Citrus Sinensis ID: 011414


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480------
MTGNESESELPVPPYPPIEPTAFDLIVIGTGLPESVISAAASASGKSVLHLDPNPFYGSHFSSLSIADLTHFLNSHSTPSSVCPDPLYSDVEISNYASRLLSQHPRNFNLDVSGPRVLFCADHAVDLMLKSGASHYLEFKSIDATFMLDADAKLCSVPDSRAAIFKDKSLGLMEKNQLMRFFKLVQGHLSLDESEENNVRISEEDLDSPFAEFLTKMKLPHKIKSIVLYAIAMADYDQEVSEYVLKTRDGINRLALYNSSIGRFQNALGALIYPIYGQGELPQAFCRRAAVKGCLYVLRMPVISLLTDQNSGSYKGVRLASGQDILSHKLVLDPSFTVPGSLASSHQQLQESFQAFSLSDNKGKVARGICITRSSLKPDLSNFLVIFPPRSLFPEQVTSIRVLQLGGNLAVCPLGMFVLYFSALCDEVNQGKKLLHAALSALQKLLVTGTAGNSSTAQSEDMEEAKPTLLWSALYIQDLSLSHVFI
cccccccccccccccccccccEEEEEEEcccHHHHHHHHHHHHccccEEEcccccccccccccccHHHHHHHHccccccccccccccccccHHcHHHccccccccccccccccccEEEEcccHHHHHHHHHcccEEEEEEEEcEEEEEcccccEEEccccHHHHcccccccHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHccccHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHccccccccEEEcccccccHHHHHHHHHHHcccEEEccccEEEEEEccccccEEEEEEccccEEEEcEEEEcccccccccccccccHHHHHHccccccccccEEEEEEEEEcccccccccccEEEccccccccccccEEEEEEEcccccccccccEEEEEEEEEcccccHHHHHHHHHHHHHHHHHccccccccccccccccccccEEEEEEEEEEEcccccccc
cccccccEccccccccccccccccEEEEcccHHHHHHHHHHHHccccEEEEcccccccccccEEcHHHHHHHHcccccccccccccccccccccccccHHHcccccccEEEccccHHHHccccHHHEEEEcccEEEEEEEEEcEEEEEEcccEEEEccccHHHHHHcccccHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHccccccHHHHHHHHHHHccccHHccccccccHHHHHHHHHHHHHHHHHccccccEEEEccccccccHHHHHHHHHHccEEEccccccEEEEEccccEEEEEEEccccEEEEEEEEEccccccccccccccccccccccccccEEEccEEEEEEEEEccccccccccEEEEEccHHccccccccEEEEEEEccccccccccEEEEEEEEEEccccHHHHHHHHHHHHcccHHHcccccccccccccccccccEEHHHHHHHHHHHHcHEcc
mtgneseselpvppyppieptafDLIVIGTGLPESVISAAAsasgksvlhldpnpfygshfsslSIADLTHflnshstpssvcpdplysdveiSNYASRLLsqhprnfnldvsgprvlFCADHAVDLMLKSGASHYlefksidatfmldadaklcsvpdsraaifkdkslglmEKNQLMRFFKLVQGhlsldeseennvriseedldspFAEFLtkmklphkIKSIVLYAIAMADYDQEVSEYVLKTRDGINRLALYNSSIGRFQNALGAliypiygqgelpqaFCRRAAVKGCLYVLRMPvislltdqnsgsykgvrlasgqdilshklvldpsftvpgslasSHQQLQESFQAfslsdnkgkvargicitrsslkpdlsnflvifpprslfpeqvTSIRVLQlggnlavcpLGMFVLYFSALCDEVNQGKKLLHAALSALQKLLVTgtagnsstaqsedmeeakPTLLWSALYIQdlslshvfi
mtgneseselpvppyppIEPTAFDLIVIGTGLPESVISAAASASGKSVLHLDPNPFYGSHFSSLSIADLTHFLNSHSTPSSVCPDPLYSDVEISNYASRLLSQHPRNFNLDVSGPRVLFCADHAVDLMLKSGASHYLEFKSIDATFMLDADAKLCSVPDSRAAIFKDKSLGLMEKNQLMRFFKLVQGHLSLDESEENNVRISEEDLDSPFAEFLTKMKLPHKIKSIVLYAIAMADYDQEVSEYVLKTRDGINRLALYNSSIGRFQNALGALIYPIYGQGELPQAFCRRAAVKGCLYVLRMPVISlltdqnsgsYKGVRLASGQDILSHKLVLDPSFTVPGSLASSHQQLQESFQAfslsdnkgKVARGICItrsslkpdlsnFLVIFPPRSLFPEQVTSIRVLQLGGNLAVCPLGMFVLYFSALCDEVNQGKKLLHAALSALQKLLVTGTAGnsstaqsedmeEAKPTLLWSALYIQDLSLSHVFI
MTGNeseselpvppyppiepTAFDLIVIGTGLPESVISAAASASGKSVLHLDPNPFYGSHFSSLSIADLTHFLNSHSTPSSVCPDPLYSDVEISNYASRLLSQHPRNFNLDVSGPRVLFCADHAVDLMLKSGASHYLEFKSIDATFMLDADAKLCSVPDSRAAIFKDKSLGLMEKNQLMRFFKLVQGHLSLDESEENNVRISEEDLDSPFAEFLTKMKLPHKIKSIVLYAIAMADYDQEVSEYVLKTRDGINRLALYNSSIGRFQNALGALIYPIYGQGELPQAFCRRAAVKGCLYVLRMPVISLLTDQNSGSYKGVRLASGQDILSHKLVLDPSFTVPGSLASSHQQLQESFQAFSLSDNKGKVARGICITRSSLKPDLSNFLVIFPPRSLFPEQVTSIRVLQLGGNLAVCPLGMFVLYFSALCDEVNQGKKLLHAALSALQKLLVTGTAGNSSTAQSEDMEEAKPTLLWSALYIQDLSLSHVFI
******************EPTAFDLIVIGTGLPESVISAAASASGKSVLHLDPNPFYGSHFSSLSIADLTHFLNSHS***SVCPDPLYSDVEISNYASRLLSQHPRNFNLDVSGPRVLFCADHAVDLMLKSGASHYLEFKSIDATFMLDADAKLCSVPDSRAAIFKDKSLGLMEKNQLMRFFKLVQGHLS******************PFAEFLTKMKLPHKIKSIVLYAIAMADYDQEVSEYVLKTRDGINRLALYNSSIGRFQNALGALIYPIYGQGELPQAFCRRAAVKGCLYVLRMPVISLLTDQNSGSYKGVRLASGQDILSHKLVLDPSFTV************************GKVARGICITRSSLKPDLSNFLVIFPPRSLFPEQVTSIRVLQLGGNLAVCPLGMFVLYFSALCDEVNQGKKLLHAALSALQKLLVTG******************TLLWSALYIQDLSLSHV**
***************PPIEPTAFDLIVIGTGLPESVISAAASASGKSVLHLDPNPFYGSHFSSLSIADLTHFLNSHSTPSSVCPDPLYSDVEISNYASRLLSQHPRNFNLDVSGPRVLFCADHAVDLMLKSGASHYLEFKSIDATFMLDADAKLCSVPDSRAAIFKDKSLGLMEKNQLMRFFKLVQGHLSLDESEENNVRISEEDLDSPFAEFLTKMKLPHKIKSIVLYAIAMADYDQEVSEYVLKTRDGINRLALYNSSIGRFQNALGALIYPIYGQGELPQAFCRRAAVKGCLYVLRMPVISLLTDQNSGSYKGVRLASGQDILSHKLVLDPSFTVPGSL***************LSDNKGKVARGICITRSSLKPDLSNFLVIFPPRSLFPEQVTSIRVLQLGGNLAVCPLGMFVLYFSALCD******KLLHAALSALQKLLVTGTAG***********EAKPTLLWSALYIQDLSLSHVFI
***********VPPYPPIEPTAFDLIVIGTGLPESVISAAASASGKSVLHLDPNPFYGSHFSSLSIADLTHFLNSHSTPSSVCPDPLYSDVEISNYASRLLSQHPRNFNLDVSGPRVLFCADHAVDLMLKSGASHYLEFKSIDATFMLDADAKLCSVPDSRAAIFKDKSLGLMEKNQLMRFFKLVQGHLSLDESEENNVRISEEDLDSPFAEFLTKMKLPHKIKSIVLYAIAMADYDQEVSEYVLKTRDGINRLALYNSSIGRFQNALGALIYPIYGQGELPQAFCRRAAVKGCLYVLRMPVISLLTDQNSGSYKGVRLASGQDILSHKLVLDPSFTVPGSLASSHQQLQESFQAFSLSDNKGKVARGICITRSSLKPDLSNFLVIFPPRSLFPEQVTSIRVLQLGGNLAVCPLGMFVLYFSALCDEVNQGKKLLHAALSALQKLLVTG***************AKPTLLWSALYIQDLSLSHVFI
******ESELPVPPYPPIEPTAFDLIVIGTGLPESVISAAASASGKSVLHLDPNPFYGSHFSSLSIADLTHFLNSH**************************QHPRNFNLDVSGPRVLFCADHAVDLMLKSGASHYLEFKSIDATFMLDADAKLCSVPDSRAAIFKDKSLGLMEKNQLMRFFKLVQGHLSLDESEENNVRISEEDLDSPFAEFLTKMKLPHKIKSIVLYAIAMADYDQEVSEYVLKTRDGINRLALYNSSIGRFQNALGALIYPIYGQGELPQAFCRRAAVKGCLYVLRMPVISLLTDQNSGSYKGVRLASGQDILSHKLVLDPSFTVPGSLA***********AFSLSDNKGKVARGICITRSSLKPDLSNFLVIFPPRSLFPEQVTSIRVLQLGGNLAVCPLGMFVLYFSALCDEVNQGKKLLHAALSALQKLLVTGTAGNSSTAQSEDMEEAKPTLLWSALYIQDLSLSHVFI
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTGNESESELPVPPYPPIEPTAFDLIVIGTGLPESVISAAASASGKSVLHLDPNPFYGSHFSSLSIADLTHFLNSHSTPSSVCPDPLYSDVEISNYASRLLSQHPRNFNLDVSGPRVLFCADHAVDLMLKSGASHYLEFKSIDATFMLDADAKLCSVPDSRAAIFKDKSLGLMEKNQLMRFFKLVQGHLSLDESEENNVRISEEDLDSPFAEFLTKMKLPHKIKSIVLYAIAMADYDQEVSEYVLKTRDGINRLALYNSSIGRFQNALGALIYPIYGQGELPQAFCRRAAVKGCLYVLRMPVISLLTDQNSGSYKGVRLASGQDILSHKLVLDPSFTVPGSLASSHQQLQESFQAFSLSDNKGKVARGICITRSSLKPDLSNFLVIFPPRSLFPEQVTSIRVLQLGGNLAVCPLGMFVLYFSALCDEVNQGKKLLHAALSALQKLLVTGTAGNSSTAQSEDMEEAKPTLLWSALYIQDLSLSHVFI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query486 2.2.26 [Sep-21-2011]
Q9V8W3511 Rab proteins geranylgeran yes no 0.617 0.587 0.340 3e-41
P32864 603 Rab proteins geranylgeran yes no 0.796 0.641 0.279 3e-32
P24386653 Rab proteins geranylgeran yes no 0.670 0.499 0.299 5e-32
O93831 640 Rab proteins geranylgeran N/A no 0.792 0.601 0.275 5e-32
Q9QZD5621 Rab proteins geranylgeran yes no 0.681 0.533 0.296 1e-31
Q10305440 Probable secretory pathwa yes no 0.761 0.840 0.259 4e-31
Q9QXG2665 Rab proteins geranylgeran no no 0.666 0.487 0.289 5e-31
P37727650 Rab proteins geranylgeran no no 0.670 0.501 0.288 8e-30
P26374656 Rab proteins geranylgeran no no 0.666 0.493 0.281 3e-29
P21856447 Rab GDP dissociation inhi no no 0.646 0.702 0.270 1e-28
>sp|Q9V8W3|RABEP_DROME Rab proteins geranylgeranyltransferase component A OS=Drosophila melanogaster GN=Rep PE=2 SV=1 Back     alignment and function desciption
 Score =  169 bits (429), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 111/326 (34%), Positives = 165/326 (50%), Gaps = 26/326 (7%)

Query: 20  PTAFDLIVIGTGLPESVISAAASASGKSVLHLDPNPFYGSHFSSLSIADLTHFLNSHSTP 79
           P  FDL+VIGTG  ES I+AA S  GKSVLHLD N +YG  +SS S+  L   L+    P
Sbjct: 6   PEQFDLVVIGTGFTESCIAAAGSRIGKSVLHLDSNEYYGDVWSSFSMDALCARLDQEVEP 65

Query: 80  SSVCPDPLY--------SDVEISNYASRLLSQHPRNFNLDVSGPRVLFCADHAVDLMLKS 131
            S   +  Y        S+ +  ++    +    R F+LD+  PR+L+ A   V L++KS
Sbjct: 66  HSALRNARYTWHSMEKESETDAQSWNRDSVLAKSRRFSLDLC-PRILYAAGELVQLLIKS 124

Query: 132 GASHYLEFKSIDATFMLDADAKLCSVPDSRAAIFKDKSLGLMEKNQLMRFFKLVQGHLSL 191
               Y EF+++D   M   + ++ SVP SR+ +F  K+L ++EK  LM+F          
Sbjct: 125 NICRYAEFRAVDHVCMRH-NGEIVSVPCSRSDVFNTKTLTIVEKRLLMKFLTACN----- 178

Query: 192 DESEENNVRISEEDLDSPFAEFLTKMKLPHKIKSIVLYAIAMADYDQEVSEYVLKTRDGI 251
           D  E+     S E     F E+L   ++  KI S V+ AIAM        E       G+
Sbjct: 179 DYGEDKCNEDSLEFRGRTFLEYLQAQRVTEKISSCVMQAIAMCGPSTSFEE-------GM 231

Query: 252 NRLALYNSSIGRFQNALGALIYPIYGQGELPQAFCRRAAVKGCLYVLRMPVISLLTDQNS 311
            R   +  S+GR+ N     ++P+YG GELPQ FCR  AV G +Y L+  V  +  D NS
Sbjct: 232 QRTQRFLGSLGRYGNT--PFLFPMYGCGELPQCFCRLCAVYGGIYCLKRAVDDIALDSNS 289

Query: 312 GSYKGVRLASGQDILSHKLVLDPSFT 337
             +  +  ++G+ + +  +V  P +T
Sbjct: 290 NEF--LLSSAGKTLRAKNVVSAPGYT 313




Binds unprenylated Rab proteins, presents it to the catalytic component B, and remains bound to it after the geranylgeranyl transfer reaction. The component A is thought to be regenerated by transferring its prenylated Rab to a protein acceptor.
Drosophila melanogaster (taxid: 7227)
>sp|P32864|RAEP_YEAST Rab proteins geranylgeranyltransferase component A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRS6 PE=1 SV=2 Back     alignment and function description
>sp|P24386|RAE1_HUMAN Rab proteins geranylgeranyltransferase component A 1 OS=Homo sapiens GN=CHM PE=1 SV=3 Back     alignment and function description
>sp|O93831|RAEP_CANAX Rab proteins geranylgeranyltransferase component A OS=Candida albicans GN=MRS6 PE=3 SV=1 Back     alignment and function description
>sp|Q9QZD5|RAE2_MOUSE Rab proteins geranylgeranyltransferase component A 2 OS=Mus musculus GN=Chml PE=2 SV=2 Back     alignment and function description
>sp|Q10305|GDI1_SCHPO Probable secretory pathway GDP dissociation inhibitor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gdi1 PE=3 SV=1 Back     alignment and function description
>sp|Q9QXG2|RAE1_MOUSE Rab proteins geranylgeranyltransferase component A 1 OS=Mus musculus GN=Chm PE=2 SV=1 Back     alignment and function description
>sp|P37727|RAE1_RAT Rab proteins geranylgeranyltransferase component A 1 OS=Rattus norvegicus GN=Chm PE=1 SV=1 Back     alignment and function description
>sp|P26374|RAE2_HUMAN Rab proteins geranylgeranyltransferase component A 2 OS=Homo sapiens GN=CHML PE=1 SV=2 Back     alignment and function description
>sp|P21856|GDIA_BOVIN Rab GDP dissociation inhibitor alpha OS=Bos taurus GN=GDI1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query486
359476981556 PREDICTED: rab proteins geranylgeranyltr 0.965 0.843 0.651 1e-177
224113201553 predicted protein [Populus trichocarpa] 0.960 0.844 0.649 1e-176
255561411551 protein with unknown function [Ricinus c 0.954 0.842 0.630 1e-166
147798203 812 hypothetical protein VITISV_019372 [Viti 0.965 0.577 0.572 1e-165
356496561553 PREDICTED: rab proteins geranylgeranyltr 0.952 0.837 0.606 1e-159
356538383551 PREDICTED: rab proteins geranylgeranyltr 0.946 0.834 0.602 1e-159
357484143552 Rab proteins geranylgeranyltransferase c 0.950 0.836 0.581 1e-157
449456881543 PREDICTED: rab proteins geranylgeranyltr 0.950 0.850 0.582 1e-157
388517443552 unknown [Medicago truncatula] 0.950 0.836 0.579 1e-157
22330883563 Rab escort protein [Arabidopsis thaliana 0.960 0.829 0.584 1e-154
>gi|359476981|ref|XP_002273131.2| PREDICTED: rab proteins geranylgeranyltransferase component A 2-like [Vitis vinifera] gi|296088658|emb|CBI37649.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  629 bits (1622), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 323/496 (65%), Positives = 385/496 (77%), Gaps = 27/496 (5%)

Query: 12  VPPYPPIEPTAFDLIVIGTGLPESVISAAASASGKSVLHLDPNPFYGSHFSSLSIADLTH 71
            P YPPIEPT FDLIV+GTGLP+SVI+AAAS++GKSVLHLD N FYGSHFSSL++ + + 
Sbjct: 4   TPSYPPIEPTDFDLIVVGTGLPQSVIAAAASSAGKSVLHLDSNSFYGSHFSSLNLDEFSS 63

Query: 72  FLNSHST--------PSSVCPD------------PLYSDVEISNYASRLLSQHPRNFNLD 111
           FL S S         PSSV  D            P+YSDVEI++++S  + +H R FNLD
Sbjct: 64  FLTSQSAVHSSHPNPPSSVAADAAEYVALDLKTRPMYSDVEITSHSSDPV-EHSRKFNLD 122

Query: 112 VSGPRVLFCADHAVDLMLKSGASHYLEFKSIDATFMLDADAKLCSVPDSRAAIFKDKSLG 171
           VSGPRVLFCAD AVDLMLKSGAS YLEFKSIDA+F+ DAD +  +VPDSRAAIFKD+SL 
Sbjct: 123 VSGPRVLFCADAAVDLMLKSGASQYLEFKSIDASFVCDADGRFSTVPDSRAAIFKDRSLS 182

Query: 172 LMEKNQLMRFFKLVQGHLSLDESEEN--NVRISEEDLDSPFAEFLTKMKLPHKIKSIVLY 229
           L EKNQLMRFFKL+QGHL+  +  EN  N RISE+DL+SPF EFL KM+LP KIKS++LY
Sbjct: 183 LTEKNQLMRFFKLIQGHLAASDEAENDSNARISEDDLESPFVEFLNKMRLPPKIKSMILY 242

Query: 230 AIAMADYDQ---EVSEYVLKTRDGINRLALYNSSIGRFQNALGALIYPIYGQGELPQAFC 286
           AIAMADYDQ   EV + VL T+ GI+RLALY+SS+GRF NALGALIYPIYGQGEL QAFC
Sbjct: 243 AIAMADYDQDSIEVCKDVLDTKIGIDRLALYHSSVGRFPNALGALIYPIYGQGELTQAFC 302

Query: 287 RRAAVKGCLYVLRMPVISLLTDQNSGSYKGVRLASGQDILSHKLVLDPSFTVPGSLASSH 346
           RRAAVKGC+YVLRMPVI+LL ++ SG  KGVRLASGQDI S KL++DPSF VP  +A S 
Sbjct: 303 RRAAVKGCIYVLRMPVIALLMEKESGHCKGVRLASGQDIFSQKLLVDPSFIVPVPVAPSQ 362

Query: 347 QQ-LQESFQAFSLSDNKGKVARGICITRSSLKPDLSNFLVIFPPRSLFPEQVTSIRVLQL 405
              + ES Q  +L D K KVARGICI +SSLKPD+SNF+ ++PPRSL+PEQ  +IR +Q+
Sbjct: 363 PDCMPESSQVINLVDAKQKVARGICIMKSSLKPDVSNFVFVYPPRSLYPEQAMAIRAVQI 422

Query: 406 GGNLAVCPLGMFVLYFSALCDEVNQGKKLLHAALSALQKLLVTGTAGNSSTAQSEDMEEA 465
           G NL VCP GMFVLY S LC++  QGK+LL AA+ +L  L V+G   NSS+  SE+MEE 
Sbjct: 423 GSNLGVCPSGMFVLYLSTLCNDATQGKELLQAAIKSLFTLPVSGNPENSSSVHSENMEEV 482

Query: 466 KPTLLWSALYIQDLSL 481
           KPTLLWSALY Q+L +
Sbjct: 483 KPTLLWSALYTQELVM 498




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224113201|ref|XP_002332635.1| predicted protein [Populus trichocarpa] gi|222832862|gb|EEE71339.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255561411|ref|XP_002521716.1| protein with unknown function [Ricinus communis] gi|223539107|gb|EEF40703.1| protein with unknown function [Ricinus communis] Back     alignment and taxonomy information
>gi|147798203|emb|CAN62777.1| hypothetical protein VITISV_019372 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356496561|ref|XP_003517135.1| PREDICTED: rab proteins geranylgeranyltransferase component A-like [Glycine max] Back     alignment and taxonomy information
>gi|356538383|ref|XP_003537683.1| PREDICTED: rab proteins geranylgeranyltransferase component A-like [Glycine max] Back     alignment and taxonomy information
>gi|357484143|ref|XP_003612358.1| Rab proteins geranylgeranyltransferase component A [Medicago truncatula] gi|355513693|gb|AES95316.1| Rab proteins geranylgeranyltransferase component A [Medicago truncatula] Back     alignment and taxonomy information
>gi|449456881|ref|XP_004146177.1| PREDICTED: rab proteins geranylgeranyltransferase component A 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|388517443|gb|AFK46783.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|22330883|ref|NP_187306.2| Rab escort protein [Arabidopsis thaliana] gi|51317418|gb|AAN03631.2|AF409086_1 Rab escort protein [Arabidopsis thaliana] gi|332640889|gb|AEE74410.1| Rab escort protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query486
TAIR|locus:2084289563 REP "AT3G06540" [Arabidopsis t 0.806 0.696 0.605 1.6e-145
FB|FBgn0026378511 Rep "Rab escort protein" [Dros 0.611 0.581 0.337 1.6e-38
UNIPROTKB|P24386653 CHM "Rab proteins geranylgeran 0.565 0.421 0.298 5.6e-37
MGI|MGI:101913621 Chml "choroideremia-like" [Mus 0.557 0.436 0.301 2.3e-36
UNIPROTKB|E2RKG1652 CHM "Uncharacterized protein" 0.563 0.420 0.307 5e-36
MGI|MGI:892979665 Chm "choroidermia" [Mus muscul 0.567 0.415 0.295 1.2e-35
DICTYBASE|DDB_G0280143 661 DDB_G0280143 "Rab escort prote 0.656 0.482 0.275 5.7e-35
UNIPROTKB|K7GR66653 CHM "Uncharacterized protein" 0.567 0.422 0.280 1.1e-34
UNIPROTKB|F1NEX6656 CHM "Uncharacterized protein" 0.419 0.310 0.328 2.1e-34
RGD|2340650 Chm "choroideremia (Rab escort 0.569 0.426 0.290 1.2e-33
TAIR|locus:2084289 REP "AT3G06540" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1219 (434.2 bits), Expect = 1.6e-145, Sum P(2) = 1.6e-145
 Identities = 243/401 (60%), Positives = 311/401 (77%)

Query:    87 LYSDVEISNYASRLLSQHPRNFNLDVSGPRVLFCADHAVDLMLKSGASHYLEFKSIDATF 146
             LYS VEIS++ S +L +H R FN+D++GPRV+FCAD +++LMLKSGA++Y+EFKSIDA+F
Sbjct:    99 LYSSVEISSFESEILEEHSRRFNVDLAGPRVVFCADESINLMLKSGANNYVEFKSIDASF 158

Query:   147 MLDADAKLCSVPDSRAAIFKDKSLGLMEKNQLMRFFKLVQGHL--SLDESEENNVRISEE 204
             + D+  +L +VPDSRAAIFKDKSL L+EKNQLM+FFKLVQ HL  S ++ +   V+ISEE
Sbjct:   159 VGDSSGELRNVPDSRAAIFKDKSLTLLEKNQLMKFFKLVQSHLASSTEKDDSTTVKISEE 218

Query:   205 DLDSPFAEFLTKMKLPHKIKSIVLYAIAMADYDQEVSE---YVLKTRDGINRLALYNSSI 261
             D++SPF +FL+KM+LP KIKSI+LYAIAM DYDQ+ +E   ++LKT++GI+RLALY +S+
Sbjct:   219 DMESPFVDFLSKMRLPPKIKSIILYAIAMLDYDQDNTETCRHLLKTKEGIDRLALYITSM 278

Query:   262 GRFQNALGALIYPIYGQGELPQAFCRRAAVKGCLYVLRMPVISLLTDQNSGSYKGVRLAS 321
             GRF NALGALIYPIYGQGELPQAFCRRAAVKGC+YVLRMP+ +LL D+ +G YKGVRLAS
Sbjct:   279 GRFSNALGALIYPIYGQGELPQAFCRRAAVKGCIYVLRMPITALLLDKETGGYKGVRLAS 338

Query:   322 GQDILSHKLVLDPSFTVP-GSLASSHQQLQESFQAFSLSD--NKGKVARGICITRSSLKP 378
             GQ+I S KL+LDP  TV   SL+S   Q  E+          NK K+ARG+C+ R S+K 
Sbjct:   339 GQEIFSQKLILDPCVTVGLESLSSLTDQQNETLSVLVPKSMINKEKIARGVCVIRGSVKA 398

Query:   379 DLSNFLVIFPPRSLFPEQVTSIRVLQLGGNLAVCPLGMFVLYFSALCDEVNQGKKLLHAA 438
             ++SN LV++PP+SLFPEQ+T+IRVLQLG  LAVCP  M VLY S LCD  +QG K L +A
Sbjct:   399 NVSNALVVYPPKSLFPEQLTAIRVLQLGSGLAVCPADMHVLYLSTLCDNDDQGIKALLSA 458

Query:   439 LSALQKLLVTGTAGNSSTAQSEDMEEAKPTLLWSALYIQDL 479
             +S L  L V     + S  ++ D  E KP LLW ALY+Q+L
Sbjct:   459 MSNLISLPVPENRQSDSVVEN-DTSETKPILLWRALYVQEL 498


GO:0005093 "Rab GDP-dissociation inhibitor activity" evidence=ISS
GO:0005737 "cytoplasm" evidence=ISM;IDA
GO:0006886 "intracellular protein transport" evidence=IEA
GO:0015031 "protein transport" evidence=ISS
GO:0017137 "Rab GTPase binding" evidence=IDA
GO:2000541 "positive regulation of protein geranylgeranylation" evidence=IDA
GO:0005829 "cytosol" evidence=IDA
FB|FBgn0026378 Rep "Rab escort protein" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|P24386 CHM "Rab proteins geranylgeranyltransferase component A 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:101913 Chml "choroideremia-like" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E2RKG1 CHM "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:892979 Chm "choroidermia" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0280143 DDB_G0280143 "Rab escort protein (REP)" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|K7GR66 CHM "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1NEX6 CHM "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
RGD|2340 Chm "choroideremia (Rab escort protein 1)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
gw1.256.25.1
hypothetical protein (552 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query486
pfam00996439 pfam00996, GDI, GDP dissociation inhibitor 5e-56
COG5044434 COG5044, MRS6, RAB proteins geranylgeranyltransfer 9e-53
PTZ00363443 PTZ00363, PTZ00363, rab-GDP dissociation inhibitor 5e-51
>gnl|CDD|216232 pfam00996, GDI, GDP dissociation inhibitor Back     alignment and domain information
 Score =  192 bits (490), Expect = 5e-56
 Identities = 120/473 (25%), Positives = 195/473 (41%), Gaps = 75/473 (15%)

Query: 23  FDLIVIGTGLPESVISAAASASGKSVLHLDPNPFYGSHFSSLSIADL-THFLNSHSTPSS 81
           +D+IV+GTGL E ++S   S  GK VLH+D N +YG   +SLS+  L   F      P S
Sbjct: 5   YDVIVLGTGLKECILSGLLSVDGKKVLHIDRNDYYGGESASLSLEQLYARFRGGEEKPPS 64

Query: 82  VCPDPLYSDVEISNYASRLLSQHPRNFNLDVSGPRVLFCADHAVDLMLKSGASHYLEFKS 141
                                   R++N+D+  P+ L      V L++ +  + YLEFK+
Sbjct: 65  K-------------LGRS------RDWNVDLI-PKFLMANGELVKLLIHTDVTRYLEFKA 104

Query: 142 IDATFMLDADAKLCSVPDSRAAIFKDKSLGLMEKNQLMRFFKLVQGHLSLDESEENNVRI 201
           ++ +++     K+  VP +         +G+ EK +  +F   VQ     DE +      
Sbjct: 105 VEGSYVYK-GGKIHKVPANEMEALSSPLMGIFEKRRFRKFLTYVQ---DYDEDDPK---- 156

Query: 202 SEEDLD---SPFAEFLTKMKLPHKIKSIVLYAIAMADYDQEVSEYVLKTRDGINRLALYN 258
           + + LD       E   K  L       + +A+A+   D  +++        + R+ LY+
Sbjct: 157 THDGLDPRKRTMLEVYKKFGLDENTIDFIGHALALYRDDDYLNQ---PALPTVERIKLYS 213

Query: 259 SSIGRFQNALGALIYPIYGQGELPQAFCRRAAVKGCLYVLRMPVISLLTDQNSGSYKGVR 318
            S+ R+       +YP+YG GELPQ F R +A+ G  Y+L  PV  ++ D+N G   GV+
Sbjct: 214 ESLARYGK--SPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPVDEIVYDEN-GKVVGVK 270

Query: 319 LASGQDILSHKLVL-DPSFTVPGSLASSHQQLQESFQAFSLSDNKGKVARGICITRSSLK 377
             SG ++   K V+ DPS+  P  +                    G+V R ICI    + 
Sbjct: 271 --SGGEVARAKQVICDPSYF-PDKVRK-----------------VGQVIRAICILSHPIP 310

Query: 378 --PDLSNFLVIFPPRSLFPEQVTSIRVLQLGGNLAVCPLGMFVLYFSALCD------EVN 429
              D  +  +I P   +  +  + I +        VCP G ++   S   +      E+ 
Sbjct: 311 NTNDAGSVQIIIPQNQVGRK--SDIYISCCSYAHNVCPKGKYIAIVSTTVETENPESELA 368

Query: 430 QGKKLLHA------ALSALQKLLVTGTAGNSSTAQSEDMEEAKPTLLWSALYI 476
            G  LL         +S L +    G+      +QS D      T     L I
Sbjct: 369 PGLDLLGPIDEKFVKISDLYEPTDDGSEDQIFISQSYDATTHFETTCNDVLDI 421


Length = 439

>gnl|CDD|227377 COG5044, MRS6, RAB proteins geranylgeranyltransferase component A (RAB escort protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|185577 PTZ00363, PTZ00363, rab-GDP dissociation inhibitor; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 486
PF00996438 GDI: GDP dissociation inhibitor; InterPro: IPR0182 100.0
KOG4405547 consensus GDP dissociation inhibitor [Signal trans 100.0
PTZ00363443 rab-GDP dissociation inhibitor; Provisional 100.0
KOG1439440 consensus RAB proteins geranylgeranyltransferase c 100.0
COG5044434 MRS6 RAB proteins geranylgeranyltransferase compon 100.0
TIGR02734502 crtI_fam phytoene desaturase. Phytoene is converte 99.96
COG1233487 Phytoene dehydrogenase and related proteins [Secon 99.95
TIGR02733492 desat_CrtD C-3',4' desaturase CrtD. Members of thi 99.95
TIGR02730493 carot_isom carotene isomerase. Members of this fam 99.95
TIGR00562462 proto_IX_ox protoporphyrinogen oxidase. This prote 99.94
PLN02576496 protoporphyrinogen oxidase 99.93
PRK07233434 hypothetical protein; Provisional 99.93
PRK12416463 protoporphyrinogen oxidase; Provisional 99.92
PRK11883451 protoporphyrinogen oxidase; Reviewed 99.92
COG1232444 HemY Protoporphyrinogen oxidase [Coenzyme metaboli 99.91
PRK07208479 hypothetical protein; Provisional 99.91
PLN02612567 phytoene desaturase 99.91
TIGR02731453 phytoene_desat phytoene desaturase. Plants and cya 99.91
TIGR02732474 zeta_caro_desat carotene 7,8-desaturase. Carotene 99.88
PLN02487569 zeta-carotene desaturase 99.87
KOG4254561 consensus Phytoene desaturase [Coenzyme transport 99.87
PLN02268435 probable polyamine oxidase 99.83
TIGR03467419 HpnE squalene-associated FAD-dependent desaturase. 99.83
PLN02529 738 lysine-specific histone demethylase 1 99.82
PLN02676487 polyamine oxidase 99.82
PLN02568539 polyamine oxidase 99.8
PLN02328 808 lysine-specific histone demethylase 1 homolog 99.8
PLN03000 881 amine oxidase 99.78
COG1231450 Monoamine oxidase [Amino acid transport and metabo 99.78
PRK13977 576 myosin-cross-reactive antigen; Provisional 99.71
KOG1276491 consensus Protoporphyrinogen oxidase [Coenzyme tra 99.68
PLN02976 1713 amine oxidase 99.67
KOG0029501 consensus Amine oxidase [Secondary metabolites bio 99.67
PF01593450 Amino_oxidase: Flavin containing amine oxidoreduct 99.61
COG2907447 Predicted NAD/FAD-binding protein [General functio 99.61
KOG0685498 consensus Flavin-containing amine oxidase [Coenzym 99.41
COG3349485 Uncharacterized conserved protein [Function unknow 99.39
COG2081408 Predicted flavoproteins [General function predicti 99.34
TIGR00031377 UDP-GALP_mutase UDP-galactopyranose mutase. The ge 99.27
PF1345068 NAD_binding_8: NAD(P)-binding Rossmann-like domain 99.26
PF01266358 DAO: FAD dependent oxidoreductase; InterPro: IPR00 99.24
PF03486409 HI0933_like: HI0933-like protein; InterPro: IPR004 99.11
COG0579429 Predicted dehydrogenase [General function predicti 99.08
PRK11728393 hydroxyglutarate oxidase; Provisional 99.06
COG0562374 Glf UDP-galactopyranose mutase [Cell envelope biog 99.06
TIGR03329460 Phn_aa_oxid putative aminophosphonate oxidoreducta 99.02
TIGR01377380 soxA_mon sarcosine oxidase, monomeric form. Sarcos 98.96
PRK08274 466 tricarballylate dehydrogenase; Validated 98.91
PRK11101 546 glpA sn-glycerol-3-phosphate dehydrogenase subunit 98.91
PRK11259376 solA N-methyltryptophan oxidase; Provisional 98.86
PRK00711416 D-amino acid dehydrogenase small subunit; Validate 98.86
PRK12845564 3-ketosteroid-delta-1-dehydrogenase; Reviewed 98.84
PRK12409410 D-amino acid dehydrogenase small subunit; Provisio 98.84
PRK06481506 fumarate reductase flavoprotein subunit; Validated 98.78
PRK01747662 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans 98.77
PF01946230 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K. 98.76
COG1635262 THI4 Ribulose 1,5-bisphosphate synthetase, convert 98.75
TIGR01373407 soxB sarcosine oxidase, beta subunit family, heter 98.74
KOG2820399 consensus FAD-dependent oxidoreductase [General fu 98.73
PTZ00383497 malate:quinone oxidoreductase; Provisional 98.72
COG0578532 GlpA Glycerol-3-phosphate dehydrogenase [Energy pr 98.69
COG3380331 Predicted NAD/FAD-dependent oxidoreductase [Genera 98.63
COG0644396 FixC Dehydrogenases (flavoproteins) [Energy produc 98.59
PF06100500 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross 98.59
TIGR00292254 thiazole biosynthesis enzyme. This enzyme is invol 98.54
PRK10157428 putative oxidoreductase FixC; Provisional 98.52
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 98.52
PRK10015429 oxidoreductase; Provisional 98.49
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 98.44
PRK07121492 hypothetical protein; Validated 98.41
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 98.4
PRK07364415 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 98.4
TIGR00275400 flavoprotein, HI0933 family. The model when search 98.38
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Prov 98.38
PLN00093450 geranylgeranyl diphosphate reductase; Provisional 98.37
PRK12266508 glpD glycerol-3-phosphate dehydrogenase; Reviewed 98.36
PF01494356 FAD_binding_3: FAD binding domain; InterPro: IPR00 98.35
PLN02172461 flavin-containing monooxygenase FMO GS-OX 98.35
PF12831428 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3 98.35
TIGR02485 432 CobZ_N-term precorrin 3B synthase CobZ. CobZ is es 98.34
COG2072443 TrkA Predicted flavoprotein involved in K+ transpo 98.34
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Prov 98.34
PRK07494388 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 98.33
PRK06467471 dihydrolipoamide dehydrogenase; Reviewed 98.3
PRK06370463 mercuric reductase; Validated 98.3
PRK06292460 dihydrolipoamide dehydrogenase; Validated 98.3
TIGR02032295 GG-red-SF geranylgeranyl reductase family. This mo 98.3
PRK13369502 glycerol-3-phosphate dehydrogenase; Provisional 98.3
PRK06116450 glutathione reductase; Validated 98.29
PRK08013400 oxidoreductase; Provisional 98.27
PTZ00058561 glutathione reductase; Provisional 98.27
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 98.26
TIGR03378419 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase 98.25
KOG2844 856 consensus Dimethylglycine dehydrogenase precursor 98.25
PRK09126392 hypothetical protein; Provisional 98.24
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 98.23
PRK07818466 dihydrolipoamide dehydrogenase; Reviewed 98.23
PRK08849384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 98.23
PRK05192 618 tRNA uridine 5-carboxymethylaminomethyl modificati 98.23
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 98.22
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 98.22
PLN02463447 lycopene beta cyclase 98.22
PRK07045388 putative monooxygenase; Reviewed 98.22
PF00890417 FAD_binding_2: FAD binding domain of the Pfam fami 98.22
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 98.22
PRK05976472 dihydrolipoamide dehydrogenase; Validated 98.21
PRK08850405 2-octaprenyl-6-methoxyphenol hydroxylase; Validate 98.21
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 98.2
PRK06184502 hypothetical protein; Provisional 98.19
COG3573552 Predicted oxidoreductase [General function predict 98.19
PRK08020391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin 98.19
TIGR02023388 BchP-ChlP geranylgeranyl reductase. This model rep 98.18
PLN02661357 Putative thiazole synthesis 98.18
PF00732296 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR0001 98.18
PRK07236386 hypothetical protein; Provisional 98.17
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 98.16
PRK13748561 putative mercuric reductase; Provisional 98.16
TIGR02028398 ChlP geranylgeranyl reductase. This model represen 98.16
PRK12837513 3-ketosteroid-delta-1-dehydrogenase; Provisional 98.16
PRK12834549 putative FAD-binding dehydrogenase; Reviewed 98.16
PRK14694468 putative mercuric reductase; Provisional 98.16
PRK06327475 dihydrolipoamide dehydrogenase; Validated 98.16
TIGR033151012 Se_ygfK putative selenate reductase, YgfK subunit. 98.15
TIGR01813439 flavo_cyto_c flavocytochrome c. This model describ 98.15
PRK08163396 salicylate hydroxylase; Provisional 98.15
PRK12842 574 putative succinate dehydrogenase; Reviewed 98.14
COG0665387 DadA Glycine/D-amino acid oxidases (deaminating) [ 98.13
TIGR01988385 Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub 98.13
TIGR03143555 AhpF_homolog putative alkyl hydroperoxide reductas 98.13
PRK06185407 hypothetical protein; Provisional 98.12
PRK06834488 hypothetical protein; Provisional 98.12
KOG1399448 consensus Flavin-containing monooxygenase [Seconda 98.12
PLN02985514 squalene monooxygenase 98.12
PRK07608388 ubiquinone biosynthesis hydroxylase family protein 98.12
COG1148622 HdrA Heterodisulfide reductase, subunit A and rela 98.11
TIGR01790388 carotene-cycl lycopene cyclase family protein. Thi 98.11
TIGR03364365 HpnW_proposed FAD dependent oxidoreductase TIGR033 98.1
KOG1298509 consensus Squalene monooxygenase [Lipid transport 98.1
PRK07190487 hypothetical protein; Provisional 98.1
PRK05714405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 98.09
PRK12831464 putative oxidoreductase; Provisional 98.09
PLN02697529 lycopene epsilon cyclase 98.09
PRK05732395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 98.09
COG0492305 TrxB Thioredoxin reductase [Posttranslational modi 98.09
TIGR02053463 MerA mercuric reductase. This model represents the 98.08
PRK14727479 putative mercuric reductase; Provisional 98.08
TIGR02360390 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase. 98.07
PLN02464627 glycerol-3-phosphate dehydrogenase 98.07
PRK12844557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 98.07
PTZ00367567 squalene epoxidase; Provisional 98.06
PRK07057 591 sdhA succinate dehydrogenase flavoprotein subunit; 98.06
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 98.05
PF04820454 Trp_halogenase: Tryptophan halogenase; InterPro: I 98.05
TIGR01984382 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T 98.04
PRK06847375 hypothetical protein; Provisional 98.04
PRK12835 584 3-ketosteroid-delta-1-dehydrogenase; Reviewed 98.04
PRK06126545 hypothetical protein; Provisional 98.03
PRK06617374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 98.03
PTZ00052499 thioredoxin reductase; Provisional 98.02
PRK07843557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 98.02
PRK098531019 putative selenate reductase subunit YgfK; Provisio 98.02
COG0654387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and 98.02
PRK12839572 hypothetical protein; Provisional 98.02
PRK08641 589 sdhA succinate dehydrogenase flavoprotein subunit; 98.01
PRK07803 626 sdhA succinate dehydrogenase flavoprotein subunit; 98.01
PRK06753373 hypothetical protein; Provisional 98.0
PLN02507499 glutathione reductase 98.0
PRK06452 566 sdhA succinate dehydrogenase flavoprotein subunit; 98.0
PRK12809639 putative oxidoreductase Fe-S binding subunit; Revi 98.0
PRK08958 588 sdhA succinate dehydrogenase flavoprotein subunit; 98.0
PRK07804541 L-aspartate oxidase; Provisional 97.99
PRK12779 944 putative bifunctional glutamate synthase subunit b 97.99
PRK08243392 4-hydroxybenzoate 3-monooxygenase; Validated 97.99
PRK12769654 putative oxidoreductase Fe-S binding subunit; Revi 97.98
PRK08244493 hypothetical protein; Provisional 97.98
TIGR01989437 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T 97.98
PTZ00306 1167 NADH-dependent fumarate reductase; Provisional 97.98
PRK08132547 FAD-dependent oxidoreductase; Provisional 97.97
PRK05257494 malate:quinone oxidoreductase; Validated 97.97
PRK06183538 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va 97.97
PRK09078 598 sdhA succinate dehydrogenase flavoprotein subunit; 97.97
PRK11445351 putative oxidoreductase; Provisional 97.97
PRK07333403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 97.97
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 97.97
PRK07538413 hypothetical protein; Provisional 97.96
PTZ00139 617 Succinate dehydrogenase [ubiquinone] flavoprotein 97.96
TIGR01320483 mal_quin_oxido malate:quinone-oxidoreductase. This 97.96
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 97.94
TIGR01789370 lycopene_cycl lycopene cyclase. This model represe 97.94
PRK07395553 L-aspartate oxidase; Provisional 97.94
TIGR01423486 trypano_reduc trypanothione-disulfide reductase. T 97.94
PRK02106560 choline dehydrogenase; Validated 97.93
PRK06134 581 putative FAD-binding dehydrogenase; Reviewed 97.93
PRK12775 1006 putative trifunctional 2-polyprenylphenol hydroxyl 97.93
PRK06175433 L-aspartate oxidase; Provisional 97.93
KOG2614420 consensus Kynurenine 3-monooxygenase and related f 97.93
PLN00128 635 Succinate dehydrogenase [ubiquinone] flavoprotein 97.93
PRK07588391 hypothetical protein; Provisional 97.91
PRK07573 640 sdhA succinate dehydrogenase flavoprotein subunit; 97.91
PLN02546558 glutathione reductase 97.91
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 97.9
PF05834374 Lycopene_cycl: Lycopene cyclase protein; InterPro: 97.89
PRK05945 575 sdhA succinate dehydrogenase flavoprotein subunit; 97.89
PRK08626 657 fumarate reductase flavoprotein subunit; Provision 97.89
PRK12810471 gltD glutamate synthase subunit beta; Reviewed 97.89
PRK05868372 hypothetical protein; Validated 97.87
PRK06069 577 sdhA succinate dehydrogenase flavoprotein subunit; 97.87
PF00743531 FMO-like: Flavin-binding monooxygenase-like; Inter 97.87
TIGR02462544 pyranose_ox pyranose oxidase. Pyranose oxidase (al 97.86
PLN02815 594 L-aspartate oxidase 97.86
PRK10262321 thioredoxin reductase; Provisional 97.85
PRK12778752 putative bifunctional 2-polyprenylphenol hydroxyla 97.85
PRK05335436 tRNA (uracil-5-)-methyltransferase Gid; Reviewed 97.84
TIGR01812 566 sdhA_frdA_Gneg succinate dehydrogenase or fumarate 97.84
PTZ00153659 lipoamide dehydrogenase; Provisional 97.84
PRK12843578 putative FAD-binding dehydrogenase; Reviewed 97.82
PRK13339497 malate:quinone oxidoreductase; Reviewed 97.82
TIGR01318467 gltD_gamma_fam glutamate synthase small subunit fa 97.82
PRK08294 634 phenol 2-monooxygenase; Provisional 97.82
PRK06475400 salicylate hydroxylase; Provisional 97.82
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 97.81
TIGR00137433 gid_trmFO tRNA:m(5)U-54 methyltransferase. This mo 97.81
PLN02852491 ferredoxin-NADP+ reductase 97.8
TIGR00551 488 nadB L-aspartate oxidase. L-aspartate oxidase is t 97.8
PRK12814652 putative NADPH-dependent glutamate synthase small 97.8
PRK11749457 dihydropyrimidine dehydrogenase subunit A; Provisi 97.79
PRK06996398 hypothetical protein; Provisional 97.79
PRK08071510 L-aspartate oxidase; Provisional 97.79
PF01134392 GIDA: Glucose inhibited division protein A; InterP 97.78
PRK06854 608 adenylylsulfate reductase subunit alpha; Validated 97.77
PLN02927 668 antheraxanthin epoxidase/zeaxanthin epoxidase 97.77
PF06039488 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro 97.76
KOG2853509 consensus Possible oxidoreductase [General functio 97.75
TIGR03219414 salicylate_mono salicylate 1-monooxygenase. Member 97.74
COG1053562 SdhA Succinate dehydrogenase/fumarate reductase, f 97.73
PRK09231 582 fumarate reductase flavoprotein subunit; Validated 97.73
PRK06263 543 sdhA succinate dehydrogenase flavoprotein subunit; 97.71
PRK08275 554 putative oxidoreductase; Provisional 97.71
TIGR01438484 TGR thioredoxin and glutathione reductase selenopr 97.71
COG3075421 GlpB Anaerobic glycerol-3-phosphate dehydrogenase 97.71
PRK05329422 anaerobic glycerol-3-phosphate dehydrogenase subun 97.7
PRK08205 583 sdhA succinate dehydrogenase flavoprotein subunit; 97.7
KOG2415621 consensus Electron transfer flavoprotein ubiquinon 97.69
COG2509 486 Uncharacterized FAD-dependent dehydrogenases [Gene 97.68
TIGR01176 580 fum_red_Fp fumarate reductase, flavoprotein subuni 97.67
PRK09077536 L-aspartate oxidase; Provisional 97.67
TIGR01317485 GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal 97.66
PRK08401 466 L-aspartate oxidase; Provisional 97.66
COG2303542 BetA Choline dehydrogenase and related flavoprotei 97.62
PF07992201 Pyr_redox_2: Pyridine nucleotide-disulphide oxidor 97.59
PRK12771564 putative glutamate synthase (NADPH) small subunit; 97.58
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 97.57
KOG03992142 consensus Glutamate synthase [Amino acid transport 97.54
PRK12770352 putative glutamate synthase subunit beta; Provisio 97.54
COG0493457 GltD NADPH-dependent glutamate synthase beta chain 97.52
PLN02785587 Protein HOTHEAD 97.52
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 97.51
PRK06567 1028 putative bifunctional glutamate synthase subunit b 97.51
KOG1335506 consensus Dihydrolipoamide dehydrogenase [Energy p 97.5
TIGR00136 617 gidA glucose-inhibited division protein A. GidA, t 97.47
TIGR01810532 betA choline dehydrogenase. This enzyme is a membe 97.47
PTZ00188506 adrenodoxin reductase; Provisional 97.47
TIGR02061 614 aprA adenosine phosphosulphate reductase, alpha su 97.47
PRK07846451 mycothione reductase; Reviewed 97.44
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a 97.42
PRK07512 513 L-aspartate oxidase; Provisional 97.42
PRK13800 897 putative oxidoreductase/HEAT repeat-containing pro 97.41
TIGR01811 603 sdhA_Bsu succinate dehydrogenase or fumarate reduc 97.41
PRK13984604 putative oxidoreductase; Provisional 97.39
PRK07845466 flavoprotein disulfide reductase; Reviewed 97.38
PRK08255 765 salicylyl-CoA 5-hydroxylase; Reviewed 97.34
COG0445 621 GidA Flavin-dependent tRNA uridine 5-carboxymethyl 97.23
COG4716587 Myosin-crossreactive antigen [Function unknown] 97.21
KOG2665453 consensus Predicted FAD-dependent oxidoreductase [ 97.12
KOG1238 623 consensus Glucose dehydrogenase/choline dehydrogen 96.95
KOG2311 679 consensus NAD/FAD-utilizing protein possibly invol 96.9
COG0029518 NadB Aspartate oxidase [Coenzyme metabolism] 96.86
KOG2404477 consensus Fumarate reductase, flavoprotein subunit 96.84
PRK09897534 hypothetical protein; Provisional 96.83
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 96.79
KOG4716503 consensus Thioredoxin reductase [Posttranslational 96.73
KOG2960328 consensus Protein involved in thiamine biosynthesi 96.72
PRK09564444 coenzyme A disulfide reductase; Reviewed 96.63
PTZ00318424 NADH dehydrogenase-like protein; Provisional 96.58
COG0446415 HcaD Uncharacterized NAD(FAD)-dependent dehydrogen 96.44
PRK13512438 coenzyme A disulfide reductase; Provisional 96.39
TIGR02352337 thiamin_ThiO glycine oxidase ThiO. This family con 96.26
KOG0405478 consensus Pyridine nucleotide-disulphide oxidoredu 96.25
COG1206439 Gid NAD(FAD)-utilizing enzyme possibly involved in 96.23
KOG3855481 consensus Monooxygenase involved in coenzyme Q (ub 96.22
KOG0042 680 consensus Glycerol-3-phosphate dehydrogenase [Ener 95.9
PF03721185 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen 95.75
PF13454156 NAD_binding_9: FAD-NAD(P)-binding 95.54
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 95.49
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [En 95.4
KOG2852380 consensus Possible oxidoreductase [General functio 95.19
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 95.14
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 95.12
KOG1800468 consensus Ferredoxin/adrenodoxin reductase [Nucleo 95.02
TIGR03197381 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouri 94.98
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 94.94
COG4529474 Uncharacterized protein conserved in bacteria [Fun 94.82
COG3634520 AhpF Alkyl hydroperoxide reductase, large subunit 94.75
PF13434341 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi 94.69
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 94.66
PF07156368 Prenylcys_lyase: Prenylcysteine lyase; InterPro: I 94.59
PRK01438480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 94.56
PRK06249313 2-dehydropantoate 2-reductase; Provisional 94.54
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 94.5
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 94.29
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Prov 94.28
PRK02705459 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 94.24
PF02558151 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: 94.17
PRK05976472 dihydrolipoamide dehydrogenase; Validated 94.16
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 94.04
TIGR03377 516 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase 93.9
PRK14989 847 nitrite reductase subunit NirD; Provisional 93.75
TIGR02053463 MerA mercuric reductase. This model represents the 93.73
PF05834374 Lycopene_cycl: Lycopene cyclase protein; InterPro: 93.73
TIGR03862376 flavo_PP4765 uncharacterized flavoprotein, PP_4765 93.69
PRK06370463 mercuric reductase; Validated 93.69
PRK14106450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 93.59
PRK11064415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro 93.57
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 93.53
PRK08293287 3-hydroxybutyryl-CoA dehydrogenase; Validated 93.5
PRK09260288 3-hydroxybutyryl-CoA dehydrogenase; Validated 93.47
PRK06467471 dihydrolipoamide dehydrogenase; Reviewed 93.43
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 93.41
PRK13512438 coenzyme A disulfide reductase; Provisional 93.39
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 93.36
PRK07846451 mycothione reductase; Reviewed 93.36
PRK07818466 dihydrolipoamide dehydrogenase; Reviewed 93.31
PRK06292460 dihydrolipoamide dehydrogenase; Validated 93.29
COG1004414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en 93.27
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 93.26
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 93.18
PRK07530292 3-hydroxybutyryl-CoA dehydrogenase; Validated 93.18
PRK07819286 3-hydroxybutyryl-CoA dehydrogenase; Validated 93.14
TIGR03385427 CoA_CoA_reduc CoA-disulfide reductase. Members of 93.12
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 93.08
COG0569225 TrkA K+ transport systems, NAD-binding component [ 93.01
PRK04148134 hypothetical protein; Provisional 92.88
PRK07066321 3-hydroxybutyryl-CoA dehydrogenase; Validated 92.71
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 92.68
PRK06327475 dihydrolipoamide dehydrogenase; Validated 92.67
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 92.66
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 92.61
COG0686371 Ald Alanine dehydrogenase [Amino acid transport an 92.52
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a 92.5
TIGR01320483 mal_quin_oxido malate:quinone-oxidoreductase. This 92.39
PF00890417 FAD_binding_2: FAD binding domain of the Pfam fami 92.38
PRK05257494 malate:quinone oxidoreductase; Validated 92.36
PRK07845466 flavoprotein disulfide reductase; Reviewed 92.28
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 92.22
PRK06522304 2-dehydropantoate 2-reductase; Reviewed 92.16
PRK09564444 coenzyme A disulfide reductase; Reviewed 92.09
PRK06035291 3-hydroxyacyl-CoA dehydrogenase; Validated 91.97
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 91.84
cd05292308 LDH_2 A subgroup of L-lactate dehydrogenases. L-la 91.81
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 91.74
PTZ00058561 glutathione reductase; Provisional 91.72
KOG0404322 consensus Thioredoxin reductase [Posttranslational 91.71
PTZ00153659 lipoamide dehydrogenase; Provisional 91.69
PRK05708305 2-dehydropantoate 2-reductase; Provisional 91.68
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 91.67
PRK14989 847 nitrite reductase subunit NirD; Provisional 91.67
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 91.65
PRK10262321 thioredoxin reductase; Provisional 91.63
TIGR03026411 NDP-sugDHase nucleotide sugar dehydrogenase. All o 91.58
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 91.45
TIGR03143555 AhpF_homolog putative alkyl hydroperoxide reductas 91.37
PRK12921305 2-dehydropantoate 2-reductase; Provisional 91.33
PRK08229341 2-dehydropantoate 2-reductase; Provisional 91.24
PLN02507499 glutathione reductase 91.22
TIGR01763305 MalateDH_bact malate dehydrogenase, NAD-dependent. 91.2
PRK12770352 putative glutamate synthase subunit beta; Provisio 91.2
PLN02545295 3-hydroxybutyryl-CoA dehydrogenase 91.14
PRK06130311 3-hydroxybutyryl-CoA dehydrogenase; Validated 91.12
PF01262168 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal 91.06
PRK06116450 glutathione reductase; Validated 90.99
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Prov 90.98
PRK06134 581 putative FAD-binding dehydrogenase; Reviewed 90.78
PRK11199374 tyrA bifunctional chorismate mutase/prephenate deh 90.74
PRK12831464 putative oxidoreductase; Provisional 90.69
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 90.62
PLN02353473 probable UDP-glucose 6-dehydrogenase 90.56
PRK13748561 putative mercuric reductase; Provisional 90.47
COG1748389 LYS9 Saccharopine dehydrogenase and related protei 90.41
PLN02546558 glutathione reductase 90.35
PRK00094325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr 90.28
PRK14694468 putative mercuric reductase; Provisional 90.23
PF13478136 XdhC_C: XdhC Rossmann domain; PDB: 3ON5_A 2WE8_B 2 90.17
PRK14619308 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 90.09
KOG3851446 consensus Sulfide:quinone oxidoreductase/flavo-bin 90.06
COG3486436 IucD Lysine/ornithine N-monooxygenase [Secondary m 90.05
PRK07417279 arogenate dehydrogenase; Reviewed 90.02
PF01134392 GIDA: Glucose inhibited division protein A; InterP 90.0
PRK07121 492 hypothetical protein; Validated 89.97
PRK06719157 precorrin-2 dehydrogenase; Validated 89.96
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 89.94
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 89.91
PRK14618328 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 89.86
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 89.84
PRK06718202 precorrin-2 dehydrogenase; Reviewed 89.8
TIGR01816 565 sdhA_forward succinate dehydrogenase, flavoprotein 89.74
PRK14727479 putative mercuric reductase; Provisional 89.59
PRK12843 578 putative FAD-binding dehydrogenase; Reviewed 89.56
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 89.56
PF10727127 Rossmann-like: Rossmann-like domain; InterPro: IPR 89.54
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 89.47
PRK15057388 UDP-glucose 6-dehydrogenase; Provisional 89.47
PRK13339 497 malate:quinone oxidoreductase; Reviewed 89.25
PRK14620326 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 89.12
PTZ00052499 thioredoxin reductase; Provisional 89.05
PRK05329422 anaerobic glycerol-3-phosphate dehydrogenase subun 89.01
PRK04308445 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 88.97
PRK01710458 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 88.94
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 88.9
KOG3923342 consensus D-aspartate oxidase [Amino acid transpor 88.88
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 88.88
TIGR01438484 TGR thioredoxin and glutathione reductase selenopr 88.78
KOG2304298 consensus 3-hydroxyacyl-CoA dehydrogenase [Lipid t 88.73
TIGR01915219 npdG NADPH-dependent F420 reductase. This model re 88.66
PRK02472447 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 88.6
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 88.57
PRK11749457 dihydropyrimidine dehydrogenase subunit A; Provisi 88.54
TIGR02279503 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa 88.5
PRK07531495 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe 88.4
PRK10157 428 putative oxidoreductase FixC; Provisional 88.39
TIGR01423486 trypano_reduc trypanothione-disulfide reductase. T 88.15
cd05291306 HicDH_like L-2-hydroxyisocapronate dehydrogenases 88.02
PRK04690468 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 87.98
PRK00141473 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 87.76
PRK15116268 sulfur acceptor protein CsdL; Provisional 87.76
PTZ00318424 NADH dehydrogenase-like protein; Provisional 87.6
COG2072443 TrkA Predicted flavoprotein involved in K+ transpo 87.57
cd01339300 LDH-like_MDH L-lactate dehydrogenase-like malate d 87.49
PRK03803448 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 87.47
PRK08268507 3-hydroxy-acyl-CoA dehydrogenase; Validated 87.44
PRK06175433 L-aspartate oxidase; Provisional 87.44
TIGR01505291 tartro_sem_red 2-hydroxy-3-oxopropionate reductase 87.28
PRK11730715 fadB multifunctional fatty acid oxidation complex 87.27
PRK03369488 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 87.24
COG0771448 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligas 87.08
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 87.02
PLN02657390 3,8-divinyl protochlorophyllide a 8-vinyl reductas 86.98
PLN02695370 GDP-D-mannose-3',5'-epimerase 86.98
PRK06847375 hypothetical protein; Provisional 86.8
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 86.66
TIGR02437714 FadB fatty oxidation complex, alpha subunit FadB. 86.51
PRK06223307 malate dehydrogenase; Reviewed 86.45
PRK15461296 NADH-dependent gamma-hydroxybutyrate dehydrogenase 86.4
PRK12835 584 3-ketosteroid-delta-1-dehydrogenase; Reviewed 86.39
TIGR01813439 flavo_cyto_c flavocytochrome c. This model describ 86.36
PRK12778752 putative bifunctional 2-polyprenylphenol hydroxyla 86.36
COG0665387 DadA Glycine/D-amino acid oxidases (deaminating) [ 86.33
PRK09424509 pntA NAD(P) transhydrogenase subunit alpha; Provis 85.99
PRK12844 557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 85.93
PRK05945 575 sdhA succinate dehydrogenase flavoprotein subunit; 85.92
PRK05675 570 sdhA succinate dehydrogenase flavoprotein subunit; 85.92
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 85.85
TIGR01812 566 sdhA_frdA_Gneg succinate dehydrogenase or fumarate 85.85
TIGR00292254 thiazole biosynthesis enzyme. This enzyme is invol 85.79
cd0519186 NAD_bind_amino_acid_DH NAD(P) binding domain of am 85.73
TIGR02964246 xanthine_xdhC xanthine dehydrogenase accessory pro 85.7
PRK12842 574 putative succinate dehydrogenase; Reviewed 85.69
PRK07831262 short chain dehydrogenase; Provisional 85.66
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 85.61
TIGR01984382 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T 85.45
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 85.35
PRK11559296 garR tartronate semialdehyde reductase; Provisiona 85.34
PRK00683418 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 85.34
TIGR02441737 fa_ox_alpha_mit fatty acid oxidation complex, alph 85.15
COG1250307 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabo 85.14
COG0654387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and 85.06
PRK07688339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 84.93
COG1893307 ApbA Ketopantoate reductase [Coenzyme metabolism] 84.93
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 84.93
TIGR02032295 GG-red-SF geranylgeranyl reductase family. This mo 84.88
PRK07333403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 84.87
PRK12549284 shikimate 5-dehydrogenase; Reviewed 84.82
PRK10015 429 oxidoreductase; Provisional 84.79
PRK08306296 dipicolinate synthase subunit A; Reviewed 84.66
PRK07843 557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 84.59
PLN02256304 arogenate dehydrogenase 84.48
PTZ00082321 L-lactate dehydrogenase; Provisional 84.46
PRK02006498 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 84.34
TIGR02440699 FadJ fatty oxidation complex, alpha subunit FadJ. 84.22
COG0287279 TyrA Prephenate dehydrogenase [Amino acid transpor 84.21
PRK07045388 putative monooxygenase; Reviewed 84.11
PRK01368454 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 84.05
PRK09078 598 sdhA succinate dehydrogenase flavoprotein subunit; 84.02
PRK06452566 sdhA succinate dehydrogenase flavoprotein subunit; 83.95
PRK08958 588 sdhA succinate dehydrogenase flavoprotein subunit; 83.89
PTZ00142470 6-phosphogluconate dehydrogenase; Provisional 83.86
PRK05714405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 83.84
PRK00066315 ldh L-lactate dehydrogenase; Reviewed 83.79
PRK00421461 murC UDP-N-acetylmuramate--L-alanine ligase; Provi 83.67
PLN02464 627 glycerol-3-phosphate dehydrogenase 83.58
PRK07502307 cyclohexadienyl dehydrogenase; Validated 83.58
>PF00996 GDI: GDP dissociation inhibitor; InterPro: IPR018203 Rab proteins constitute a family of small GTPases that serve a regulatory role in vesicular membrane traffic [, ]; C-terminal geranylgeranylation is crucial for their membrane association and function Back     alignment and domain information
Probab=100.00  E-value=1e-67  Score=532.57  Aligned_cols=373  Identities=35%  Similarity=0.648  Sum_probs=290.2

Q ss_pred             CCCcccEEEECCChhHHHHHHHHhhCCCcEEEEccCCCCCCCccccchhhhhhhhhcCCCCCCCCCCCcccccccccccc
Q 011414           19 EPTAFDLIVIGTGLPESVISAAASASGKSVLHLDPNPFYGSHFSSLSIADLTHFLNSHSTPSSVCPDPLYSDVEISNYAS   98 (486)
Q Consensus        19 ~~~~~DViIIGaGl~GL~aA~~La~~G~~VlvlE~~~~~GG~~~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   98 (486)
                      |+++|||||+|||+.++++|++|+++|++|||+|+|++|||.++|++++++.+|+......                 ..
T Consensus         1 m~~~yDviI~GTGl~esila~als~~GkkVLhiD~n~yYGg~~asl~l~~l~~~~~~~~~~-----------------~~   63 (438)
T PF00996_consen    1 MDEEYDVIILGTGLTESILAAALSRSGKKVLHIDRNDYYGGEWASLNLDQLYEWFRPKQWT-----------------PP   63 (438)
T ss_dssp             --SBESEEEE--SHHHHHHHHHHHHTT--EEEE-SSSSSCGGG-EE-HHHHHHHHCCTCCH-----------------HH
T ss_pred             CCccceEEEECCCcHHHHHHHHHHhcCCEEEecCCCCCcCCchhcccHHHHHHHhhccccc-----------------cc
Confidence            4688999999999999999999999999999999999999999999999998888654210                 00


Q ss_pred             ccccCCCCceEeecCCCEEEecChHHHHHHHhcCcccccchhcccceeeeccCCceeecCCCHHHHhhcccCChHhHHHH
Q 011414           99 RLLSQHPRNFNLDVSGPRVLFCADHAVDLMLKSGASHYLEFKSIDATFMLDADAKLCSVPDSRAAIFKDKSLGLMEKNQL  178 (486)
Q Consensus        99 ~~~~~~~~~~~idl~Gp~ll~~~~~l~~~l~~~~~~~y~ef~~~~~~~~~~~~g~~~~vp~s~~~~f~~~~l~~~~k~~l  178 (486)
                      +.+ ..+|+|+|||. |++++++|+++++|+++++.+|+||+.+++.|+|. +|++++||+++.|+|+++.+++.+||+|
T Consensus        64 ~~~-~~sR~ynIDL~-PKll~a~g~LV~lLi~S~V~rYLEFk~V~~~~v~~-~~~l~kVP~sr~dvf~s~~lsl~eKR~l  140 (438)
T PF00996_consen   64 ESL-GRSRDYNIDLI-PKLLYARGPLVKLLISSGVTRYLEFKAVDGSYVYK-NGKLHKVPCSREDVFKSKLLSLFEKRRL  140 (438)
T ss_dssp             HHH-HTGGGC-EESS---BEETTSHHHHHHHHCTGGGGSEEEEESEEEEEE-TTEEEE--SSHHHHHC-TTS-HHHHHHH
T ss_pred             ccc-ccccceeEecc-hHhhhccCHHHHHHHhCCcccceEEEEcceeEEEe-CCEEeeCCCCHHHhhcCCCccHHHHHHH
Confidence            122 36799999998 99999999999999999999999999999999986 8999999999999999999999999999


Q ss_pred             HHHHHHHHhhcccCccccccccccccccCCcHHHHHHhcCCChHHHHHHHHHHhhccCCchhhhhhhchhhHHHHHHHHH
Q 011414          179 MRFFKLVQGHLSLDESEENNVRISEEDLDSPFAEFLTKMKLPHKIKSIVLYAIAMADYDQEVSEYVLKTRDGINRLALYN  258 (486)
Q Consensus       179 ~~fl~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~l~~~~l~~~l~~~l~~~i~~~~~~~~~~~~~~s~~~~l~~~~~~~  258 (486)
                      |||++++.++....+...   + ..+...+++.+++++|++++.+++++.|++++...+...   ..++.+++.++++|+
T Consensus       141 mkFl~~v~~~~~~~~~~~---~-~~~~~~~~~~e~~~~f~L~~~~~~~i~haiaL~~~~~~~---~~p~~~~l~ri~~yl  213 (438)
T PF00996_consen  141 MKFLKFVANYEEDDPSTH---K-GLDPEKKTFQELLKKFGLSENLIDFIGHAIALSLDDSYL---TEPAREGLERIKLYL  213 (438)
T ss_dssp             HHHHHHHHHGCTTBGGGS---T-TG-TTTSBHHHHHHHTTS-HHHHHHHHHHTS-SSSSGGG---GSBSHHHHHHHHHHH
T ss_pred             HHHHHHHhhcccCCcchh---h-ccccccccHHHHHHhcCCCHHHHHHHHHhhhhccCcccc---cccHHHHHHHHHHHH
Confidence            999999988754322110   1 113446899999999999999999999999886432211   126788999999999


Q ss_pred             HhhhcccCCCcceEeecCCcchHHHHHHHHHHHcCcEEEeCCceeEEEEecCCCeEEEEEeCCCcEEEcCEEEECCCCCC
Q 011414          259 SSIGRFQNALGALIYPIYGQGELPQAFCRRAAVKGCLYVLRMPVISLLTDQNSGSYKGVRLASGQDILSHKLVLDPSFTV  338 (486)
Q Consensus       259 ~s~g~~g~~~g~~~~p~gG~~~L~qal~r~~~~~Gg~i~l~~~V~~I~~~~~~g~~~gV~~~~G~~i~A~~VI~~p~~~~  338 (486)
                      .|+|+||++  +|+||+||.|||+|+|||++|+.||+|+||++|++|..++ +|++.+|+ ++|++++|++||++|.|. 
T Consensus       214 ~SlgryG~s--PfLyP~YG~GELpQ~FcRl~AV~GG~Y~L~~~i~~i~~~~-~g~~~gV~-s~ge~v~~k~vI~dpsy~-  288 (438)
T PF00996_consen  214 SSLGRYGKS--PFLYPLYGLGELPQAFCRLSAVYGGTYMLNRPIDEIVVDE-DGKVIGVK-SEGEVVKAKKVIGDPSYL-  288 (438)
T ss_dssp             HHHCCCSSS--SEEEETT-TTHHHHHHHHHHHHTT-EEESS--EEEEEEET-TTEEEEEE-ETTEEEEESEEEEEGGGB-
T ss_pred             HHHhccCCC--CEEEEccCCccHHHHHHHHhhhcCcEEEeCCccceeeeec-CCeEEEEe-cCCEEEEcCEEEECCccC-
Confidence            999999986  4999999999999999999999999999999999999974 68899997 599999999999999886 


Q ss_pred             CCCCcccchhhhhhhhhhccCCCcceEEEEEEEecCCCCCCC--CceEEEeCCCCCCCCCCceEEEEEeCCCCccCCCCe
Q 011414          339 PGSLASSHQQLQESFQAFSLSDNKGKVARGICITRSSLKPDL--SNFLVIFPPRSLFPEQVTSIRVLQLGGNLAVCPLGM  416 (486)
Q Consensus       339 ~~l~~~~~~~l~~~~~~l~~~~~~~~v~r~i~i~~~~~~~~~--~~~~~~~p~~~~~~~~~~~v~v~~~~~~~~~~P~G~  416 (486)
                      ++-.                 ...++++|+|+|+++|+....  ...++++|+.+.+  ..++||++++|+++++||+|+
T Consensus       289 p~~v-----------------~~~~~V~RaI~Il~~pi~~t~~~~s~~IiiP~~~~~--~~~dIyv~~~ss~~~~CP~G~  349 (438)
T PF00996_consen  289 PEKV-----------------KKTGQVSRAICILDHPIPNTEDASSVQIIIPQSQVG--RKSDIYVLQLSSSTGVCPKGQ  349 (438)
T ss_dssp             GCGE-----------------EEEEEEEEEEEEESS-STTSTT-SSEEEEE-GGGCT--SSS-EEEEEEEGGGTSS-TT-
T ss_pred             cccc-----------------cccceEEEEEEEEcCCCCCCCCCceEEEecCCcccC--CCCCeEEEEECCCccccCCCc
Confidence            3211                 124579999999999998643  3567779987654  356799999999999999999


Q ss_pred             EEEEEEEeeccCcchHHHHHHHHHHHH
Q 011414          417 FVLYFSALCDEVNQGKKLLHAALSALQ  443 (486)
Q Consensus       417 ~vi~~~t~~~~~~~~~~~l~~~~~~l~  443 (486)
                      ||+|+||..++ .+++++|+++++.|-
T Consensus       350 yi~~~St~~~t-~~p~~eL~~~l~lL~  375 (438)
T PF00996_consen  350 YIAYVSTTVET-SNPEEELEPALELLG  375 (438)
T ss_dssp             EEEEEEEEE-S-S-HHHHTHHHHHTT-
T ss_pred             EEEEEEeccCC-CCcHHHHHHHHHhhc
Confidence            99999998765 588999999998554



This post-translational modification is catalysed by Rab geranylgeranyl transferase (Rab-GGTase), a multi-subunit enzyme that contains a catalytic heterodimer and an accessory component, termed Rab escort protein (REP)-1 []. REP-1 presents newly- synthesised Rab proteins to the catalytic component, and forms a stable complex with the prenylated proteins following the transfer reaction. The mechanism of REP-1-mediated membrane association of Rab5 is similar to that mediated by Rab GDP dissociation inhibitor (GDI). REP-1 and Rab GDI also share other functional properties, including the ability to inhibit the release of GDP and to remove Rab proteins from membranes. The crystal structure of the bovine alpha-isoform of Rab GDI has been determined to a resolution of 1.81A []. The protein is composed of two main structural units: a large complex multi-sheet domain I, and a smaller alpha-helical domain II. The structural organisation of domain I is closely related to FAD-containing monooxygenases and oxidases []. Conserved regions common to GDI and the choroideraemia gene product, which delivers Rab to catalytic subunits of Rab geranylgeranyltransferase II, are clustered on one face of the domain []. The two most conserved regions form a compact structure at the apex of the molecule; site-directed mutagenesis has shown these regions to play a critical role in the binding of Rab proteins [].; PDB: 1VG9_C 1VG0_A 1LTX_R 3P1W_A 3CPH_H 3CPJ_G 3CPI_H 1UKV_G 2BCG_G 1GND_A ....

>KOG4405 consensus GDP dissociation inhibitor [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PTZ00363 rab-GDP dissociation inhibitor; Provisional Back     alignment and domain information
>KOG1439 consensus RAB proteins geranylgeranyltransferase component A (RAB escort protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5044 MRS6 RAB proteins geranylgeranyltransferase component A (RAB escort protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02734 crtI_fam phytoene desaturase Back     alignment and domain information
>COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR02733 desat_CrtD C-3',4' desaturase CrtD Back     alignment and domain information
>TIGR02730 carot_isom carotene isomerase Back     alignment and domain information
>TIGR00562 proto_IX_ox protoporphyrinogen oxidase Back     alignment and domain information
>PLN02576 protoporphyrinogen oxidase Back     alignment and domain information
>PRK07233 hypothetical protein; Provisional Back     alignment and domain information
>PRK12416 protoporphyrinogen oxidase; Provisional Back     alignment and domain information
>PRK11883 protoporphyrinogen oxidase; Reviewed Back     alignment and domain information
>COG1232 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] Back     alignment and domain information
>PRK07208 hypothetical protein; Provisional Back     alignment and domain information
>PLN02612 phytoene desaturase Back     alignment and domain information
>TIGR02731 phytoene_desat phytoene desaturase Back     alignment and domain information
>TIGR02732 zeta_caro_desat carotene 7,8-desaturase Back     alignment and domain information
>PLN02487 zeta-carotene desaturase Back     alignment and domain information
>KOG4254 consensus Phytoene desaturase [Coenzyme transport and metabolism] Back     alignment and domain information
>PLN02268 probable polyamine oxidase Back     alignment and domain information
>TIGR03467 HpnE squalene-associated FAD-dependent desaturase Back     alignment and domain information
>PLN02529 lysine-specific histone demethylase 1 Back     alignment and domain information
>PLN02676 polyamine oxidase Back     alignment and domain information
>PLN02568 polyamine oxidase Back     alignment and domain information
>PLN02328 lysine-specific histone demethylase 1 homolog Back     alignment and domain information
>PLN03000 amine oxidase Back     alignment and domain information
>COG1231 Monoamine oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13977 myosin-cross-reactive antigen; Provisional Back     alignment and domain information
>KOG1276 consensus Protoporphyrinogen oxidase [Coenzyme transport and metabolism] Back     alignment and domain information
>PLN02976 amine oxidase Back     alignment and domain information
>KOG0029 consensus Amine oxidase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PF01593 Amino_oxidase: Flavin containing amine oxidoreductase This is a subset of the Pfam family; InterPro: IPR002937 This entry consists of various amine oxidases, including maize polyamine oxidase (PAO) [], L-amino acid oxidases (LAO) and various flavin containing monoamine oxidases (MAO) Back     alignment and domain information
>COG2907 Predicted NAD/FAD-binding protein [General function prediction only] Back     alignment and domain information
>KOG0685 consensus Flavin-containing amine oxidase [Coenzyme transport and metabolism] Back     alignment and domain information
>COG3349 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG2081 Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>TIGR00031 UDP-GALP_mutase UDP-galactopyranose mutase Back     alignment and domain information
>PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G Back     alignment and domain information
>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases Back     alignment and domain information
>COG0579 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PRK11728 hydroxyglutarate oxidase; Provisional Back     alignment and domain information
>COG0562 Glf UDP-galactopyranose mutase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase Back     alignment and domain information
>TIGR01377 soxA_mon sarcosine oxidase, monomeric form Back     alignment and domain information
>PRK08274 tricarballylate dehydrogenase; Validated Back     alignment and domain information
>PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional Back     alignment and domain information
>PRK11259 solA N-methyltryptophan oxidase; Provisional Back     alignment and domain information
>PRK00711 D-amino acid dehydrogenase small subunit; Validated Back     alignment and domain information
>PRK12845 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>PRK06481 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information
>PF01946 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K Back     alignment and domain information
>COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form Back     alignment and domain information
>KOG2820 consensus FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>PTZ00383 malate:quinone oxidoreductase; Provisional Back     alignment and domain information
>COG0578 GlpA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>PF06100 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross-reactive antigen like family ; InterPro: IPR010354 Members of this family are thought to have structural features in common with the beta chain of the class II antigens, as well as myosin, and may play an important role in the pathogenesis [] Back     alignment and domain information
>TIGR00292 thiazole biosynthesis enzyme Back     alignment and domain information
>PRK10157 putative oxidoreductase FixC; Provisional Back     alignment and domain information
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>PRK10015 oxidoreductase; Provisional Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>PRK07121 hypothetical protein; Validated Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>TIGR00275 flavoprotein, HI0933 family Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PLN00093 geranylgeranyl diphosphate reductase; Provisional Back     alignment and domain information
>PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>TIGR02485 CobZ_N-term precorrin 3B synthase CobZ Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR02032 GG-red-SF geranylgeranyl reductase family Back     alignment and domain information
>PRK13369 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>PRK08013 oxidoreductase; Provisional Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit Back     alignment and domain information
>KOG2844 consensus Dimethylglycine dehydrogenase precursor [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>PLN02463 lycopene beta cyclase Back     alignment and domain information
>PRK07045 putative monooxygenase; Reviewed Back     alignment and domain information
>PF00890 FAD_binding_2: FAD binding domain of the Pfam family Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>PRK06184 hypothetical protein; Provisional Back     alignment and domain information
>COG3573 Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed Back     alignment and domain information
>TIGR02023 BchP-ChlP geranylgeranyl reductase Back     alignment and domain information
>PLN02661 Putative thiazole synthesis Back     alignment and domain information
>PF00732 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR000172 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ] Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>TIGR02028 ChlP geranylgeranyl reductase Back     alignment and domain information
>PRK12837 3-ketosteroid-delta-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK12834 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>TIGR01813 flavo_cyto_c flavocytochrome c Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK12842 putative succinate dehydrogenase; Reviewed Back     alignment and domain information
>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>PRK06185 hypothetical protein; Provisional Back     alignment and domain information
>PRK06834 hypothetical protein; Provisional Back     alignment and domain information
>KOG1399 consensus Flavin-containing monooxygenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02985 squalene monooxygenase Back     alignment and domain information
>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] Back     alignment and domain information
>TIGR01790 carotene-cycl lycopene cyclase family protein Back     alignment and domain information
>TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364 Back     alignment and domain information
>KOG1298 consensus Squalene monooxygenase [Lipid transport and metabolism] Back     alignment and domain information
>PRK07190 hypothetical protein; Provisional Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>PLN02697 lycopene epsilon cyclase Back     alignment and domain information
>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase Back     alignment and domain information
>PLN02464 glycerol-3-phosphate dehydrogenase Back     alignment and domain information
>PRK12844 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PTZ00367 squalene epoxidase; Provisional Back     alignment and domain information
>PRK07057 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>PF04820 Trp_halogenase: Tryptophan halogenase; InterPro: IPR006905 Tryptophan halogenase catalyses the chlorination of tryptophan to form 7-chlorotryptophan Back     alignment and domain information
>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>PRK12835 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK06126 hypothetical protein; Provisional Back     alignment and domain information
>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK07843 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>PRK12839 hypothetical protein; Provisional Back     alignment and domain information
>PRK08641 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07803 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK08958 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07804 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK08244 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6 Back     alignment and domain information
>PTZ00306 NADH-dependent fumarate reductase; Provisional Back     alignment and domain information
>PRK08132 FAD-dependent oxidoreductase; Provisional Back     alignment and domain information
>PRK05257 malate:quinone oxidoreductase; Validated Back     alignment and domain information
>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>PRK09078 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK11445 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>PRK07538 hypothetical protein; Provisional Back     alignment and domain information
>PTZ00139 Succinate dehydrogenase [ubiquinone] flavoprotein subunit; Provisional Back     alignment and domain information
>TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>TIGR01789 lycopene_cycl lycopene cyclase Back     alignment and domain information
>PRK07395 L-aspartate oxidase; Provisional Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>PRK02106 choline dehydrogenase; Validated Back     alignment and domain information
>PRK06134 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>PRK06175 L-aspartate oxidase; Provisional Back     alignment and domain information
>KOG2614 consensus Kynurenine 3-monooxygenase and related flavoprotein monooxygenases [Energy production and conversion; General function prediction only] Back     alignment and domain information
>PLN00128 Succinate dehydrogenase [ubiquinone] flavoprotein subunit Back     alignment and domain information
>PRK07588 hypothetical protein; Provisional Back     alignment and domain information
>PRK07573 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins Back     alignment and domain information
>PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08626 fumarate reductase flavoprotein subunit; Provisional Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>PRK05868 hypothetical protein; Validated Back     alignment and domain information
>PRK06069 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>TIGR02462 pyranose_ox pyranose oxidase Back     alignment and domain information
>PLN02815 L-aspartate oxidase Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed Back     alignment and domain information
>TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>PRK12843 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK13339 malate:quinone oxidoreductase; Reviewed Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>PRK08294 phenol 2-monooxygenase; Provisional Back     alignment and domain information
>PRK06475 salicylate hydroxylase; Provisional Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>TIGR00137 gid_trmFO tRNA:m(5)U-54 methyltransferase Back     alignment and domain information
>PLN02852 ferredoxin-NADP+ reductase Back     alignment and domain information
>TIGR00551 nadB L-aspartate oxidase Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>PRK06996 hypothetical protein; Provisional Back     alignment and domain information
>PRK08071 L-aspartate oxidase; Provisional Back     alignment and domain information
>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria Back     alignment and domain information
>PRK06854 adenylylsulfate reductase subunit alpha; Validated Back     alignment and domain information
>PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase Back     alignment and domain information
>PF06039 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro: IPR006231 The membrane-associated enzyme, malate:quinone-oxidoreductase, is an alternative to the better-known NAD-dependent malate dehydrogenase as part of the TCA cycle Back     alignment and domain information
>KOG2853 consensus Possible oxidoreductase [General function prediction only] Back     alignment and domain information
>TIGR03219 salicylate_mono salicylate 1-monooxygenase Back     alignment and domain information
>COG1053 SdhA Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>PRK09231 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PRK06263 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08275 putative oxidoreductase; Provisional Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>COG3075 GlpB Anaerobic glycerol-3-phosphate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>PRK08205 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>KOG2415 consensus Electron transfer flavoprotein ubiquinone oxidoreductase [Energy production and conversion] Back     alignment and domain information
>COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>TIGR01176 fum_red_Fp fumarate reductase, flavoprotein subunit Back     alignment and domain information
>PRK09077 L-aspartate oxidase; Provisional Back     alignment and domain information
>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>PRK08401 L-aspartate oxidase; Provisional Back     alignment and domain information
>COG2303 BetA Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism] Back     alignment and domain information
>PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>KOG0399 consensus Glutamate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PLN02785 Protein HOTHEAD Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated Back     alignment and domain information
>KOG1335 consensus Dihydrolipoamide dehydrogenase [Energy production and conversion] Back     alignment and domain information
>TIGR00136 gidA glucose-inhibited division protein A Back     alignment and domain information
>TIGR01810 betA choline dehydrogenase Back     alignment and domain information
>PTZ00188 adrenodoxin reductase; Provisional Back     alignment and domain information
>TIGR02061 aprA adenosine phosphosulphate reductase, alpha subunit Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>PRK07512 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>TIGR01811 sdhA_Bsu succinate dehydrogenase or fumarate reductase, flavoprotein subunit, Bacillus subtilis subgroup Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>COG0445 GidA Flavin-dependent tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG4716 Myosin-crossreactive antigen [Function unknown] Back     alignment and domain information
>KOG2665 consensus Predicted FAD-dependent oxidoreductase [Function unknown] Back     alignment and domain information
>KOG1238 consensus Glucose dehydrogenase/choline dehydrogenase/mandelonitrile lyase (GMC oxidoreductase family) [General function prediction only] Back     alignment and domain information
>KOG2311 consensus NAD/FAD-utilizing protein possibly involved in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0029 NadB Aspartate oxidase [Coenzyme metabolism] Back     alignment and domain information
>KOG2404 consensus Fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>PRK09897 hypothetical protein; Provisional Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>KOG4716 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2960 consensus Protein involved in thiamine biosynthesis and DNA damage tolerance [General function prediction only] Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>TIGR02352 thiamin_ThiO glycine oxidase ThiO Back     alignment and domain information
>KOG0405 consensus Pyridine nucleotide-disulphide oxidoreductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG1206 Gid NAD(FAD)-utilizing enzyme possibly involved in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG3855 consensus Monooxygenase involved in coenzyme Q (ubiquinone) biosynthesis [Coenzyme transport and metabolism; Energy production and conversion] Back     alignment and domain information
>KOG0042 consensus Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>PF13454 NAD_binding_9: FAD-NAD(P)-binding Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>KOG2852 consensus Possible oxidoreductase [General function prediction only] Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>KOG1800 consensus Ferredoxin/adrenodoxin reductase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR03197 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouridine biosynthesis protein MnmC, C-terminal domain Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>COG4529 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>PF07156 Prenylcys_lyase: Prenylcysteine lyase; InterPro: IPR010795 This entry represents a conserved region found in a group of prenylcysteine lyases (1 Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK06249 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>TIGR03377 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase, anaerobic, A subunit Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins Back     alignment and domain information
>TIGR03862 flavo_PP4765 uncharacterized flavoprotein, PP_4765 family Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase Back     alignment and domain information
>PF00890 FAD_binding_2: FAD binding domain of the Pfam family Back     alignment and domain information
>PRK05257 malate:quinone oxidoreductase; Validated Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>KOG0404 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>PRK05708 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>PRK12921 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK08229 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PLN02545 3-hydroxybutyryl-CoA dehydrogenase Back     alignment and domain information
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK06134 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>PLN02353 probable UDP-glucose 6-dehydrogenase Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>PF13478 XdhC_C: XdhC Rossmann domain; PDB: 3ON5_A 2WE8_B 2WE7_A Back     alignment and domain information
>PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>KOG3851 consensus Sulfide:quinone oxidoreductase/flavo-binding protein [Energy production and conversion] Back     alignment and domain information
>COG3486 IucD Lysine/ornithine N-monooxygenase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK07417 arogenate dehydrogenase; Reviewed Back     alignment and domain information
>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria Back     alignment and domain information
>PRK07121 hypothetical protein; Validated Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01816 sdhA_forward succinate dehydrogenase, flavoprotein subunit, E Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK12843 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>PRK15057 UDP-glucose 6-dehydrogenase; Provisional Back     alignment and domain information
>PRK13339 malate:quinone oxidoreductase; Reviewed Back     alignment and domain information
>PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>PRK04308 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>KOG3923 consensus D-aspartate oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>KOG2304 consensus 3-hydroxyacyl-CoA dehydrogenase [Lipid transport and metabolism] Back     alignment and domain information
>TIGR01915 npdG NADPH-dependent F420 reductase Back     alignment and domain information
>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>PRK10157 putative oxidoreductase FixC; Provisional Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>PRK04690 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK15116 sulfur acceptor protein CsdL; Provisional Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd01339 LDH-like_MDH L-lactate dehydrogenase-like malate dehydrogenase proteins Back     alignment and domain information
>PRK03803 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK08268 3-hydroxy-acyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK06175 L-aspartate oxidase; Provisional Back     alignment and domain information
>TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase Back     alignment and domain information
>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG0771 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>PLN02695 GDP-D-mannose-3',5'-epimerase Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>TIGR02437 FadB fatty oxidation complex, alpha subunit FadB Back     alignment and domain information
>PRK06223 malate dehydrogenase; Reviewed Back     alignment and domain information
>PRK15461 NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK12835 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01813 flavo_cyto_c flavocytochrome c Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>PRK12844 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK05675 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup Back     alignment and domain information
>TIGR00292 thiazole biosynthesis enzyme Back     alignment and domain information
>cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins Back     alignment and domain information
>TIGR02964 xanthine_xdhC xanthine dehydrogenase accessory protein XdhC Back     alignment and domain information
>PRK12842 putative succinate dehydrogenase; Reviewed Back     alignment and domain information
>PRK07831 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>PRK11559 garR tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>PRK00683 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR02441 fa_ox_alpha_mit fatty acid oxidation complex, alpha subunit, mitochondrial Back     alignment and domain information
>COG1250 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabolism] Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>COG1893 ApbA Ketopantoate reductase [Coenzyme metabolism] Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>TIGR02032 GG-red-SF geranylgeranyl reductase family Back     alignment and domain information
>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK10015 oxidoreductase; Provisional Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>PRK07843 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PLN02256 arogenate dehydrogenase Back     alignment and domain information
>PTZ00082 L-lactate dehydrogenase; Provisional Back     alignment and domain information
>PRK02006 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR02440 FadJ fatty oxidation complex, alpha subunit FadJ Back     alignment and domain information
>COG0287 TyrA Prephenate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07045 putative monooxygenase; Reviewed Back     alignment and domain information
>PRK01368 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK09078 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08958 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PTZ00142 6-phosphogluconate dehydrogenase; Provisional Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK00066 ldh L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>PRK00421 murC UDP-N-acetylmuramate--L-alanine ligase; Provisional Back     alignment and domain information
>PLN02464 glycerol-3-phosphate dehydrogenase Back     alignment and domain information
>PRK07502 cyclohexadienyl dehydrogenase; Validated Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query486
1ltx_R650 Structure Of Rab Escort Protein-1 In Complex With R 6e-31
1vg0_A650 The Crystal Structures Of The Rep-1 Protein In Comp 1e-30
1d5t_A433 Guanine Nucleotide Dissociation Inhibitor, Alpha-Is 6e-30
1lv0_A449 Crystal Structure Of The Rab Effector Guanine Nucle 7e-30
1gnd_A447 Guanine Nucleotide Dissociation Inhibitor, Alpha-Is 7e-30
1ukv_G453 Structure Of Rabgdp-Dissociation Inhibitor In Compl 2e-29
3cph_G451 Crystal Structure Of Sec4 In Complex With Rab-Gdi L 3e-29
3p1w_A475 Crystal Structure Of Rab Gdi From Plasmodium Falcip 9e-23
>pdb|1LTX|R Chain R, Structure Of Rab Escort Protein-1 In Complex With Rab Geranylgeranyl Transferase And Isoprenoid Length = 650 Back     alignment and structure

Iteration: 1

Score = 132 bits (331), Expect = 6e-31, Method: Compositional matrix adjust. Identities = 107/371 (28%), Positives = 168/371 (45%), Gaps = 45/371 (12%) Query: 106 RNFNLDVSGPRVLFCADHAVDLMLKSGASHYLEFKSIDATFMLDADAKLCSVPDSRAAIF 165 R FN+D+ ++L+ +DL++KS S Y EFK+I + + VP SRA +F Sbjct: 222 RRFNIDLVS-KLLYSRGLLIDLLIKSNVSRYAEFKNITRILAF-REGTVEQVPCSRADVF 279 Query: 166 KDKSLGLMEKNQLMRFFKLVQGHLSLDESEENNVRISEEDLDSPFAEFLTKMKLPHKIKS 225 K L ++EK LM+F + E + R E + F+E+L KL ++ Sbjct: 280 NSKQLTMVEKRMLMKFLTFCVEY----EEHPDEYRAYE---GTTFSEYLKTQKLTPNLQY 332 Query: 226 IVLYAIAMADYDQEVSEYVLKTRDGINRLALYNSSIGRFQNALGALIYPIYGQGELPQAF 285 VL++IAM SE T DG+ + +GR+ N ++P+YGQGELPQ F Sbjct: 333 FVLHSIAM------TSETTSCTVDGLKATKKFLQCLGRYGNT--PFLFPLYGQGELPQCF 384 Query: 286 CRRAAVKGCLYVLRMPVISLLTDQNSGSYKGVRLASGQDILSHKLVLDPSFTVPGSLASS 345 CR AV G +Y LR V L+ D+ S K V GQ I+S +++ S+ + + Sbjct: 385 CRMCAVFGGIYCLRHSVQCLVVDKESRKCKAVIDQFGQRIISKHFIIEDSYLSENTCSRV 444 Query: 346 HQQLQESFQAFSLSDNKGKVARGICITRSS-LKPDLSNFLVIFPPRSLFPEQVTSIRVLQ 404 + +++R + IT S LK D + I + P ++RV++ Sbjct: 445 QYR---------------QISRAVLITDGSVLKTDADQQVSILTVPAEEPGSF-AVRVIE 488 Query: 405 LGGNLAVCPLGMFVLYFSALCDEVNQGKKLLHAALSALQKLLVTGTAGNSSTAQSEDMEE 464 L + C G ++++ + + K +QKL T + Q E Sbjct: 489 LCSSTMTCMKGTYLVHLTCM-----SSKTAREDLERVVQKLFTPYTEIEAENEQVE---- 539 Query: 465 AKPTLLWSALY 475 KP LLW ALY Sbjct: 540 -KPRLLW-ALY 548
>pdb|1VG0|A Chain A, The Crystal Structures Of The Rep-1 Protein In Complex With Monoprenylated Rab7 Protein Length = 650 Back     alignment and structure
>pdb|1D5T|A Chain A, Guanine Nucleotide Dissociation Inhibitor, Alpha-Isoform Length = 433 Back     alignment and structure
>pdb|1LV0|A Chain A, Crystal Structure Of The Rab Effector Guanine Nucleotide Dissociation Inhibitor (Gdi) In Complex With A Geranylgeranyl (Gg) Peptide Length = 449 Back     alignment and structure
>pdb|1GND|A Chain A, Guanine Nucleotide Dissociation Inhibitor, Alpha-Isoform Length = 447 Back     alignment and structure
>pdb|1UKV|G Chain G, Structure Of Rabgdp-Dissociation Inhibitor In Complex With Prenylated Ypt1 Gtpase Length = 453 Back     alignment and structure
>pdb|3CPH|G Chain G, Crystal Structure Of Sec4 In Complex With Rab-Gdi Length = 451 Back     alignment and structure
>pdb|3P1W|A Chain A, Crystal Structure Of Rab Gdi From Plasmodium Falciparum, Pfl2060c Length = 475 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query486
2bcg_G453 Secretory pathway GDP dissociation inhibitor; RABG 6e-81
3p1w_A475 Rabgdi protein; GDI RAB, malaria, structural genom 1e-76
1vg0_A650 RAB proteins geranylgeranyltransferase component A 4e-74
1vg0_A 650 RAB proteins geranylgeranyltransferase component A 1e-15
1d5t_A433 Guanine nucleotide dissociation inhibitor; ultra-h 3e-70
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-08
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Length = 453 Back     alignment and structure
 Score =  257 bits (658), Expect = 6e-81
 Identities = 93/428 (21%), Positives = 177/428 (41%), Gaps = 49/428 (11%)

Query: 20  PTAFDLIVIGTGLPESVISAAASASGKSVLHLDPNPFYGSHFSSLSIADLTHFLNSHSTP 79
            T +D+IV+GTG+ E ++S   S  GK VLH+D    YG   +S++++ L      +   
Sbjct: 9   DTDYDVIVLGTGITECILSGLLSVDGKKVLHIDKQDHYGGEAASVTLSQLYEKFKQNPIS 68

Query: 80  SSVCPDPLYSDVEISNYASRLLSQHPRNFNLDVSGPRVLFCADHAVDLMLKSGASHYLEF 139
                                     R++N+D+  P+ L       ++++ +  + Y++F
Sbjct: 69  KEERESKFG---------------KDRDWNVDL-IPKFLMANGELTNILIHTDVTRYVDF 112

Query: 140 KSIDATFMLDADAKLCSVPDSRAAIFKDKSLGLMEKNQLMRFFKLVQGHLSLDESEENNV 199
           K +  +++     K+  VP +         +G+ EK ++ +F + +  +   D S    +
Sbjct: 113 KQVSGSYVFK-QGKIYKVPANEIEAISSPLMGIFEKRRMKKFLEWISSYKEDDLSTHQGL 171

Query: 200 RISEEDLDSPFAEFLTKMKLPHKIKSIVLYAIAMADYDQEVSEYVLKTRDGINRLALYNS 259
            + +        E   K  L +  K  + +A+A+   D  + +     R    R+ LY  
Sbjct: 172 DLDKN----TMDEVYYKFGLGNSTKEFIGHAMALWTNDDYLQQ---PARPSFERILLYCQ 224

Query: 260 SIGRFQNALGALIYPIYGQGELPQAFCRRAAVKGCLYVLRMPVISLLTDQNSGSYKGVRL 319
           S+ R+       +YP+YG GELPQ F R +A+ G  Y+L  P+  +L  +++G ++GV+ 
Sbjct: 225 SVARYGK--SPYLYPMYGLGELPQGFARLSAIYGGTYMLDTPIDEVLYKKDTGKFEGVK- 281

Query: 320 ASGQDILSHKLVLDPSFTVPGSLASSHQQLQESFQAFSLSDNKGKVARGICITRSSLKP- 378
                  +  ++ DP++  P    S+ Q                +V R ICI    +   
Sbjct: 282 TKLGTFKAPLVIADPTY-FPEKCKSTGQ----------------RVIRAICILNHPVPNT 324

Query: 379 -DLSNFLVIFPPRSLFPEQVTSIRVLQLGGNLAVCPLGMFVLYFSALCDEVNQGKKLLHA 437
            +  +  +I P   L  +    I V  +     VC  G ++   S    E ++    L  
Sbjct: 325 SNADSLQIIIPQSQLGRKS--DIYVAIVSDAHNVCSKGHYLAIIST-IIETDKPHIELEP 381

Query: 438 ALSALQKL 445
           A   L  +
Sbjct: 382 AFKLLGPI 389


>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} Length = 475 Back     alignment and structure
>1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R* Length = 650 Back     alignment and structure
>1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R* Length = 650 Back     alignment and structure
>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Length = 433 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query486
1vg0_A650 RAB proteins geranylgeranyltransferase component A 100.0
3p1w_A475 Rabgdi protein; GDI RAB, malaria, structural genom 100.0
2bcg_G453 Secretory pathway GDP dissociation inhibitor; RABG 100.0
1d5t_A433 Guanine nucleotide dissociation inhibitor; ultra-h 100.0
4dgk_A501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 100.0
3nrn_A421 Uncharacterized protein PF1083; alpha-beta protein 99.93
3ka7_A425 Oxidoreductase; structural genomics, PSI-2, protei 99.93
2ivd_A478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 99.92
1s3e_A 520 Amine oxidase [flavin-containing] B; human monoami 99.91
2yg5_A453 Putrescine oxidase; oxidoreductase, flavin; HET: F 99.9
3i6d_A470 Protoporphyrinogen oxidase; protein-inhibitor comp 99.9
3lov_A475 Protoporphyrinogen oxidase; structural genomics, J 99.89
3nks_A477 Protoporphyrinogen oxidase; FAD containing protein 99.89
1sez_A504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 99.89
4gde_A513 UDP-galactopyranose mutase; flavin adenine dinucle 99.89
2vvm_A495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 99.88
4dsg_A484 UDP-galactopyranose mutase; rossmann fold, flavin 99.84
1rsg_A 516 FMS1 protein; FAD binding motif, oxidoreductase; H 99.81
1b37_A472 Protein (polyamine oxidase); flavin-dependent amin 99.78
3k7m_X431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 99.78
2iid_A498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 99.75
2b9w_A424 Putative aminooxidase; isomerase, conjugated linol 99.75
2jae_A489 L-amino acid oxidase; oxidoreductase, dimerisation 99.74
3hdq_A397 UDP-galactopyranose mutase; substrate and inhibito 99.64
1v0j_A399 UDP-galactopyranose mutase; flavoprotein, isomeras 99.64
2e1m_A376 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 99.63
1i8t_A367 UDP-galactopyranose mutase; rossman fold, FAD, con 99.61
4gut_A776 Lysine-specific histone demethylase 1B; histone de 99.58
2bi7_A384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 99.57
2z3y_A662 Lysine-specific histone demethylase 1; chromatin, 99.51
2xag_A852 Lysine-specific histone demethylase 1; amine oxida 99.51
3ayj_A 721 Pro-enzyme of L-phenylalanine oxidase; amino acid 99.46
3qj4_A342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 99.45
3dme_A369 Conserved exported protein; structural genomics, P 99.24
3dje_A438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 99.2
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 99.12
3ps9_A676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 99.12
3nyc_A381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 99.11
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 99.06
4at0_A510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 99.05
3v76_A417 Flavoprotein; structural genomics, PSI-biology, NE 99.03
3pvc_A689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 99.03
1y56_B382 Sarcosine oxidase; dehydrogenase, protein-protein 99.02
2gag_B405 Heterotetrameric sarcosine oxidase beta-subunit; f 99.01
2i0z_A 447 NAD(FAD)-utilizing dehydrogenases; structural geno 98.99
1y0p_A 571 Fumarate reductase flavoprotein subunit; flavocyto 98.98
1qo8_A 566 Flavocytochrome C3 fumarate reductase; oxidoreduct 98.97
3nlc_A 549 Uncharacterized protein VP0956; FAD-binding protei 98.93
1pj5_A 830 N,N-dimethylglycine oxidase; channelling, FAD bind 98.87
3oz2_A397 Digeranylgeranylglycerophospholipid reductase; str 98.79
1d4d_A 572 Flavocytochrome C fumarate reductase; oxidoreducta 98.77
3fpz_A326 Thiazole biosynthetic enzyme; FAD, mitochondrion, 98.62
4fk1_A304 Putative thioredoxin reductase; structural genomic 98.56
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 98.54
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 98.53
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 98.46
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 98.46
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 98.44
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 98.43
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 98.43
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 98.42
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 98.41
2gjc_A326 Thiazole biosynthetic enzyme, mitochondrial; gluta 98.41
2gqf_A401 Hypothetical protein HI0933; structural genomics, 98.4
2oln_A397 NIKD protein; flavoprotein, rossmann fold, oxidore 98.39
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 98.38
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 98.38
3da1_A 561 Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 98.37
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 98.37
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 98.36
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 98.35
3l8k_A466 Dihydrolipoyl dehydrogenase; redox-active center, 98.34
4ap3_A549 Steroid monooxygenase; oxidoreductase, baeyer-vill 98.34
3rp8_A407 Flavoprotein monooxygenase; FAD-binding protein, o 98.34
1c0p_A363 D-amino acid oxidase; alpha-beta-alpha motif, flav 98.33
2uzz_A372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 98.32
3c96_A410 Flavin-containing monooxygenase; FAD, oxidoreducta 98.32
3nix_A 421 Flavoprotein/dehydrogenase; structural genomics, P 98.3
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 98.29
2qcu_A 501 Aerobic glycerol-3-phosphate dehydrogenase; glycer 98.29
2xdo_A398 TETX2 protein; tetracycline degradation, tigecycli 98.28
4dna_A463 Probable glutathione reductase; structural genomic 98.28
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 98.28
1w4x_A542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 98.27
2gf3_A389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 98.27
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 98.27
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 98.26
3alj_A379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 98.26
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 98.26
2cul_A232 Glucose-inhibited division protein A-related PROT 98.25
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 98.24
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 98.24
3axb_A448 Putative oxidoreductase; dinucleotide-binding fold 98.24
2vou_A397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 98.23
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 98.23
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 98.23
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 98.23
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 98.22
3r9u_A315 Thioredoxin reductase; structural genomics, center 98.21
3i3l_A 591 Alkylhalidase CMLS; flavin-dependent halogenase, c 98.21
3uox_A545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 98.18
3gwf_A540 Cyclohexanone monooxygenase; flavoprotein biocatal 98.18
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 98.18
3c4n_A405 Uncharacterized protein DR_0571; alpha-beta protei 98.18
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 98.18
2wdq_A 588 Succinate dehydrogenase flavoprotein subunit; succ 98.18
3e1t_A 512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 98.17
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 98.17
3gyx_A 662 Adenylylsulfate reductase; oxidoreductase; HET: FA 98.17
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 98.17
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 98.17
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 98.16
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 98.16
2x3n_A399 Probable FAD-dependent monooxygenase; oxidoreducta 98.16
3atr_A 453 Conserved archaeal protein; saturating double bond 98.16
3pl8_A 623 Pyranose 2-oxidase; substrate complex, H167A mutan 98.16
2r0c_A549 REBC; flavin adenine dinucleotide, monooxygenase, 98.15
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 98.15
3ihg_A535 RDME; flavoenzyme, anthracycline, polyketide biosy 98.15
2rgh_A 571 Alpha-glycerophosphate oxidase; flavoprotein oxida 98.15
2bs2_A 660 Quinol-fumarate reductase flavoprotein subunit A; 98.15
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 98.15
1ojt_A482 Surface protein; redox-active center, glycolysis, 98.14
2gmh_A584 Electron transfer flavoprotein-ubiquinone oxidored 98.14
1chu_A540 Protein (L-aspartate oxidase); flavoenzyme, NAD bi 98.14
2qa1_A500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 98.14
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 98.14
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 98.14
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 98.13
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 98.12
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 98.11
3fmw_A570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 98.11
2bry_A497 NEDD9 interacting protein with calponin homology a 98.11
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 98.11
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 98.11
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 98.11
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 98.09
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 98.08
3g3e_A351 D-amino-acid oxidase; FAD, flavoprotein, oxidoredu 98.07
2h88_A 621 Succinate dehydrogenase flavoprotein subunit; comp 98.07
2zxi_A 637 TRNA uridine 5-carboxymethylaminomethyl modificat 98.07
2qa2_A499 CABE, polyketide oxygenase CABE; FAD, angucycline, 98.07
1k0i_A394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 98.06
1fec_A490 Trypanothione reductase; redox-active center, oxid 98.05
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 98.05
3cp8_A 641 TRNA uridine 5-carboxymethylaminomethyl modificati 98.05
4hb9_A412 Similarities with probable monooxygenase; flavin, 98.03
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 98.02
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 98.02
1y56_A493 Hypothetical protein PH1363; dehydrogenase, protei 98.02
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 98.01
3ces_A 651 MNMG, tRNA uridine 5-carboxymethylaminomethyl modi 98.0
2aqj_A 538 Tryptophan halogenase, pRNA; flavin-dependent halo 98.0
2dkh_A 639 3-hydroxybenzoate hydroxylase; flavoprotein, monoo 98.0
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 97.99
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 97.99
3g5s_A443 Methylenetetrahydrofolate--tRNA-(uracil-5-)- methy 97.99
3c4a_A381 Probable tryptophan hydroxylase VIOD; alpha-beta p 97.99
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 97.98
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 97.97
1kf6_A 602 Fumarate reductase flavoprotein; respiration, fuma 97.97
1kdg_A546 CDH, cellobiose dehydrogenase; GMC oxidoreductase, 97.97
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 97.96
3ihm_A430 Styrene monooxygenase A; rossman fold, anti-parall 97.96
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 97.95
4b1b_A542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 97.95
3q9t_A 577 Choline dehydrogenase and related flavoproteins; g 97.94
3t37_A526 Probable dehydrogenase; BET alpha beta fold, ADP b 97.94
2e5v_A 472 L-aspartate oxidase; archaea, oxidoreductase; HET: 97.94
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 97.93
2ywl_A180 Thioredoxin reductase related protein; uncharacter 97.91
3qvp_A583 Glucose oxidase; oxidoreductase; HET: NAG BMA MAN 97.89
1jnr_A 643 Adenylylsulfate reductase; oxidoreductase; HET: FA 97.88
2e4g_A 550 Tryptophan halogenase; flavin-binding, rebeccamyci 97.86
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 97.85
2pyx_A 526 Tryptophan halogenase; structural genomics, JOI fo 97.84
1ju2_A536 HydroxynitrIle lyase; flavin, GMC oxidoreductase, 97.84
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 97.83
1lqt_A456 FPRA; NADP+ derivative, oxidoreductase, structural 97.8
1pn0_A 665 Phenol 2-monooxygenase; two dimers, TLS refinement 97.78
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 97.77
2weu_A 511 Tryptophan 5-halogenase; regioselectivity, antifun 97.77
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 97.76
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 97.76
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 97.75
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 97.74
1cjc_A460 Protein (adrenodoxin reductase); flavoenzyme, MAD 97.72
3ics_A 588 Coenzyme A-disulfide reductase; pyridine nucleotid 97.71
1n4w_A504 CHOD, cholesterol oxidase; flavoenzyme, steroid me 97.7
3fim_B566 ARYL-alcohol oxidase; AAO, lignin degradation, oxi 97.66
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 97.63
3h28_A430 Sulfide-quinone reductase; monotopic membrane prot 97.61
1coy_A507 Cholesterol oxidase; oxidoreductase(oxygen recepto 97.6
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 97.6
1gpe_A587 Protein (glucose oxidase); oxidoreductase(flavopro 97.59
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 97.59
2jbv_A546 Choline oxidase; alcohol oxidation, flavoenyzme ox 97.57
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 97.54
3h8l_A409 NADH oxidase; membrane protein, complete form, ros 97.52
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 97.52
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 97.5
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 97.5
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 97.48
3sx6_A437 Sulfide-quinone reductase, putative; sulfide:quino 97.42
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 97.4
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 97.33
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 97.32
4b63_A501 L-ornithine N5 monooxygenase; oxidoreductase, side 97.25
4g6h_A502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 97.05
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 97.04
3vrd_B401 FCCB subunit, flavocytochrome C flavin subunit; su 97.0
4eqs_A437 Coenzyme A disulfide reductase; oxidoreductase; HE 96.91
3hyw_A430 Sulfide-quinone reductase; monotopic membrane prot 96.8
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 95.7
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 95.66
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 95.63
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 95.52
1lss_A140 TRK system potassium uptake protein TRKA homolog; 95.52
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 95.27
1id1_A153 Putative potassium channel protein; RCK domain, E. 95.23
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 95.03
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 95.0
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 94.98
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 94.92
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 94.85
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 94.83
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 94.8
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 94.8
3c85_A183 Putative glutathione-regulated potassium-efflux S 94.76
3k6j_A460 Protein F01G10.3, confirmed by transcript evidenc; 94.48
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 94.45
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 94.42
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 94.42
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 94.38
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 94.26
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 94.09
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 94.07
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 94.0
3ado_A319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 93.96
1f0y_A302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 93.93
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 93.81
3doj_A310 AT3G25530, dehydrogenase-like protein; gamma-hydro 93.79
3qsg_A312 NAD-binding phosphogluconate dehydrogenase-like P; 93.77
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 93.76
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 93.69
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 93.65
3dtt_A245 NADP oxidoreductase; structural genomics, joint ce 93.65
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 93.64
1ojt_A482 Surface protein; redox-active center, glycolysis, 93.63
3da1_A561 Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 93.62
3axb_A448 Putative oxidoreductase; dinucleotide-binding fold 93.6
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 93.58
4e21_A358 6-phosphogluconate dehydrogenase (decarboxylating; 93.57
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 93.47
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 93.46
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 93.42
3gwf_A540 Cyclohexanone monooxygenase; flavoprotein biocatal 93.39
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 93.32
2uzz_A372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 93.29
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 93.28
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 93.21
2oln_A397 NIKD protein; flavoprotein, rossmann fold, oxidore 93.19
1pzg_A331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 93.17
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 93.11
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 93.06
3uox_A545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 93.05
2y0c_A478 BCEC, UDP-glucose dehydrogenase; oxidoreductase, c 93.03
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 93.02
3k96_A356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 93.02
4eqs_A437 Coenzyme A disulfide reductase; oxidoreductase; HE 93.01
1bg6_A359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 92.99
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 92.89
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 92.88
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 92.88
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 92.82
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 92.81
2rgh_A571 Alpha-glycerophosphate oxidase; flavoprotein oxida 92.8
4ap3_A549 Steroid monooxygenase; oxidoreductase, baeyer-vill 92.78
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 92.76
2dpo_A319 L-gulonate 3-dehydrogenase; structural genomics, N 92.74
3g0o_A303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 92.73
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 92.72
3lk7_A451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 92.72
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 92.7
3vtf_A444 UDP-glucose 6-dehydrogenase; two discrete alpha/be 92.69
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 92.69
3ghy_A335 Ketopantoate reductase protein; oxidoreductase, NA 92.68
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 92.66
3i83_A320 2-dehydropantoate 2-reductase; structural genomics 92.61
2izz_A322 Pyrroline-5-carboxylate reductase 1; amino-acid bi 92.6
1zcj_A463 Peroxisomal bifunctional enzyme; peroxisomal multi 92.53
3hn2_A312 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str 92.49
2cul_A232 Glucose-inhibited division protein A-related PROT 92.47
1ks9_A291 KPA reductase;, 2-dehydropantoate 2-reductase; PAN 92.47
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 92.45
3l8k_A466 Dihydrolipoyl dehydrogenase; redox-active center, 92.36
2pv7_A298 T-protein [includes: chorismate mutase (EC 5.4.99 92.31
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 92.28
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 92.18
3qha_A296 Putative oxidoreductase; seattle structural genomi 92.18
2gf3_A389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 92.13
4a7p_A446 UDP-glucose dehydrogenase; oxidoreductase, carbohy 92.07
3g79_A478 NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; 92.05
2ew2_A316 2-dehydropantoate 2-reductase, putative; alpha-str 92.05
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 92.03
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 92.01
3gg2_A450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 91.99
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 91.98
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 91.93
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 91.83
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 91.74
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 91.72
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 91.69
1mv8_A436 GMD, GDP-mannose 6-dehydrogenase; rossman fold, do 91.6
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 91.5
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 91.47
2x5o_A439 UDP-N-acetylmuramoylalanine--D-glutamate ligase; A 91.46
2uyy_A316 N-PAC protein; long-chain dehydrogenase, cytokine; 91.31
2weu_A511 Tryptophan 5-halogenase; regioselectivity, antifun 91.31
3mog_A483 Probable 3-hydroxybutyryl-COA dehydrogenase; struc 91.28
1zej_A293 HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural 91.25
3dfu_A232 Uncharacterized protein from 6-phosphogluconate de 91.24
2e4g_A550 Tryptophan halogenase; flavin-binding, rebeccamyci 91.22
3ics_A588 Coenzyme A-disulfide reductase; pyridine nucleotid 91.13
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 91.09
3pid_A432 UDP-glucose 6-dehydrogenase; rossmann fold, oxidor 90.98
3tl2_A315 Malate dehydrogenase; center for structural genomi 90.97
1kyq_A274 Met8P, siroheme biosynthesis protein Met8; homodim 90.96
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 90.96
3atr_A453 Conserved archaeal protein; saturating double bond 90.95
3g17_A294 Similar to 2-dehydropantoate 2-reductase; structur 90.92
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 90.91
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 90.86
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 90.86
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 90.81
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 90.72
1z82_A335 Glycerol-3-phosphate dehydrogenase; TM0378, struct 90.71
3pef_A287 6-phosphogluconate dehydrogenase, NAD-binding; gam 90.67
3hwr_A318 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A 90.65
4huj_A220 Uncharacterized protein; PSI-biology, nysgrc, stru 90.65
2ewd_A317 Lactate dehydrogenase,; protein-substrate_cofactor 90.63
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 90.63
4dll_A320 2-hydroxy-3-oxopropionate reductase; structural ge 90.62
4g65_A461 TRK system potassium uptake protein TRKA; structur 90.59
3nix_A421 Flavoprotein/dehydrogenase; structural genomics, P 90.55
1lld_A319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 90.46
2x3n_A399 Probable FAD-dependent monooxygenase; oxidoreducta 90.46
3ojo_A431 CAP5O; rossmann fold, complex with cofactor NAD an 90.32
2gmh_A 584 Electron transfer flavoprotein-ubiquinone oxidored 90.22
3l6d_A306 Putative oxidoreductase; structural genomics, prot 90.22
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 90.21
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 90.21
2zyd_A480 6-phosphogluconate dehydrogenase, decarboxylating; 90.18
3r9u_A315 Thioredoxin reductase; structural genomics, center 90.1
1t2d_A322 LDH-P, L-lactate dehydrogenase; ternary complex, o 90.06
3ggo_A314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 89.98
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 89.96
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 89.93
3ktd_A341 Prephenate dehydrogenase; structural genomics, joi 89.91
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 89.91
1fec_A490 Trypanothione reductase; redox-active center, oxid 89.86
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 89.83
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 89.83
4gwg_A484 6-phosphogluconate dehydrogenase, decarboxylating; 89.81
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 89.76
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 89.73
3pdu_A287 3-hydroxyisobutyrate dehydrogenase family protein; 89.71
3l9w_A413 Glutathione-regulated potassium-efflux system Pro 89.68
1dlj_A402 UDP-glucose dehydrogenase; rossmann fold, ternary 89.67
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 89.61
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 89.57
1evy_A366 Glycerol-3-phosphate dehydrogenase; rossmann fold, 89.55
2h78_A302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 89.48
2q3e_A467 UDP-glucose 6-dehydrogenase; hexamer, structural g 89.47
2hjr_A328 Malate dehydrogenase; malaria, structural genomics 89.41
2qyt_A317 2-dehydropantoate 2-reductase; APC81190, porphyrom 89.41
2v6b_A304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 89.38
1txg_A335 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid 89.38
3ego_A307 Probable 2-dehydropantoate 2-reductase; structural 89.36
3c4n_A405 Uncharacterized protein DR_0571; alpha-beta protei 89.28
1x0v_A354 GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase 89.25
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 89.25
2o3j_A481 UDP-glucose 6-dehydrogenase; structural genomics, 89.1
2qcu_A501 Aerobic glycerol-3-phosphate dehydrogenase; glycer 89.09
2ywl_A180 Thioredoxin reductase related protein; uncharacter 89.09
3eag_A326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME 89.08
2rcy_A262 Pyrroline carboxylate reductase; malaria, structur 89.05
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 88.94
2gqf_A401 Hypothetical protein HI0933; structural genomics, 88.88
2aqj_A538 Tryptophan halogenase, pRNA; flavin-dependent halo 88.79
3cky_A301 2-hydroxymethyl glutarate dehydrogenase; rossmann 88.79
4b1b_A542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 88.72
2bs2_A 660 Quinol-fumarate reductase flavoprotein subunit A; 88.7
2e1m_B130 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 88.67
3e1t_A512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 88.63
4dna_A463 Probable glutathione reductase; structural genomic 88.59
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 88.47
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 88.44
1cjc_A460 Protein (adrenodoxin reductase); flavoenzyme, MAD 88.42
1guz_A310 Malate dehydrogenase; oxidoreductase, tricarboxyli 88.37
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 88.33
2iz1_A474 6-phosphogluconate dehydrogenase, decarboxylating; 88.32
2h88_A 621 Succinate dehydrogenase flavoprotein subunit; comp 88.26
2f1k_A279 Prephenate dehydrogenase; tyrosine synthesis, X-RA 88.19
4ezb_A317 Uncharacterized conserved protein; structural geno 88.17
2wdq_A 588 Succinate dehydrogenase flavoprotein subunit; succ 88.13
1x13_A401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 88.08
2pyx_A526 Tryptophan halogenase; structural genomics, JOI fo 88.01
4ffl_A363 PYLC; amino acid, biosynthesis of pyrrolysine, iso 87.98
3gvi_A324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 87.95
2zxi_A 637 TRNA uridine 5-carboxymethylaminomethyl modificat 87.94
2gf2_A296 Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct 87.93
1yqg_A263 Pyrroline-5-carboxylate reductase; structural geno 87.74
3tri_A280 Pyrroline-5-carboxylate reductase; amino acid bios 87.72
2aef_A234 Calcium-gated potassium channel MTHK; rossmann fol 87.66
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 87.58
2wtb_A725 MFP2, fatty acid multifunctional protein (ATMFP2); 87.57
3orf_A251 Dihydropteridine reductase; alpha-beta-alpha sandw 87.36
3i3l_A 591 Alkylhalidase CMLS; flavin-dependent halogenase, c 87.29
1w6u_A302 2,4-dienoyl-COA reductase, mitochondrial precursor 87.28
1l7d_A384 Nicotinamide nucleotide transhydrogenase, subunit 87.25
3p7m_A321 Malate dehydrogenase; putative dehydrogenase, enzy 87.21
1vpd_A299 Tartronate semialdehyde reductase; structural geno 87.21
2pgd_A482 6-phosphogluconate dehydrogenase; oxidoreductase ( 87.18
2p4q_A497 6-phosphogluconate dehydrogenase, decarboxylating; 87.07
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 87.04
3c24_A286 Putative oxidoreductase; YP_511008.1, structural g 87.03
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 87.0
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 86.97
2pzm_A330 Putative nucleotide sugar epimerase/ dehydratase; 86.97
1a5z_A319 L-lactate dehydrogenase; oxidoreductase, glycolysi 86.91
2g5c_A281 Prephenate dehydrogenase; TYRA, oxidoreductase; HE 86.79
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 86.77
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 86.7
3ius_A286 Uncharacterized conserved protein; APC63810, silic 86.69
3k31_A296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 86.66
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 86.65
1pgj_A478 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; o 86.63
1y6j_A318 L-lactate dehydrogenase; southeast collaboratory f 86.58
3pqe_A326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 86.57
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 86.43
2a9f_A398 Putative malic enzyme ((S)-malate:NAD+ oxidoreduct 86.31
1ur5_A309 Malate dehydrogenase; oxidoreductase, tricarboxyli 86.27
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 86.26
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 86.24
1yj8_A375 Glycerol-3-phosphate dehydrogenase; SGPP, structur 86.19
1edz_A320 5,10-methylenetetrahydrofolate dehydrogenase; nucl 86.15
4b4o_A298 Epimerase family protein SDR39U1; isomerase; HET: 86.12
1np3_A338 Ketol-acid reductoisomerase; A DEEP figure-OF-eigh 86.05
1wdk_A715 Fatty oxidation complex alpha subunit; alpha2BETA2 86.02
3c7a_A404 Octopine dehydrogenase; L) stereospecific opine de 85.99
1pjq_A457 CYSG, siroheme synthase; rossman fold, nucleotide 85.92
2cvz_A289 Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; 85.86
1vl6_A388 Malate oxidoreductase; TM0542, NAD-dependent malic 85.86
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 85.84
1w4x_A542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 85.82
3ces_A 651 MNMG, tRNA uridine 5-carboxymethylaminomethyl modi 85.78
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 85.71
1k0i_A394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 85.59
1hyh_A309 L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 85.58
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 85.49
2ahr_A259 Putative pyrroline carboxylate reductase; pyrrolin 85.43
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 85.42
3d1l_A266 Putative NADP oxidoreductase BF3122; structural ge 85.28
4id9_A347 Short-chain dehydrogenase/reductase; putative dehy 85.26
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 85.16
1kf6_A 602 Fumarate reductase flavoprotein; respiration, fuma 85.02
3gt0_A247 Pyrroline-5-carboxylate reductase; structural geno 84.98
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 84.83
2hk9_A275 Shikimate dehydrogenase; shikimate pathway, drug d 84.35
4gbj_A297 6-phosphogluconate dehydrogenase NAD-binding; stru 84.3
2d5c_A263 AROE, shikimate 5-dehydrogenase; substrate, dimer, 84.21
3ond_A488 Adenosylhomocysteinase; plant protein, enzyme-subs 84.2
3b1f_A290 Putative prephenate dehydrogenase; enzyme, 4-hydro 84.19
1ff9_A450 Saccharopine reductase; lysine biosynthesis, alpha 84.18
2rir_A300 Dipicolinate synthase, A chain; structural genomic 84.17
2qa1_A 500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 84.16
1n4w_A504 CHOD, cholesterol oxidase; flavoenzyme, steroid me 84.1
3gvx_A290 Glycerate dehydrogenase related protein; NYSGXRC, 84.09
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 83.97
3zwc_A742 Peroxisomal bifunctional enzyme; beta oxidation pa 83.97
3abi_A365 Putative uncharacterized protein PH1688; L-lysine 83.93
1nvt_A287 Shikimate 5'-dehydrogenase; structural genomics, P 83.92
2ekl_A313 D-3-phosphoglycerate dehydrogenase; structural gen 83.86
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 83.81
1wwk_A307 Phosphoglycerate dehydrogenase; riken structural g 83.75
1i36_A264 Conserved hypothetical protein MTH1747; NADP bindi 83.74
3ek2_A271 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 83.49
2qa2_A 499 CABE, polyketide oxygenase CABE; FAD, angucycline, 83.46
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 83.28
2gcg_A330 Glyoxylate reductase/hydroxypyruvate reductase; NA 83.27
1yb4_A295 Tartronic semialdehyde reductase; structural genom 83.26
2we8_A386 Xanthine dehydrogenase; oxidoreductase; 2.30A {Myc 83.25
3fi9_A343 Malate dehydrogenase; structural genomics, oxidore 83.15
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 83.07
2qrj_A394 Saccharopine dehydrogenase, NAD+, L-lysine- formin 82.99
2dbq_A334 Glyoxylate reductase; D-3-phosphoglycerate dehydro 82.98
1oju_A294 MDH, malate dehydrogenase; hyperthermophilic, oxid 82.86
3i6i_A346 Putative leucoanthocyanidin reductase 1; rossmann 82.86
1lqt_A456 FPRA; NADP+ derivative, oxidoreductase, structural 82.84
>1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R* Back     alignment and structure
Probab=100.00  E-value=2.5e-58  Score=487.46  Aligned_cols=417  Identities=30%  Similarity=0.509  Sum_probs=324.3

Q ss_pred             CCcccEEEECCChhHHHHHHHHhhCCCcEEEEccCCCCCCCccccchhhhhhhhhcCCCCCC-------C----------
Q 011414           20 PTAFDLIVIGTGLPESVISAAASASGKSVLHLDPNPFYGSHFSSLSIADLTHFLNSHSTPSS-------V----------   82 (486)
Q Consensus        20 ~~~~DViIIGaGl~GL~aA~~La~~G~~VlvlE~~~~~GG~~~s~~~~~~~~~~~~~~~~~~-------~----------   82 (486)
                      +.+|||+|||+|+.|++.|+.|++.|++|+|+|+|++|||.+.++++.++.+|+........       .          
T Consensus         6 ~~~~D~~i~GtGl~~~~~a~~~~~~g~~vl~id~~~~~gg~~~~~~l~~l~~w~~~~~~~~~~~~~~~~~~~~~~~~~~~   85 (650)
T 1vg0_A            6 PSDFDVIVIGTGLPESIIAAACSRSGQRVLHVDSRSYYGGNWASFSFSGLLSWLKEYQENNDVVTENSMWQEQILENEEA   85 (650)
T ss_dssp             CSBCSEEEECCSHHHHHHHHHHHHTTCCEEEECSSSSSCGGGCEECHHHHHHHHHHTC----------CGGGGCCTTEEE
T ss_pred             CCcCCEEEECCcHHHHHHHHHHHhCCCEEEEEcCCCcccCccccccHHHHHHHHHHhhccccccccccchhhhhhcchhh
Confidence            34799999999999999999999999999999999999999999999999999876542100       0          


Q ss_pred             ----CCCCcccccccccc--------------------------------------------------------------
Q 011414           83 ----CPDPLYSDVEISNY--------------------------------------------------------------   96 (486)
Q Consensus        83 ----~~~~~~~~~~~~~~--------------------------------------------------------------   96 (486)
                          .....+.+.++.++                                                              
T Consensus        86 ~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  165 (650)
T 1vg0_A           86 IPLSSKDKTIQHVEVFCYASQDLHKDVEEAGALQKNHASVTSAQSAEAAEAAETSCLPTAVEPLSMGSCEIPAEQSQCPG  165 (650)
T ss_dssp             EEBCSSCCCEEEEEEEECSCC-----------------------------------------------------------
T ss_pred             ccccccccccccceeEeecccccccchhhccccccccccccccccccccccccccccccccccccccccccccccccccc
Confidence                00000000000000                                                              


Q ss_pred             ------------------------------------------ccc-----cccCCCCceEeecCCCEEEecChHHHHHHH
Q 011414           97 ------------------------------------------ASR-----LLSQHPRNFNLDVSGPRVLFCADHAVDLML  129 (486)
Q Consensus        97 ------------------------------------------~~~-----~~~~~~~~~~idl~Gp~ll~~~~~l~~~l~  129 (486)
                                                                ...     .+.+..|+|+||+ ||+++++++.++++|+
T Consensus       166 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~t~~~i~~~~R~f~~DL-~PklL~~~g~lv~LL~  244 (650)
T 1vg0_A          166 PESSPEVNDAEATGKKENSDAKSSTEEPSENVPKVQDNTETPKKNRITYSQIIKEGRRFNIDL-VSKLLYSRGLLIDLLI  244 (650)
T ss_dssp             ---------------------------------------------CCCHHHHHHTGGGCCEES-SCCCEESSSHHHHHHH
T ss_pred             cccccccccccccccccccccccccccccccccccccccccccccccchhhhcccCCCeEEee-CCeeeeCCcHHHHHHH
Confidence                                                      000     0112579999999 5999999999999999


Q ss_pred             hcCcccccchhcccceeeeccCCceeecCCCHHHHhhcccCChHhHHHHHHHHHHHHhhcccCccccccccccccccCCc
Q 011414          130 KSGASHYLEFKSIDATFMLDADAKLCSVPDSRAAIFKDKSLGLMEKNQLMRFFKLVQGHLSLDESEENNVRISEEDLDSP  209 (486)
Q Consensus       130 ~~~~~~y~ef~~~~~~~~~~~~g~~~~vp~s~~~~f~~~~l~~~~k~~l~~fl~~~~~~~~~~~~~~~~~~~~~~~~~~s  209 (486)
                      ++|+.+|++|+.++..|++. +|+++++|+++.++|+++.+++.+|+.+|+|++.+..+.. .+      .....+..+|
T Consensus       245 ~sgV~~yLEFk~v~~~y~~~-~G~~~~VPas~~eif~s~~Lsl~EKr~L~kFl~~~~~~~~-~p------~~~~~~d~~S  316 (650)
T 1vg0_A          245 KSNVSRYAEFKNITRILAFR-EGTVEQVPCSRADVFNSKQLTMVEKRMLMKFLTFCVEYEE-HP------DEYRAYEGTT  316 (650)
T ss_dssp             HHTGGGGCCEEECCEEEEES-SSSEEECCCSHHHHHHCSSSCHHHHHHHHHHHHHHHTGGG-CH------HHHHTTTTSB
T ss_pred             HcCCcceeeEEEccceEEec-CCCEeECCCCHHHHHhCcCCCHHHHHHHHHHHHHHHHhcc-Ch------HHHhhhccCC
Confidence            99999999999999988874 8889999999999999999999999999999999887532 11      0123456789


Q ss_pred             HHHHHHhcCCChHHHHHHHHHHhhccCCchhhhhhhchhhHHHHHHHHHHhhhcccCCCcceEeecCCcchHHHHHHHHH
Q 011414          210 FAEFLTKMKLPHKIKSIVLYAIAMADYDQEVSEYVLKTRDGINRLALYNSSIGRFQNALGALIYPIYGQGELPQAFCRRA  289 (486)
Q Consensus       210 ~~~~l~~~~l~~~l~~~l~~~i~~~~~~~~~~~~~~s~~~~l~~~~~~~~s~g~~g~~~g~~~~p~gG~~~L~qal~r~~  289 (486)
                      +.+||+++++++.++.++.+++++.....      .++..++.++..|+.++++||.+  +++||+||+++|+|+|||++
T Consensus       317 ~~d~L~~~~ls~~L~~~L~~~lal~~~~~------~pa~~~l~~i~~~l~sl~~yg~s--g~~yp~GG~g~L~qaL~r~~  388 (650)
T 1vg0_A          317 FSEYLKTQKLTPNLQYFVLHSIAMTSETT------SCTVDGLKATKKFLQCLGRYGNT--PFLFPLYGQGELPQCFCRMC  388 (650)
T ss_dssp             HHHHHTTSSSCHHHHHHHHHHTTC--CCS------CBHHHHHHHHHHHHHHTTSSSSS--SEEEETTCTTHHHHHHHHHH
T ss_pred             HHHHHHHhCCCHHHHHHHHHHHhccCCCC------CchhHHHHHHHHHHHHHHhhccC--ceEEeCCchhHHHHHHHHHH
Confidence            99999999999999999887766643321      24566777788899999888863  48999999999999999999


Q ss_pred             HHcCcEEEeCCceeEEEEecCCCeEEEEEeCCCcEEEcCEEEECCCCCCCCCCcccchhhhhhhhhhccCCCcceEEEEE
Q 011414          290 AVKGCLYVLRMPVISLLTDQNSGSYKGVRLASGQDILSHKLVLDPSFTVPGSLASSHQQLQESFQAFSLSDNKGKVARGI  369 (486)
Q Consensus       290 ~~~Gg~i~l~~~V~~I~~~~~~g~~~gV~~~~G~~i~A~~VI~~p~~~~~~l~~~~~~~l~~~~~~l~~~~~~~~v~r~i  369 (486)
                      +++||+|+|+++|++|.++.++|++++|++.+|++++|++||++|.++ +...   .           .+...++++|++
T Consensus       389 ~~~Gg~i~l~~~V~~I~~~~~~g~v~gV~~~~Ge~i~A~~VVs~~~~l-p~~~---~-----------~~~~~~~v~R~i  453 (650)
T 1vg0_A          389 AVFGGIYCLRHSVQCLVVDKESRKCKAVIDQFGQRIISKHFIIEDSYL-SENT---C-----------SRVQYRQISRAV  453 (650)
T ss_dssp             HHTTCEEESSCCEEEEEEETTTCCEEEEEETTSCEEECSEEEEEGGGB-CTTT---T-----------TTCCCEEEEEEE
T ss_pred             HHcCCEEEeCCEeeEEEEeCCCCeEEEEEeCCCCEEEcCEEEEChhhc-CHhH---h-----------ccccccceEEEE
Confidence            999999999999999998821188999988889999999999988775 3211   0           111246799999


Q ss_pred             EEecCCCCCCC---CceEEEeCCCCCCCCCCceEEEEEeCCCCccCCCCeEEEEEEEeeccCcchHHHHHHHHHHHHhhh
Q 011414          370 CITRSSLKPDL---SNFLVIFPPRSLFPEQVTSIRVLQLGGNLAVCPLGMFVLYFSALCDEVNQGKKLLHAALSALQKLL  446 (486)
Q Consensus       370 ~i~~~~~~~~~---~~~~~~~p~~~~~~~~~~~v~v~~~~~~~~~~P~G~~vi~~~t~~~~~~~~~~~l~~~~~~l~~~~  446 (486)
                      +|+++|+.+..   ...++++|+.+ +  ..++||++++|++++.||+|++|+|+++..  ..+++++|++++++|+...
T Consensus       454 ~i~~~pi~~~~~~~~~~~iiiP~~~-g--~~~~V~i~~~Ss~~~~cP~G~~Vv~lst~~--~~~~~~eLe~~l~~L~~~~  528 (650)
T 1vg0_A          454 LITDGSVLRTDADQQVSILTVPAEE-P--GSFAVRVIELCSSTMTCMKGTYLVHLTCMS--SKTAREDLERVVQKLFTPY  528 (650)
T ss_dssp             EEESSCSSCCSCCCCCEEEEECCSS-T--TSCCEEEEEECGGGTSSCTTCEEEEEEEEC--SSCHHHHHHHHHHHHCBSC
T ss_pred             EEecCCCCCcCCCcceEEEEccCcc-C--CCCCEEEEEeCCCCCCCCCCCEEEEEEeec--CCCHHHHHHHHHHHHhccc
Confidence            99999986532   45788888765 2  367899999999999999999999999873  3588999999999998531


Q ss_pred             hcCCCCCCCCccccccccCCcceEeEEeEEeecCc
Q 011414          447 VTGTAGNSSTAQSEDMEEAKPTLLWSALYIQDLSL  481 (486)
Q Consensus       447 ~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~  481 (486)
                              .+++.++.+.++|+|||++||+|.+..
T Consensus       529 --------~~~~~~~~~~~~~~vLws~~~~~~~~~  555 (650)
T 1vg0_A          529 --------TEIEAENEQVEKPRLLWALYFNMRDSS  555 (650)
T ss_dssp             --------SCCC-------CCBEEEEEEEEEEECT
T ss_pred             --------cccccccccccCCceEEEEEEEeeccc
Confidence                    122233445679999999999998765



>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} Back     alignment and structure
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Back     alignment and structure
>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Back     alignment and structure
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Back     alignment and structure
>4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Back     alignment and structure
>4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Back     alignment and structure
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Back     alignment and structure
>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* Back     alignment and structure
>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Back     alignment and structure
>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Back     alignment and structure
>4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A* Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Back     alignment and structure
>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Back     alignment and structure
>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Back     alignment and structure
>3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A* Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Back     alignment and structure
>3fpz_A Thiazole biosynthetic enzyme; FAD, mitochondrion, N thiamine biosynthesis, transit peptide, biosynthetic protei; HET: AHZ; 1.82A {Saccharomyces cerevisiae} Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A* Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Back     alignment and structure
>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Back     alignment and structure
>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Back     alignment and structure
>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* Back     alignment and structure
>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Back     alignment and structure
>1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* Back     alignment and structure
>2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... Back     alignment and structure
>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A Back     alignment and structure
>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* Back     alignment and structure
>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3g5s_A Methylenetetrahydrofolate--tRNA-(uracil-5-)- methyltransferase TRMFO; tRNA methyltransferase FAD folate, FAD, flavoprotein; HET: MSE FAD GSH; 1.05A {Thermus thermophilus} PDB: 3g5q_A* 3g5r_A* Back     alignment and structure
>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* Back     alignment and structure
>1kdg_A CDH, cellobiose dehydrogenase; GMC oxidoreductase, PHBH fold, alpha/beta structure, rossman 6-hydroxylated FAD, oxidoreductase; HET: NAG MAN 6FA EMT; 1.50A {Phanerochaete chrysosporium} SCOP: c.3.1.2 d.16.1.1 PDB: 1naa_A* Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>3q9t_A Choline dehydrogenase and related flavoproteins; glucose-methanol-choline oxidoreductase family, formate OXID formyl-FAD, oxidoreductase; HET: FAY; 2.24A {Aspergillus oryzae} Back     alignment and structure
>3t37_A Probable dehydrogenase; BET alpha beta fold, ADP binding, oxidoreductase; HET: FAD; 2.19A {Mesorhizobium loti} Back     alignment and structure
>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>3qvp_A Glucose oxidase; oxidoreductase; HET: NAG BMA MAN FAD; 1.20A {Aspergillus niger} PDB: 1gal_A* 1cf3_A* 3qvr_A* Back     alignment and structure
>1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A* Back     alignment and structure
>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina} Back     alignment and structure
>1ju2_A HydroxynitrIle lyase; flavin, GMC oxidoreductase, almond, cyanogenesis; HET: NAG NDG FUC BMA MAN FAD; 1.47A {Prunus dulcis} SCOP: c.3.1.2 d.16.1.1 PDB: 3gdp_A* 3gdn_A* Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A* Back     alignment and structure
>3fim_B ARYL-alcohol oxidase; AAO, lignin degradation, oxidoreductase, flavoprotein; HET: FAD; 2.55A {Pleurotus eryngii} Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A* Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>1gpe_A Protein (glucose oxidase); oxidoreductase(flavoprotein); HET: NAG BMA MAN FAD; 1.80A {Penicillium amagasakiense} SCOP: c.3.1.2 d.16.1.1 Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>2jbv_A Choline oxidase; alcohol oxidation, flavoenyzme oxidase, covalently linked FAD, C4A-adduct, flavoprotein, oxidoreductase; HET: FAO; 1.86A {Arthrobacter globiformis} PDB: 3nne_A* 3ljp_A* Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum} Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* Back     alignment and structure
>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} Back     alignment and structure
>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} Back     alignment and structure
>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>2x5o_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; ATP-binding, cell cycle, cell division, cell shape, cell WAL biogenesis/degradation; HET: KCX VSV; 1.46A {Escherichia coli} PDB: 2wjp_A* 2xpc_A* 2y1o_A* 2jff_A* 2jfh_A* 2uuo_A* 2uup_A* 2vtd_A* 2vte_A* 2jfg_A* 2y66_A* 2y67_A* 2y68_A* 4uag_A* 1e0d_A* 1uag_A* 1eeh_A* 3uag_A* 2uag_A* Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* Back     alignment and structure
>3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} Back     alignment and structure
>1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>3dfu_A Uncharacterized protein from 6-phosphogluconate dehydrogenase-like family; putative rossmann-like dehydrogenase, structural genomics; HET: MSE; 2.07A {Corynebacterium glutamicum} Back     alignment and structure
>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Back     alignment and structure
>3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>3ojo_A CAP5O; rossmann fold, complex with cofactor NAD and EU(PDC)3, oxidi conformation, oxidoreductase; HET: NAD PDC; 2.50A {Staphylococcus aureus} PDB: 3ojl_A* Back     alignment and structure
>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>1dlj_A UDP-glucose dehydrogenase; rossmann fold, ternary complex, crystallographic dimer, oxidoreductase; HET: NAI UGA; 1.80A {Streptococcus pyogenes} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1dli_A* Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* Back     alignment and structure
>2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>2qyt_A 2-dehydropantoate 2-reductase; APC81190, porphyromonas gingi W83, structural genomics, PSI-2; HET: MSE; 2.15A {Porphyromonas gingivalis} Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 Back     alignment and structure
>3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Back     alignment and structure
>1x0v_A GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic; two independent domains, GXGXXG motif, oxidoreductase; 2.30A {Homo sapiens} PDB: 1x0x_A* 1wpq_A* 2pla_A* Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>2o3j_A UDP-glucose 6-dehydrogenase; structural genomics, PSI-2, prote structure initiative, NEW YORK SGX research center for STRU genomics; 1.88A {Caenorhabditis elegans} Back     alignment and structure
>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* Back     alignment and structure
>2e1m_B L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* Back     alignment and structure
>2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... Back     alignment and structure
>2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina} Back     alignment and structure
>4ffl_A PYLC; amino acid, biosynthesis of pyrrolysine, isopeptide bond for ATP-grAsp fold, ligase, ATP-binding, L-lysine and 3R-methyl ornithine; HET: LYS ADP ATP; 1.50A {Methanosarcina barkeri} PDB: 4ffm_A* 4ffn_A* 4ffo_A* 4ffp_A* 4ffr_A* Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* Back     alignment and structure
>2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* Back     alignment and structure
>1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A* Back     alignment and structure
>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* Back     alignment and structure
>2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>1pgj_A 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; oxidoreductase, CHOH(D)-NADP+(B); 2.82A {Trypanosoma brucei} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Back     alignment and structure
>2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} Back     alignment and structure
>1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>1yj8_A Glycerol-3-phosphate dehydrogenase; SGPP, structural genomics, PSI; 2.85A {Plasmodium falciparum} Back     alignment and structure
>1edz_A 5,10-methylenetetrahydrofolate dehydrogenase; nucleotide-binding domain, monofunctional, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: c.2.1.7 c.58.1.2 PDB: 1ee9_A* Back     alignment and structure
>4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} Back     alignment and structure
>1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6 Back     alignment and structure
>1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A* Back     alignment and structure
>3c7a_A Octopine dehydrogenase; L) stereospecific opine dehydrogenas, oxidorecutase, oxidoreductase; HET: NAD; 2.10A {Pecten maximus} PDB: 3c7c_B* 3c7d_B* 3iqd_B* Back     alignment and structure
>1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} SCOP: c.2.1.11 c.90.1.1 e.37.1.1 PDB: 1pjs_A* 1pjt_A* Back     alignment and structure
>2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* Back     alignment and structure
>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Back     alignment and structure
>1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* Back     alignment and structure
>3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure
>4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} Back     alignment and structure
>2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure
>3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Back     alignment and structure
>1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A* Back     alignment and structure
>3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>3zwc_A Peroxisomal bifunctional enzyme; beta oxidation pathway, oxidoreductase, lipid metabolism, LY isomerase, peroxisome, fatty acid metabolism; HET: NAD HSC; 2.30A {Rattus norvegicus} PDB: 3zw9_A* 3zw8_A* 3zwa_A* 3zwb_A* 2x58_A* Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6 Back     alignment and structure
>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Back     alignment and structure
>1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} Back     alignment and structure
>2we8_A Xanthine dehydrogenase; oxidoreductase; 2.30A {Mycobacterium smegmatis} PDB: 2we7_A Back     alignment and structure
>3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>2qrj_A Saccharopine dehydrogenase, NAD+, L-lysine- forming; sulfate, rossmann fold, alpha-aminoadipate pathway, fungal lysine biosynthesis; 1.60A {Saccharomyces cerevisiae} PDB: 2qrk_A* 2qrl_A* 2q99_A 3ugk_A 3uh1_A* 3uha_A* Back     alignment and structure
>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Back     alignment and structure
>1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A* Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 486
d1vg0a1491 c.3.1.3 (A:3-444,A:558-606) Rab escort protein 1 { 7e-68
d1vg0a1491 c.3.1.3 (A:3-444,A:558-606) Rab escort protein 1 { 2e-20
d2bcgg1297 c.3.1.3 (G:5-301) Guanine nucleotide dissociation 3e-28
d1vg0a2113 d.16.1.6 (A:445-557) Rab escort protein 1 {Rat (Ra 3e-21
d1d5ta1336 c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide di 6e-19
d1y0pa2308 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 ( 4e-04
>d1vg0a1 c.3.1.3 (A:3-444,A:558-606) Rab escort protein 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 491 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: GDI-like N domain
domain: Rab escort protein 1
species: Rat (Rattus norvegicus) [TaxId: 10116]
 Score =  223 bits (569), Expect = 7e-68
 Identities = 90/356 (25%), Positives = 141/356 (39%), Gaps = 48/356 (13%)

Query: 62  SSLSIADLTHFLNSHSTPSSVCPDPLYSDVEISNYASRLLSQHPRNFNLDVSGPRVLFCA 121
                +D        S       D   +  +     S+++ +  R FN+D+   ++L+  
Sbjct: 177 GKKENSDAKSSTEEPSENVPKVQDNTETPKKNRITYSQIIKEG-RRFNIDLV-SKLLYSR 234

Query: 122 DHAVDLMLKSGASHYLEFKSIDATFMLDADAKLCSVPDSRAAIFKDKSLGLMEKNQLMRF 181
              +DL++KS  S Y EFK+I        +  +  VP SRA +F  K L ++EK  LM+F
Sbjct: 235 GLLIDLLIKSNVSRYAEFKNITRILAFR-EGTVEQVPCSRADVFNSKQLTMVEKRMLMKF 293

Query: 182 FKLVQGHLSLDESEENNVRISEEDLDSPFAEFLTKMKLPHKIKSIVLYAIAMADYDQEVS 241
                 +       E +         + F+E+L   KL   ++  VL++IAM        
Sbjct: 294 LTFCVEY-------EEHPDEYRAYEGTTFSEYLKTQKLTPNLQYFVLHSIAMTSETTS-- 344

Query: 242 EYVLKTRDGINRLALYNSSIGRFQNALGALIYPIYGQGELPQAFCRRAAVKGCLYVLRMP 301
                T DG+     +   +GR+ N     ++P+YGQGELPQ FCR  AV G +Y LR  
Sbjct: 345 ----CTVDGLKATKKFLQCLGRYGNT--PFLFPLYGQGELPQCFCRMCAVFGGIYCLRHS 398

Query: 302 VISLLTDQNSGSYKGVRLASGQDILSHKLVLDPSFTVPGSLASSHQQLQESFQAFSLSDN 361
           V  L+ D+ S   K V    GQ I+S   +++ S+    +                    
Sbjct: 399 VQCLVVDKESRKCKAVIDQFGQRIISKHFIIEDSYLSENTC------------------- 439

Query: 362 KGKVARGICITRSSLKPDLSNFLVIFPPRSLFPE----QVTSIRVLQLGGNLAVCP 413
             +V+R  C          SN  V   P S        +       Q+  N   CP
Sbjct: 440 -SRVSR-DCYNDLP-----SNVYVCSGPDSGLGNDNAVKQAETLFQQICPNEDFCP 488


>d1vg0a1 c.3.1.3 (A:3-444,A:558-606) Rab escort protein 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 491 Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 297 Back     information, alignment and structure
>d1vg0a2 d.16.1.6 (A:445-557) Rab escort protein 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 113 Back     information, alignment and structure
>d1d5ta1 c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide dissociation inhibitor, GDI {Cow (Bos taurus) [TaxId: 9913]} Length = 336 Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Length = 308 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query486
d1vg0a1491 Rab escort protein 1 {Rat (Rattus norvegicus) [Tax 100.0
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 100.0
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 99.96
d1vg0a2113 Rab escort protein 1 {Rat (Rattus norvegicus) [Tax 99.88
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 99.86
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 99.79
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 99.75
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 99.62
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 99.47
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 99.41
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 99.4
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 99.37
d2dw4a2449 Lysine-specific histone demethylase 1, LSD1 {Human 99.37
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 99.36
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 99.33
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 99.27
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 99.23
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 99.18
d1d5ta297 Guanine nucleotide dissociation inhibitor, GDI {Co 99.08
d1qo8a2317 Flavocytochrome c3 (respiratory fumarate reductase 99.07
d2bcgg398 Guanine nucleotide dissociation inhibitor, GDI {Ba 99.05
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 98.82
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 98.79
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 98.77
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 98.77
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 98.74
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 98.72
d2gmha1380 Electron transfer flavoprotein-ubiquinone oxidored 98.69
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 98.69
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 98.65
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 98.64
d1d4ca2322 Flavocytochrome c3 (respiratory fumarate reductase 98.64
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 98.63
d2f5va1379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 98.62
d2bs2a2336 Fumarate reductase {Wolinella succinogenes [TaxId: 98.58
d1chua2305 L-aspartate oxidase {Escherichia coli [TaxId: 562] 98.57
d1h6va1235 Mammalian thioredoxin reductase {Rat (Rattus norve 98.56
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 98.52
d1mo9a1261 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 98.5
d2cula1230 GidA-related protein TTHA1897 {Thermus thermophilu 98.49
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 98.49
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 98.48
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 98.45
d2gjca1311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 98.44
d1neka2330 Succinate dehydogenase {Escherichia coli [TaxId: 5 98.44
d3coxa1370 Cholesterol oxidase of GMC family {Brevibacterium 98.44
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 98.43
d1onfa1259 Glutathione reductase {Plasmodium falciparum [TaxI 98.42
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 98.4
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 98.39
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 98.39
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 98.38
d1jnra2356 Adenylylsulfate reductase A subunit {Archaeon Arch 98.36
d1kdga1360 Flavoprotein domain of flavocytochrome cellobiose 98.34
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 98.33
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 98.31
d1n4wa1367 Cholesterol oxidase of GMC family {Streptomyces sp 98.31
d1pn0a1360 Phenol hydroxylase {Soil-living yeast (Trichosporo 98.29
d1feca1240 Trypanothione reductase {Crithidia fasciculata [Ta 98.25
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 98.25
d1aoga1238 Trypanothione reductase {Trypanosoma cruzi [TaxId: 98.22
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 98.2
d1cf3a1385 Glucose oxidase {Aspergillus niger [TaxId: 5061]} 98.14
d1gpea1391 Glucose oxidase {Penicillium amagasakiense [TaxId: 98.12
d1kf6a2311 Fumarate reductase {Escherichia coli [TaxId: 562]} 98.08
d1ju2a1351 Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxI 97.97
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 97.66
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 97.64
d1xdia1233 Dihydrolipoamide dehydrogenase {Mycobacterium tube 97.58
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 97.53
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 97.52
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 97.5
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 97.49
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 97.47
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 97.44
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 97.41
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 97.27
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 97.24
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 97.2
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 97.17
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 97.09
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 96.9
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 96.9
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 96.89
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 96.87
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 96.85
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 96.8
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 96.8
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 96.66
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 96.63
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 96.63
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 96.47
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 96.45
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 96.31
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 96.27
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 96.26
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 96.2
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 96.15
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 96.14
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 96.14
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 96.13
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 96.13
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 96.09
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 96.07
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 95.88
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 95.8
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 95.77
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 95.75
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 95.22
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 95.22
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 95.14
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 95.13
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 95.11
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 95.06
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 94.99
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 94.61
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 94.55
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 94.08
d1dlja2196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 94.06
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 94.06
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 93.78
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 93.69
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 93.67
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 93.48
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 93.47
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 93.44
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 93.05
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 93.01
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 92.72
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 92.62
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 92.29
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 92.15
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 92.12
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 91.97
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 91.87
d1trba2126 Thioredoxin reductase {Escherichia coli [TaxId: 56 91.84
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 91.8
d1d4ca2322 Flavocytochrome c3 (respiratory fumarate reductase 91.77
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 91.69
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 91.36
d1fl2a2126 Alkyl hydroperoxide reductase subunit F (AhpF), C- 91.34
d1vdca2130 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 91.0
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 90.96
d1ps9a2162 2,4-dienoyl-CoA reductase, C-terminal domain {Esch 90.7
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 90.59
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 90.45
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 90.24
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 90.14
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 90.02
d1id1a_153 Rck domain from putative potassium channel Kch {Es 89.98
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 89.9
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 89.8
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 89.51
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 89.45
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 89.43
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 89.24
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 88.45
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 88.36
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 88.32
d2cula1230 GidA-related protein TTHA1897 {Thermus thermophilu 88.31
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 88.1
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 88.01
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 87.48
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 87.48
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 87.07
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 86.85
d1vl0a_281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 86.78
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 86.64
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 86.61
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 86.5
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 86.5
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 86.2
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 85.55
d1w4xa2235 Phenylacetone monooxygenase {Thermobifida fusca [T 85.44
d1a9xa4121 Carbamoyl phosphate synthetase (CPS), large subuni 85.4
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 85.21
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 84.91
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 84.7
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 84.66
d1uzma1237 beta-keto acyl carrier protein reductase {Mycobact 84.6
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 84.09
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 83.69
d2bs2a2336 Fumarate reductase {Wolinella succinogenes [TaxId: 83.5
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 83.14
d1a9xa3127 Carbamoyl phosphate synthetase (CPS), large subuni 83.09
d2c5aa1363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 83.01
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 82.89
d1w6ua_294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 82.38
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 81.64
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 81.57
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 80.98
d1n4wa1367 Cholesterol oxidase of GMC family {Streptomyces sp 80.85
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 80.72
d2dt5a2126 Transcriptional repressor Rex, C-terminal domain { 80.4
d3coxa1370 Cholesterol oxidase of GMC family {Brevibacterium 80.22
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 80.08
>d1vg0a1 c.3.1.3 (A:3-444,A:558-606) Rab escort protein 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: GDI-like N domain
domain: Rab escort protein 1
species: Rat (Rattus norvegicus) [TaxId: 10116]
Probab=100.00  E-value=4.2e-56  Score=450.52  Aligned_cols=301  Identities=36%  Similarity=0.608  Sum_probs=251.2

Q ss_pred             CCcccEEEECCChhHHHHHHHHhhCCCcEEEEccCCCCCCCccccchhhhhhhhhcCCCCCCCCC---------------
Q 011414           20 PTAFDLIVIGTGLPESVISAAASASGKSVLHLDPNPFYGSHFSSLSIADLTHFLNSHSTPSSVCP---------------   84 (486)
Q Consensus        20 ~~~~DViIIGaGl~GL~aA~~La~~G~~VlvlE~~~~~GG~~~s~~~~~~~~~~~~~~~~~~~~~---------------   84 (486)
                      +++|||||+||||.++++|++|||.|+||||+|+|++|||.++||+++++.+|+...........               
T Consensus         4 P~e~DVII~GTGL~ESILAaAlSr~GkkVLHiD~N~yYGg~~aSl~~~~L~~w~~~~~~~~~~~~~~~~~~~~~~e~e~~   83 (491)
T d1vg0a1           4 PSDFDVIVIGTGLPESIIAAACSRSGQRVLHVDSRSYYGGNWASFSFSGLLSWLKEYQENNDVVTENSMWQEQILENEEA   83 (491)
T ss_dssp             CSBCSEEEECCSHHHHHHHHHHHHTTCCEEEECSSSSSCGGGCEECHHHHHHHHHHTC----------CGGGGCCTTEEE
T ss_pred             CCccCEEEECCChHHHHHHHHHHhcCCEEEEecCCCcCCCcccceeHHHHHHHHHhhhcccccccccccccccccccchh
Confidence            57899999999999999999999999999999999999999999999999999975543210000               


Q ss_pred             ------CCcccccccccc--------------------------------------------------------------
Q 011414           85 ------DPLYSDVEISNY--------------------------------------------------------------   96 (486)
Q Consensus        85 ------~~~~~~~~~~~~--------------------------------------------------------------   96 (486)
                            .....+++..++                                                              
T Consensus        84 ~~~~~~~~~~~~~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~  163 (491)
T d1vg0a1          84 IPLSSKDKTIQHVEVFCYASQDLHKDVEEAGALQKNHASVTSAQSAEAAEAAETSCLPTAVEPLSMGSCEIPAEQSQCPG  163 (491)
T ss_dssp             EEBCSSCCCEEEEEEEECSCC-----------------------------------------------------------
T ss_pred             cccccccccccccceeeccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccC
Confidence                  000000000000                                                              


Q ss_pred             -----------------------------------------------ccccccCCCCceEeecCCCEEEecChHHHHHHH
Q 011414           97 -----------------------------------------------ASRLLSQHPRNFNLDVSGPRVLFCADHAVDLML  129 (486)
Q Consensus        97 -----------------------------------------------~~~~~~~~~~~~~idl~Gp~ll~~~~~l~~~l~  129 (486)
                                                                     ..+.+.+..|+|+|||. |++++++|.++++|+
T Consensus       164 ~e~~~~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~r~~niDL~-Pk~l~a~g~lv~~Li  242 (491)
T d1vg0a1         164 PESSPEVNDAEATGKKENSDAKSSTEEPSENVPKVQDNTETPKKNRITYSQIIKEGRRFNIDLV-SKLLYSRGLLIDLLI  242 (491)
T ss_dssp             ---------------------------------------------CCCHHHHHHTGGGCCEESS-CCCEESSSHHHHHHH
T ss_pred             cccccccccccccccccccccccccccccccccccccccccccccccchhhhhccccccccccc-chheecccHHHHHHH
Confidence                                                           00011234699999997 999999999999999


Q ss_pred             hcCcccccchhcccceeeeccCCceeecCCCHHHHhhcccCChHhHHHHHHHHHHHHhhcccCccccccccccccccCCc
Q 011414          130 KSGASHYLEFKSIDATFMLDADAKLCSVPDSRAAIFKDKSLGLMEKNQLMRFFKLVQGHLSLDESEENNVRISEEDLDSP  209 (486)
Q Consensus       130 ~~~~~~y~ef~~~~~~~~~~~~g~~~~vp~s~~~~f~~~~l~~~~k~~l~~fl~~~~~~~~~~~~~~~~~~~~~~~~~~s  209 (486)
                      ++++.+|+||+.+++.|+|. +|++.+||+++.++|+++.+++.+||+||||++++..+... +      +....+.+.|
T Consensus       243 ~S~v~rYlEFk~v~~~~v~~-~g~~~~VP~sr~eif~s~~l~l~eKR~lmkFl~~v~~~~~~-~------~~~~~~~~~~  314 (491)
T d1vg0a1         243 KSNVSRYAEFKNITRILAFR-EGTVEQVPCSRADVFNSKQLTMVEKRMLMKFLTFCVEYEEH-P------DEYRAYEGTT  314 (491)
T ss_dssp             HHTGGGGCCEEECCEEEEES-SSSEEECCCSHHHHHHCSSSCHHHHHHHHHHHHHHHTGGGC-H------HHHHTTTTSB
T ss_pred             HcChhhheeEEEeceEEEec-CCeEEECCCCHHHHhcCCCCCHHHHHHHHHHHHHHhhccCC-c------cccccccCCc
Confidence            99999999999999999886 89999999999999999999999999999999999887531 1      1123456789


Q ss_pred             HHHHHHhcCCChHHHHHHHHHHhhccCCchhhhhhhchhhHHHHHHHHHHhhhcccCCCcceEeecCCcchHHHHHHHHH
Q 011414          210 FAEFLTKMKLPHKIKSIVLYAIAMADYDQEVSEYVLKTRDGINRLALYNSSIGRFQNALGALIYPIYGQGELPQAFCRRA  289 (486)
Q Consensus       210 ~~~~l~~~~l~~~l~~~l~~~i~~~~~~~~~~~~~~s~~~~l~~~~~~~~s~g~~g~~~g~~~~p~gG~~~L~qal~r~~  289 (486)
                      |.+||+++++++.+++++.|+++|.....      .++.+++.++++|+.|+|+||++  +|+||+||.|+|+|+|||++
T Consensus       315 ~~e~l~~~~l~~~~~~~i~~aial~~~~~------~~~~~~l~ri~~yl~Slg~yG~s--pflyp~YG~gEipQ~FcR~~  386 (491)
T d1vg0a1         315 FSEYLKTQKLTPNLQYFVLHSIAMTSETT------SCTVDGLKATKKFLQCLGRYGNT--PFLFPLYGQGELPQCFCRMC  386 (491)
T ss_dssp             HHHHHTTSSSCHHHHHHHHHHTTC--CCS------CBHHHHHHHHHHHHHHTTSSSSS--SEEEETTCTTHHHHHHHHHH
T ss_pred             HHHHHHHcCCChHHHHHHHhheeccCCCC------ccHHHHHHHHHHHHHHHHhhCCC--CeEeecCCcchHHHHHHHHH
Confidence            99999999999999999999999864322      36788999999999999999975  49999999999999999999


Q ss_pred             HHcCcEEEeCCceeEEEEecCCCeEEEEEeCCCcEEEcCEEEECCCCC
Q 011414          290 AVKGCLYVLRMPVISLLTDQNSGSYKGVRLASGQDILSHKLVLDPSFT  337 (486)
Q Consensus       290 ~~~Gg~i~l~~~V~~I~~~~~~g~~~gV~~~~G~~i~A~~VI~~p~~~  337 (486)
                      ++.||+|+||++|++|.++++++++.+|++++|++++|++||++|.|.
T Consensus       387 AV~Gg~Y~L~~~i~~i~~d~e~~~~~~v~~~~g~~i~~k~vI~~psy~  434 (491)
T d1vg0a1         387 AVFGGIYCLRHSVQCLVVDKESRKCKAVIDQFGQRIISKHFIIEDSYL  434 (491)
T ss_dssp             HHTTCEEESSCCEEEEEEETTTCCEEEEEETTSCEEECSEEEEEGGGB
T ss_pred             HhcCcEEEcCCccceEEEecCCCeEEEEEccCCcEEecCeEEECHHhC
Confidence            999999999999999999766888889999999999999999999886



>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vg0a2 d.16.1.6 (A:445-557) Rab escort protein 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1d5ta2 d.16.1.6 (A:292-388) Guanine nucleotide dissociation inhibitor, GDI {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d2bcgg3 d.16.1.6 (G:302-399) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1a9xa3 c.30.1.1 (A:1-127) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d2dt5a2 c.2.1.12 (A:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure