomerisation domain; InterPro: IPR015415 This domain is found at the C-terminal of ATPase proteins involved in vacuolar sorting	Back alignment and domain information

>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A	Back alignment and domain information

>cd01120 RecA-like_NTPases RecA-like NTPases	Back alignment and domain information

>COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only]	Back alignment and domain information

>PF12774 AAA_6: Hydrolytic ATP binding site of dynein motor region D1; PDB: 3VKH_A 3VKG_A 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A	Back alignment and domain information

>COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion]	Back alignment and domain information

>KOG1051 consensus Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR02237 recomb_radB DNA repair and recombination protein RadB	Back alignment and domain information

>KOG2170 consensus ATPase of the AAA+ superfamily [General function prediction only]	Back alignment and domain information

>PF14516 AAA_35: AAA-like domain	Back alignment and domain information

>PF03969 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP	Back alignment and domain information

>KOG4509 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG0477 consensus DNA replication licensing factor, MCM2 component [Replication, recombination and repair]	Back alignment and domain information

>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5)	Back alignment and domain information

>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>PHA00729 NTP-binding motif containing protein	Back alignment and domain information

>TIGR01618 phage_P_loop phage nucleotide-binding protein	Back alignment and domain information

>KOG2228 consensus Origin recognition complex, subunit 4 [Replication, recombination and repair]	Back alignment and domain information

>PRK06581 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK00771 signal recognition particle protein Srp54; Provisional	Back alignment and domain information

>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs	Back alignment and domain information

>KOG0481 consensus DNA replication licensing factor, MCM5 component [Replication, recombination and repair]	Back alignment and domain information

>PHA02624 large T antigen; Provisional	Back alignment and domain information

>COG1485 Predicted ATPase [General function prediction only]	Back alignment and domain information

>PRK15455 PrkA family serine protein kinase; Provisional	Back alignment and domain information

>PF05707 Zot: Zonular occludens toxin (Zot); InterPro: IPR008900 This entry consists of bacterial and viral proteins which are very similar to the Zonular occludens toxin (Zot)	Back alignment and domain information

>PRK08118 topology modulation protein; Reviewed	Back alignment and domain information

>PRK09361 radB DNA repair and recombination protein RadB; Provisional	Back alignment and domain information

>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A	Back alignment and domain information

>TIGR02688 conserved hypothetical protein TIGR02688	Back alignment and domain information

>PRK12723 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>TIGR02012 tigrfam_recA protein RecA	Back alignment and domain information

>PRK11823 DNA repair protein RadA; Provisional	Back alignment and domain information

>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A	Back alignment and domain information

>PRK04296 thymidine kinase; Provisional	Back alignment and domain information

>PRK04841 transcriptional regulator MalT; Provisional	Back alignment and domain information

>cd01121 Sms Sms (bacterial radA) DNA repair protein	Back alignment and domain information

>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A	Back alignment and domain information

>PRK07261 topology modulation protein; Provisional	Back alignment and domain information

>KOG2543 consensus Origin recognition complex, subunit 5 [Replication, recombination and repair]	Back alignment and domain information

>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response	Back alignment and domain information

>PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins	Back alignment and domain information

>PTZ00202 tuzin; Provisional	Back alignment and domain information

>COG1373 Predicted ATPase (AAA+ superfamily) [General function prediction only]	Back alignment and domain information

>PRK08533 flagellar accessory protein FlaH; Reviewed	Back alignment and domain information

>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PRK00131 aroK shikimate kinase; Reviewed	Back alignment and domain information

>PRK13949 shikimate kinase; Provisional	Back alignment and domain information

>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency []	Back alignment and domain information

>PF10443 RNA12: RNA12 protein; InterPro: IPR018850 Mitochondrial escape protein 2 (also known as RNA12) plays a role in maintaining the mitochondrial genome and in controlling mtDNA escape [, ]	Back alignment and domain information

>KOG0479 consensus DNA replication licensing factor, MCM3 component [Replication, recombination and repair]	Back alignment and domain information

>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B	Back alignment and domain information

>PRK10867 signal recognition particle protein; Provisional	Back alignment and domain information

>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP)	Back alignment and domain information

>cd01131 PilT Pilus retraction ATPase PilT	Back alignment and domain information

>KOG2709 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PRK06067 flagellar accessory protein FlaH; Validated	Back alignment and domain information

>cd00046 DEXDc DEAD-like helicases superfamily	Back alignment and domain information

>PRK14974 cell division protein FtsY; Provisional	Back alignment and domain information

>COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only]	Back alignment and domain information

>PF07693 KAP_NTPase: KAP family P-loop domain; InterPro: IPR011646 The KAP (after Kidins220/ARMS and PifA) family of predicted NTPases are sporadically distributed across a wide phylogenetic range in bacteria and in animals	Back alignment and domain information

>PHA02774 E1; Provisional	Back alignment and domain information

>cd01394 radB RadB	Back alignment and domain information

>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B	Back alignment and domain information

>PRK13695 putative NTPase; Provisional	Back alignment and domain information

>PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated	Back alignment and domain information

>COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family	Back alignment and domain information

>PRK10536 hypothetical protein; Provisional	Back alignment and domain information

>PRK13947 shikimate kinase; Provisional	Back alignment and domain information

>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PRK03839 putative kinase; Provisional	Back alignment and domain information

>PRK00625 shikimate kinase; Provisional	Back alignment and domain information

>PRK09376 rho transcription termination factor Rho; Provisional	Back alignment and domain information

>CHL00195 ycf46 Ycf46; Provisional	Back alignment and domain information

>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response	Back alignment and domain information

>PRK06762 hypothetical protein; Provisional	Back alignment and domain information

>PRK09354 recA recombinase A; Provisional	Back alignment and domain information

>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants	Back alignment and domain information

>PRK05973 replicative DNA helicase; Provisional	Back alignment and domain information

>COG4650 RtcR Sigma54-dependent transcription regulator containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms]	Back alignment and domain information

>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism]	Back alignment and domain information

>KOG3347 consensus Predicted nucleotide kinase/nuclear protein involved oxidative stress response [Nucleotide transport and metabolism]	Back alignment and domain information

>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical	Back alignment and domain information

>TIGR01425 SRP54_euk signal recognition particle protein SRP54	Back alignment and domain information

>PRK14532 adenylate kinase; Provisional	Back alignment and domain information

>TIGR01420 pilT_fam pilus retraction protein PilT	Back alignment and domain information

>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase	Back alignment and domain information

>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family	Back alignment and domain information

>cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU)	Back alignment and domain information

>PRK13900 type IV secretion system ATPase VirB11; Provisional	Back alignment and domain information

>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ]	Back alignment and domain information

>TIGR00064 ftsY signal recognition particle-docking protein FtsY	Back alignment and domain information

>PRK04040 adenylate kinase; Provisional	Back alignment and domain information

>TIGR00416 sms DNA repair protein RadA	Back alignment and domain information

>TIGR03499 FlhF flagellar biosynthetic protein FlhF	Back alignment and domain information

>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate	Back alignment and domain information

>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes	Back alignment and domain information

>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases	Back alignment and domain information

>TIGR00959 ffh signal recognition particle protein	Back alignment and domain information

>COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>PRK12724 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT)	Back alignment and domain information

>PF10236 DAP3: Mitochondrial ribosomal death-associated protein 3; InterPro: IPR019368 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms	Back alignment and domain information

>PRK12726 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>KOG2383 consensus Predicted ATPase [General function prediction only]	Back alignment and domain information

>PRK06217 hypothetical protein; Validated	Back alignment and domain information

>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB	Back alignment and domain information

>PRK13948 shikimate kinase; Provisional	Back alignment and domain information

>COG0703 AroK Shikimate kinase [Amino acid transport and metabolism]	Back alignment and domain information

>PF12780 AAA_8: P-loop containing dynein motor region D4; InterPro: IPR024317 The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases	Back alignment and domain information

>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated	Back alignment and domain information

>PRK14531 adenylate kinase; Provisional	Back alignment and domain information

>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ	Back alignment and domain information

>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP)	Back alignment and domain information

>COG5245 DYN1 Dynein, heavy chain [Cytoskeleton]	Back alignment and domain information

>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor	Back alignment and domain information

>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family	Back alignment and domain information

>PRK04132 replication factor C small subunit; Provisional	Back alignment and domain information

>PRK14530 adenylate kinase; Provisional	Back alignment and domain information

>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>cd01125 repA Hexameric Replicative Helicase RepA	Back alignment and domain information

>PRK13764 ATPase; Provisional	Back alignment and domain information

>cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes	Back alignment and domain information

>PF13479 AAA_24: AAA domain	Back alignment and domain information

>cd00984 DnaB_C DnaB helicase C terminal domain	Back alignment and domain information

>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases	Back alignment and domain information

>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS)	Back alignment and domain information

>PRK08233 hypothetical protein; Provisional	Back alignment and domain information

>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein	Back alignment and domain information

>PRK04328 hypothetical protein; Provisional	Back alignment and domain information

>PRK10416 signal recognition particle-docking protein FtsY; Provisional	Back alignment and domain information

>TIGR02858 spore_III_AA stage III sporulation protein AA	Back alignment and domain information

>PRK06547 hypothetical protein; Provisional	Back alignment and domain information

>PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II []	Back alignment and domain information

>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal	Back alignment and domain information

>PRK13946 shikimate kinase; Provisional	Back alignment and domain information

>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family	Back alignment and domain information

>PRK13833 conjugal transfer protein TrbB; Provisional	Back alignment and domain information

>PRK03731 aroL shikimate kinase II; Reviewed	Back alignment and domain information

>PTZ00088 adenylate kinase 1; Provisional	Back alignment and domain information

>PF13245 AAA_19: Part of AAA domain	Back alignment and domain information

>COG2909 MalT ATP-dependent transcriptional regulator [Transcription]	Back alignment and domain information

>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos)	Back alignment and domain information

>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only]	Back alignment and domain information

>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ]	Back alignment and domain information

>PF05272 VirE: Virulence-associated protein E; InterPro: IPR007936 This family contains several bacterial virulence-associated protein E like proteins	Back alignment and domain information

>TIGR00767 rho transcription termination factor Rho	Back alignment and domain information

>TIGR02533 type_II_gspE general secretory pathway protein E	Back alignment and domain information

>TIGR01448 recD_rel helicase, putative, RecD/TraA family	Back alignment and domain information

>PRK05057 aroK shikimate kinase I; Reviewed	Back alignment and domain information

>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family	Back alignment and domain information

>smart00487 DEXDc DEAD-like helicases superfamily	Back alignment and domain information

>PF08298 AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 This is entry is found at the N terminus of PrkA proteins - bacterial and archaeal serine kinases approximately 630 residues in length	Back alignment and domain information

>PRK13851 type IV secretion system protein VirB11; Provisional	Back alignment and domain information

>PLN02200 adenylate kinase family protein	Back alignment and domain information

>PRK14528 adenylate kinase; Provisional	Back alignment and domain information

>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function	Back alignment and domain information

>PRK04301 radA DNA repair and recombination protein RadA; Validated	Back alignment and domain information

>PLN03187 meiotic recombination protein DMC1 homolog; Provisional	Back alignment and domain information

>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion]	Back alignment and domain information

>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily	Back alignment and domain information

>PRK02496 adk adenylate kinase; Provisional	Back alignment and domain information

>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids	Back alignment and domain information

>PRK13894 conjugal transfer ATPase TrbB; Provisional	Back alignment and domain information

>PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed	Back alignment and domain information

>TIGR01351 adk adenylate kinases	Back alignment and domain information

>TIGR02236 recomb_radA DNA repair and recombination protein RadA	Back alignment and domain information

>COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism]	Back alignment and domain information

>PRK09519 recA DNA recombination protein RecA; Reviewed	Back alignment and domain information

>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11	Back alignment and domain information

>PRK10436 hypothetical protein; Provisional	Back alignment and domain information

>PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C	Back alignment and domain information

>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth	Back alignment and domain information

>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes	Back alignment and domain information

>TIGR02238 recomb_DMC1 meiotic recombinase Dmc1	Back alignment and domain information

>PRK00279 adk adenylate kinase; Reviewed	Back alignment and domain information

>cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch	Back alignment and domain information

>TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB	Back alignment and domain information

>COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C	Back alignment and domain information

>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules	Back alignment and domain information

>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars	Back alignment and domain information

>PRK14527 adenylate kinase; Provisional	Back alignment and domain information

>cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP	Back alignment and domain information

>PRK06696 uridine kinase; Validated	Back alignment and domain information

>PRK00889 adenylylsulfate kinase; Provisional	Back alignment and domain information

>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA	Back alignment and domain information

>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family	Back alignment and domain information

>smart00534 MUTSac ATPase domain of DNA mismatch repair MUTS family	Back alignment and domain information

>PF06414 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This entry represents a domain originally identified in bacterial zeta toxin proteins, where it comprises the whole protein []	Back alignment and domain information

>cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes	Back alignment and domain information

>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A	Back alignment and domain information

>PRK08485 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>TIGR02655 circ_KaiC circadian clock protein KaiC	Back alignment and domain information

>PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases	Back alignment and domain information

>PLN02674 adenylate kinase	Back alignment and domain information

>PF13521 AAA_28: AAA domain; PDB: 1LW7_A	Back alignment and domain information

>PRK01184 hypothetical protein; Provisional	Back alignment and domain information

>PTZ00035 Rad51 protein; Provisional	Back alignment and domain information

>PRK14700 recombination factor protein RarA; Provisional	Back alignment and domain information

>TIGR00150 HI0065_YjeE ATPase, YjeE family	Back alignment and domain information

>PF00406 ADK: Adenylate kinase; InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction AMP + MgATP = ADP + MgADP an essential reaction for many processes in living cells	Back alignment and domain information

>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins	Back alignment and domain information

>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism]	Back alignment and domain information

>TIGR02239 recomb_RAD51 DNA repair protein RAD51	Back alignment and domain information

>COG1855 ATPase (PilT family) [General function prediction only]	Back alignment and domain information

>PF08303 tRNA_lig_kinase: tRNA ligase kinase domain; InterPro: IPR015966 This entry represents a kinase domain found in fungal tRNA ligases []	Back alignment and domain information

>PRK04182 cytidylate kinase; Provisional	Back alignment and domain information

>PRK14730 coaE dephospho-CoA kinase; Provisional	Back alignment and domain information

>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways	Back alignment and domain information

>PRK14526 adenylate kinase; Provisional	Back alignment and domain information

>PHA02530 pseT polynucleotide kinase; Provisional	Back alignment and domain information

>PRK13889 conjugal transfer relaxase TraA; Provisional	Back alignment and domain information

>TIGR02173 cyt_kin_arch cytidylate kinase, putative	Back alignment and domain information

>COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only]	Back alignment and domain information

>PLN03186 DNA repair protein RAD51 homolog; Provisional	Back alignment and domain information

>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion	Back alignment and domain information

>TIGR01526 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltransferase, NadR type	Back alignment and domain information

>PRK10263 DNA translocase FtsK; Provisional	Back alignment and domain information

>PRK10875 recD exonuclease V subunit alpha; Provisional	Back alignment and domain information

>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated	Back alignment and domain information

>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion]	Back alignment and domain information

>PF01745 IPT: Isopentenyl transferase; InterPro: IPR002648 Isopentenyl transferase / dimethylallyl transferase synthesizes isopentenyladensosine 5'-monophosphate, a cytokinin that induces shoot formation on host plants infected with the Ti plasmid []	Back alignment and domain information

>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism]	Back alignment and domain information

>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion]	Back alignment and domain information

>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB	Back alignment and domain information

>PRK05541 adenylylsulfate kinase; Provisional	Back alignment and domain information

>PRK12608 transcription termination factor Rho; Provisional	Back alignment and domain information

>PRK12339 2-phosphoglycerate kinase; Provisional	Back alignment and domain information

>TIGR00152 dephospho-CoA kinase	Back alignment and domain information

>PRK10078 ribose 1,5-bisphosphokinase; Provisional	Back alignment and domain information

Homologous Structure Templates