Citrus Sinensis ID: 011417


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480------
MPNMETENSSVSRAEELKALANEAFRAKKYSQAIDLYSQAIELNSQNAVYYANRAFAHTKLEEYGSAIQDASKAIEIDPRYPKGYYRRGAAYLAMGKFKEALKDFQQVKKLSPNDPDAAQKVKECEKAVKKLKFEEAIAVPESERHSVADSIDYQSIEVEPQYSGARIEGDVITLDFVKKMMDDFKNQKCLHKRYAFQIVLQTREMLRALPSLVDIDIPDGKHFTVCGDVHGQFYDLLNIFELNGLPSEENPYLFNGDFVDRGSFSVEVILTLFAFKCMCPSAIYLSRGNHESKSMNKIYGFEGEVRSKLSETFVELFAEVFCCLPLAHVLNQKVFVVHGGLFSVDGVKLSDIKTIDRFCEPPEEGLMCELLWSDPQPLPGRGPSKRGVGLSFGADVTKRFLQDNSLGNLVVRSHEVKDEGYEIEHDGKLITVFSAPNYCDQMGNKGAFIRFEAPTLKPNIVTFAAVPHPDVKPMAYANNFLRMFQ
ccccccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHcccEEEEcccccccEEEEcccccHHHHHHHHHHHccccccccccEEccccccccccHHHHHHHHHHHHHcccccEEEcccccccccccccccHHHHHHHHccHHHHHHHHHHcccHHHHHHHcccEEEEEccccccccccHHHHHHcccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccccEEcccccccccEEEEcccEEEEEEccccccccccccEEEEEEEcccccccEEEEEcccccccccccccccHHcccc
cccccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEccccccccccccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHcccEEEEEcccccEEEEEcEccccHHHHHHHHHHHccccccccEEEccccccccccHHHHHHHHHHHHHHccccEEEcccccccHHHHccccHHHHHHHHccHHHHHHHHHHHcccccEEEEcccEEEEcccccccccccHHHHHccccccccccccHHHHHHHcEEcccccccccccccEEEccHHHHHHHHHHccccEEEEEEEEEccccEEEEEccEEEEEcccccHHHcccccEEEEEEEcccccccEEEEEEcccccccHHHHHHHHHHHcc
mpnmetenssvSRAEELKALANEAFRAKKYSQAIDLYSQAIELNSQNAVYYANRAFAHTKLEEYGSAIQDASkaieidprypkgyyrrGAAYLAMGKFKEALKDFQQvkklspndpdaAQKVKECEKAVKKLKFEEaiavpeserhsvadsidyqsievepqysgariegdVITLDFVKKMMDdfknqkclhKRYAFQIVLQTREMLRAlpslvdidipdgkhftvcgdvHGQFYDLLNIfelnglpseenpylfngdfvdrgsFSVEVILTLFAFKcmcpsaiylsrgnhesksmnkiygfeGEVRSKLSETFVELFAEVFCclplahvlnQKVFVVHGGlfsvdgvklsdiktidrfceppeeglmcellwsdpqplpgrgpskrgvglsfgadvtkrflqdnslgnlvvrshevkdegyeiehdgklitvfsapnycdqmgnkgafirfeaptlkpnivtfaavphpdvkpmayANNFLRMFQ
mpnmetenssvsrAEELKALANEAFRAKKYSQAIDLYSQAIELNSQNAVYYANRAFAHTKLEEYGSAIQdaskaieidprypkGYYRRGAAYLAMGKFKEALKDFQQVKKlspndpdaaQKVKECEKAVKKLKFeeaiavpeserhsvadsidyqsievepqysgarieGDVITLDFVKKMMDDFKNQKCLHKRYAFQIVLQTREMLRALPSLVDIDIPDGKHFTVCGDVHGQFYDLLNIFELNGLPSEENPYLFNGDFVDRGSFSVEVILTLFAFKCMCPSAIYlsrgnhesksMNKIYGFEGEVRSKLSETFVELFAEVFCCLPLAHVLNQKVFVVHGGLFsvdgvklsdiKTIDRFCEPPEEGLMCELLWSDPQPLPGRGPSKRGVGLSFGADVTKrflqdnslgnlvVRSHEVKDEGYEIEHDGKLITVFSAPNYCDQMGNKGAFIRFEAPTLKPNIVTfaavphpdvkPMAYANNFLRMFQ
MPNMETENSSVSRAEELKALANEAFRAKKYSQAIDLYSQAIELNSQNAVYYANRAFAHTKLEEYGSAIQDASKAIEIDPRYPKGYYRRGAAYLAMGKFKEALKDFQQVKKLSPNDPDAAQKVKECEKAVKKLKFEEAIAVPESERHSVADSIDYQSIEVEPQYSGARIEGDVITLDFVKKMMDDFKNQKCLHKRYAFQIVLQTREMLRALPSLVDIDIPDGKHFTVCGDVHGQFYDLLNIFELNGLPSEENPYLFNGDFVDRGSFSVEVILTLFAFKCMCPSAIYLSRGNHESKSMNKIYGFEGEVRSKLSETFVELFAEVFCCLPLAHVLNQKVFVVHGGLFSVDGVKLSDIKTIDRFCEPPEEGLMCELLWSDPQPLPGRGPSKRGVGLSFGADVTKRFLQDNSLGNLVVRSHEVKDEGYEIEHDGKLITVFSAPNYCDQMGNKGAFIRFEAPTLKPNIVTFAAVPHPDVKPMAYANNFLRMFQ
***********************AFRAKKYSQAIDLYSQAIELNSQNAVYYANRAFAHTKLEEYGSAIQDASKAIEIDPRYPKGYYRRGAAYLAMGKFKEALKDF**********************************************IDYQSIEVEPQYSGARIEGDVITLDFVKKMMDDFKNQKCLHKRYAFQIVLQTREMLRALPSLVDIDIPDGKHFTVCGDVHGQFYDLLNIFELNGLPSEENPYLFNGDFVDRGSFSVEVILTLFAFKCMCPSAIYLSRGNH***SMNKIYGFEGEVRSKLSETFVELFAEVFCCLPLAHVLNQKVFVVHGGLFSVDGVKLSDIKTIDRFCEPPEEGLMCELLWS**************VGLSFGADVTKRFLQDNSLGNLVVRSHEVKDEGYEIEHDGKLITVFSAPNYCDQMGNKGAFIRFEAPTLKPNIVTFAAVPHPDVKPMAYANNFL****
*****************KALANEAFRAKKYSQAIDLYSQAIELNSQNAVYYANRAFAHTKLEEYGSAIQDASKAIEIDPRYPKGYYRRGAAYLAMGKFKEALKDFQQVKKLSPNDPD********E*A****************************IEVE*QYSGARIEGDVITLDFVKKMMDDFKNQKCLHKRYAFQIVLQTREMLRALPSLVDIDIPDGKHFTVCGDVHGQFYDLLNIFELNGLPSEENPYLFNGDFVDRGSFSVEVILTLFAFKCMCPSAIYLSRGNHESKSMNKIYGFEGEVRSKLSETFVELFAEVFCCLPLAHVLNQKVFVVHGGLFSVDGVKLSDIKTIDRFCEPPEEGLMCELLWSDPQPLPGRGPSKRGVGLSFGADVTKRFLQDNSLGNLVVRSHEVKDEGYEIEHDGKLITVFSAPNYCDQMGNKGAFIRFEAPTLKPNIVTFAAVPHPDVKPMAYANNFLRMFQ
*************AEELKALANEAFRAKKYSQAIDLYSQAIELNSQNAVYYANRAFAHTKLEEYGSAIQDASKAIEIDPRYPKGYYRRGAAYLAMGKFKEALKDFQQVKKLSPN*********ECEKAVKKLKFEEAIAVPESERHSVADSIDYQSIEVEPQYSGARIEGDVITLDFVKKMMDDFKNQKCLHKRYAFQIVLQTREMLRALPSLVDIDIPDGKHFTVCGDVHGQFYDLLNIFELNGLPSEENPYLFNGDFVDRGSFSVEVILTLFAFKCMCPSAIYLSRGNHESKSMNKIYGFEGEVRSKLSETFVELFAEVFCCLPLAHVLNQKVFVVHGGLFSVDGVKLSDIKTIDRFCEPPEEGLMCELLWSDPQPLPGRGPSKRGVGLSFGADVTKRFLQDNSLGNLVVRSHEVKDEGYEIEHDGKLITVFSAPNYCDQMGNKGAFIRFEAPTLKPNIVTFAAVPHPDVKPMAYANNFLRMFQ
*********SVSRAEELKALANEAFRAKKYSQAIDLYSQAIELNSQNAVYYANRAFAHTKLEEYGSAIQDASKAIEIDPRYPKGYYRRGAAYLAMGKFKEALKDFQQVKKLSPNDPDAAQKVKECEKAVKKLKFEEAIAVPESERHSVADSIDYQSIEVEPQYSGARIEGDVITLDFVKKMMDDFKNQKCLHKRYAFQIVLQTREMLRALPSLVDIDIPDGKHFTVCGDVHGQFYDLLNIFELNGLPSEENPYLFNGDFVDRGSFSVEVILTLFAFKCMCPSAIYLSRGNHESKSMNKIYGFEGEVRSKLSETFVELFAEVFCCLPLAHVLNQKVFVVHGGLFSVDGVKLSDIKTIDRFCEPPEEGLMCELLWSDPQPLPGRGPSKRGVGLSFGADVTKRFLQDNSLGNLVVRSHEVKDEGYEIEHDGKLITVFSAPNYCDQMGNKGAFIRFEAPTLKPNIVTFAAVPHPDVKPMAYANNFLRMFQ
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPNMETENSSVSRAEELKALANEAFRAKKYSQAIDLYSQAIELNSQNAVYYANRAFAHTKLEEYGSAIQDASKAIEIDPRYPKGYYRRGAAYLAMGKFKEALKDFQQVKKLSPNDPDAAQKVKECEKAVKKLKFEEAIAVPESERHSVADSIDYQSIEVEPQYSGARIEGDVITLDFVKKMMDDFKNQKCLHKRYAFQIVLQTREMLRALPSLVDIDIPDGKHFTVCGDVHGQFYDLLNIFELNGLPSEENPYLFNGDFVDRGSFSVEVILTLFAFKCMCPSAIYLSRGNHESKSMNKIYGFEGEVRSKLSETFVELFAEVFCCLPLAHVLNQKVFVVHGGLFSVDGVKLSDIKTIDRFCEPPEEGLMCELLWSDPQPLPGRGPSKRGVGLSFGADVTKRFLQDNSLGNLVVRSHEVKDEGYEIEHDGKLITVFSAPNYCDQMGNKGAFIRFEAPTLKPNIVTFAAVPHPDVKPMAYANNFLRMFQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query486 2.2.26 [Sep-21-2011]
Q84XU2538 Serine/threonine-protein no no 0.991 0.895 0.769 0.0
Q84K11556 Serine/threonine-protein N/A no 0.674 0.589 0.917 0.0
P53041499 Serine/threonine-protein yes no 0.977 0.951 0.568 1e-163
P53042499 Serine/threonine-protein yes no 0.973 0.947 0.572 1e-163
Q60676499 Serine/threonine-protein yes no 0.977 0.951 0.570 1e-163
O43049473 Serine/threonine-protein yes no 0.954 0.980 0.511 1e-137
P53043513 Serine/threonine-protein yes no 0.954 0.904 0.413 1e-105
Q05681 558 Serine/threonine-protein N/A no 0.590 0.514 0.4 2e-59
Q4WUR1 534 Serine/threonine-protein no no 0.604 0.550 0.4 1e-58
P48457 549 Serine/threonine-protein yes no 0.604 0.535 0.396 2e-57
>sp|Q84XU2|PPP5_ARATH Serine/threonine-protein phosphatase 5 OS=Arabidopsis thaliana GN=PAPP5 PE=1 SV=1 Back     alignment and function desciption
 Score =  845 bits (2183), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 415/539 (76%), Positives = 450/539 (83%), Gaps = 57/539 (10%)

Query: 4   MET--ENSSVSRAEELKALANEAFRAKKYSQAIDLYSQAIELNSQNAVYYANRAFAHTKL 61
           MET  ENS VSRAEE K+ ANEAF+  KYS AIDLY++AIELNS NAVY+ANRAFAHTKL
Sbjct: 1   METKNENSDVSRAEEFKSQANEAFKGHKYSSAIDLYTKAIELNSNNAVYWANRAFAHTKL 60

Query: 62  EEYGSAIQDASKAIEIDPRYPKGYYRRGAAYLAMGKFKEALKDFQQVKKLSPNDPDAAQK 121
           EEYGSAIQDASKAIE+D RY KGYYRRGAAYLAMGKFK+ALKDFQQVK+LSPNDPDA +K
Sbjct: 61  EEYGSAIQDASKAIEVDSRYSKGYYRRGAAYLAMGKFKDALKDFQQVKRLSPNDPDATRK 120

Query: 122 VKECEKAVKKLKFEEAIAVPESER---------HSVADSIDYQSI--------------- 157
           +KECEKAV KLKFEEAI+VP SER         H++ +     S+               
Sbjct: 121 LKECEKAVMKLKFEEAISVPVSERRSVAESIDFHTIGNKPRSSSMPTKTALAAVVAAVMV 180

Query: 158 ------------------------------EVEPQYSGARIEGDVITLDFVKKMMDDFKN 187
                                         +VEPQYSGARIEG+ +TLDFVK MM+DFKN
Sbjct: 181 VAVRGFATTEILMVLVSVVLGTFWWGSFSGKVEPQYSGARIEGEEVTLDFVKTMMEDFKN 240

Query: 188 QKCLHKRYAFQIVLQTREMLRALPSLVDIDIPDGKHFTVCGDVHGQFYDLLNIFELNGLP 247
           QK LHKRYA+QIVLQTR++L ALPSLVDI +P GKH TVCGDVHGQFYDLLNIFELNGLP
Sbjct: 241 QKTLHKRYAYQIVLQTRQILLALPSLVDISVPHGKHITVCGDVHGQFYDLLNIFELNGLP 300

Query: 248 SEENPYLFNGDFVDRGSFSVEVILTLFAFKCMCPSAIYLSRGNHESKSMNKIYGFEGEVR 307
           SEENPYLFNGDFVDRGSFSVE+ILTLFAFKCMCPS+IYL+RGNHESKSMNKIYGFEGEVR
Sbjct: 301 SEENPYLFNGDFVDRGSFSVEIILTLFAFKCMCPSSIYLARGNHESKSMNKIYGFEGEVR 360

Query: 308 SKLSETFVELFAEVFCCLPLAHVLNQKVFVVHGGLFSVDGVKLSDIKTIDRFCEPPEEGL 367
           SKLSE FV+LFAEVFC LPLAHV+N KVFVVHGGLFSVDGVKLSDI+ IDRFCEPPEEGL
Sbjct: 361 SKLSEKFVDLFAEVFCYLPLAHVINGKVFVVHGGLFSVDGVKLSDIRAIDRFCEPPEEGL 420

Query: 368 MCELLWSDPQPLPGRGPSKRGVGLSFGADVTKRFLQDNSLGNLVVRSHEVKDEGYEIEHD 427
           MCELLWSDPQPLPGRGPSKRGVGLSFG DVTKRFLQDN+L +L+VRSHEVKDEGYE+EHD
Sbjct: 421 MCELLWSDPQPLPGRGPSKRGVGLSFGGDVTKRFLQDNNL-DLLVRSHEVKDEGYEVEHD 479

Query: 428 GKLITVFSAPNYCDQMGNKGAFIRFEAPTLKPNIVTFAAVPHPDVKPMAYANNFLRMFQ 486
           GKLITVFSAPNYCDQMGNKGAFIRFEAP +KPNIVTF+AVPHPDVKPMAYANNFLRMF 
Sbjct: 480 GKLITVFSAPNYCDQMGNKGAFIRFEAPDMKPNIVTFSAVPHPDVKPMAYANNFLRMFN 538




Isoform 2 dephosphorylates phosphorylated phytochromes, with a preference toward Pfr forms, and enhances phytochrome-mediated photoresponses, probably by enhancing their stability and their binding affinity for light signal transducers such as NDPK2. Can use para-nitrophenylphosphate (pNPP) as substrate.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 1EC: .EC: 3EC: .EC: 1EC: 6
>sp|Q84K11|PPP5_SOLLC Serine/threonine-protein phosphatase 5 OS=Solanum lycopersicum GN=PP5 PE=1 SV=1 Back     alignment and function description
>sp|P53041|PPP5_HUMAN Serine/threonine-protein phosphatase 5 OS=Homo sapiens GN=PPP5C PE=1 SV=1 Back     alignment and function description
>sp|P53042|PPP5_RAT Serine/threonine-protein phosphatase 5 OS=Rattus norvegicus GN=Ppp5c PE=2 SV=1 Back     alignment and function description
>sp|Q60676|PPP5_MOUSE Serine/threonine-protein phosphatase 5 OS=Mus musculus GN=Ppp5c PE=2 SV=2 Back     alignment and function description
>sp|O43049|PPT1_SCHPO Serine/threonine-protein phosphatase T OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppt1 PE=3 SV=2 Back     alignment and function description
>sp|P53043|PPT1_YEAST Serine/threonine-protein phosphatase T OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PPT1 PE=1 SV=1 Back     alignment and function description
>sp|Q05681|PP2B_NEUCR Serine/threonine-protein phosphatase 2B catalytic subunit OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cna-1 PE=2 SV=2 Back     alignment and function description
>sp|Q4WUR1|PP2B_ASPFU Serine/threonine-protein phosphatase 2B catalytic subunit OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cnaA PE=3 SV=2 Back     alignment and function description
>sp|P48457|PP2B_EMENI Serine/threonine-protein phosphatase 2B catalytic subunit OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cnaA PE=3 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query486
350536163485 serine/threonine-protein phosphatase 5 [ 0.995 0.997 0.892 0.0
343488864485 serine/threonine protein phosphatase 5 [ 0.995 0.997 0.894 0.0
355329952485 serine/threonine-protein phosphatase 5 [ 0.995 0.997 0.888 0.0
224128732488 predicted protein [Populus trichocarpa] 0.995 0.991 0.887 0.0
255558752476 protein phosphatase-5, putative [Ricinus 0.971 0.991 0.892 0.0
18406066484 serine/threonine-protein phosphatase 5 [ 0.991 0.995 0.868 0.0
449444753485 PREDICTED: serine/threonine-protein phos 0.997 1.0 0.858 0.0
357127077483 PREDICTED: serine/threonine-protein phos 0.989 0.995 0.821 0.0
326523823483 predicted protein [Hordeum vulgare subsp 0.989 0.995 0.815 0.0
79324899538 serine/threonine-protein phosphatase 5 [ 0.991 0.895 0.769 0.0
>gi|350536163|ref|NP_001234232.1| serine/threonine-protein phosphatase 5 [Solanum lycopersicum] gi|24954813|gb|AAN64317.1| type 5 serine/threonine phosphatase 55 kDa isoform [Solanum lycopersicum] gi|28141084|gb|AAO26214.1| type 5 protein serine/threonine phosphatase 55 kDa isoform [Solanum lycopersicum] Back     alignment and taxonomy information
 Score =  914 bits (2363), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/485 (89%), Positives = 464/485 (95%), Gaps = 1/485 (0%)

Query: 1   MPNMETENSSVSRAEELKALANEAFRAKKYSQAIDLYSQAIELNSQNAVYYANRAFAHTK 60
           MP ME ENS+ SRAEELK LANEAF+  KYSQAIDLY+QAIELN +NAVYYANRAFAHTK
Sbjct: 1   MPGMEAENSNASRAEELKQLANEAFKGHKYSQAIDLYTQAIELNGENAVYYANRAFAHTK 60

Query: 61  LEEYGSAIQDASKAIEIDPRYPKGYYRRGAAYLAMGKFKEALKDFQQVKKLSPNDPDAAQ 120
           LEEYGSAIQD ++AIEIDPRY KGYYRRGAAYLAMGKFK+ALKDFQQVKKL PNDPDA +
Sbjct: 61  LEEYGSAIQDGTRAIEIDPRYSKGYYRRGAAYLAMGKFKDALKDFQQVKKLCPNDPDATK 120

Query: 121 KVKECEKAVKKLKFEEAIAVPESERHSVADSIDYQSIEVEPQYSGARIEGDVITLDFVKK 180
           K+KECEKAV KLKFEEAI+VPES+R SVADSIDY+S+EVEPQY+GARIEGDV+TLDFVKK
Sbjct: 121 KLKECEKAVMKLKFEEAISVPESQRRSVADSIDYRSVEVEPQYAGARIEGDVVTLDFVKK 180

Query: 181 MMDDFKNQKCLHKRYAFQIVLQTREMLRALPSLVDIDIPDGKHFTVCGDVHGQFYDLLNI 240
           M+DDFKNQK LHKRYA+QIVLQTREMLRALPSLVDI +P+GKHFTVCGDVHGQFYDLLNI
Sbjct: 181 MLDDFKNQKNLHKRYAYQIVLQTREMLRALPSLVDIVVPEGKHFTVCGDVHGQFYDLLNI 240

Query: 241 FELNGLPSEENPYLFNGDFVDRGSFSVEVILTLFAFKCMCPSAIYLSRGNHESKSMNKIY 300
           FELNGLPSE+NPYLFNGDFVDRGSFS+EVILTLFAFKCMCPSAI+L+RGNHESKSMNKIY
Sbjct: 241 FELNGLPSEDNPYLFNGDFVDRGSFSLEVILTLFAFKCMCPSAIHLARGNHESKSMNKIY 300

Query: 301 GFEGEVRSKLSETFVELFAEVFCCLPLAHVLNQKVFVVHGGLFSVDGVKLSDIKTIDRFC 360
           GFEGEVRSKLSE FVELFAEVFCCLPLAHV+N+KVFVVHGGLFSVDGVKLSDI+ IDRFC
Sbjct: 301 GFEGEVRSKLSEIFVELFAEVFCCLPLAHVINEKVFVVHGGLFSVDGVKLSDIRAIDRFC 360

Query: 361 EPPEEGLMCELLWSDPQPLPGRGPSKRGVGLSFGADVTKRFLQDNSLGNLVVRSHEVKDE 420
           EPPEEGLMCELLWSDPQP PGRGPSKRGVGLSFG DVTKRFLQ+N+L +LVVRSHEVKDE
Sbjct: 361 EPPEEGLMCELLWSDPQPQPGRGPSKRGVGLSFGGDVTKRFLQENNL-DLVVRSHEVKDE 419

Query: 421 GYEIEHDGKLITVFSAPNYCDQMGNKGAFIRFEAPTLKPNIVTFAAVPHPDVKPMAYANN 480
           GYEIEHDGKLITVFSAPNYCDQMGNKGAFIRFEAP +KPNIVTF+AVPHPDVKPMAYANN
Sbjct: 420 GYEIEHDGKLITVFSAPNYCDQMGNKGAFIRFEAPDMKPNIVTFSAVPHPDVKPMAYANN 479

Query: 481 FLRMF 485
           FLRMF
Sbjct: 480 FLRMF 484




Source: Solanum lycopersicum

Species: Solanum lycopersicum

Genus: Solanum

Family: Solanaceae

Order: Solanales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|343488864|gb|AEM45799.1| serine/threonine protein phosphatase 5 [Solanum torvum] Back     alignment and taxonomy information
>gi|355329952|dbj|BAL14275.1| serine/threonine-protein phosphatase 5 [Nicotiana tabacum] Back     alignment and taxonomy information
>gi|224128732|ref|XP_002320408.1| predicted protein [Populus trichocarpa] gi|222861181|gb|EEE98723.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255558752|ref|XP_002520400.1| protein phosphatase-5, putative [Ricinus communis] gi|223540447|gb|EEF42016.1| protein phosphatase-5, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|18406066|ref|NP_565985.1| serine/threonine-protein phosphatase 5 [Arabidopsis thaliana] gi|16930441|gb|AAL31906.1|AF419574_1 At2g42810/F7D19.19 [Arabidopsis thaliana] gi|20197966|gb|AAD21727.2| putative phosphoprotein phosphatase [Arabidopsis thaliana] gi|33589766|gb|AAQ22649.1| At2g42810/F7D19.19 [Arabidopsis thaliana] gi|330255077|gb|AEC10171.1| serine/threonine-protein phosphatase 5 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449444753|ref|XP_004140138.1| PREDICTED: serine/threonine-protein phosphatase 5-like [Cucumis sativus] gi|449481084|ref|XP_004156077.1| PREDICTED: serine/threonine-protein phosphatase 5-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|357127077|ref|XP_003565212.1| PREDICTED: serine/threonine-protein phosphatase 5-like [Brachypodium distachyon] Back     alignment and taxonomy information
>gi|326523823|dbj|BAJ93082.1| predicted protein [Hordeum vulgare subsp. vulgare] Back     alignment and taxonomy information
>gi|79324899|ref|NP_001031534.1| serine/threonine-protein phosphatase 5 [Arabidopsis thaliana] gi|75148953|sp|Q84XU2.1|PPP5_ARATH RecName: Full=Serine/threonine-protein phosphatase 5 gi|28141302|gb|AAO26216.1| type 5 protein serine/threonine phosphatase 60 kDa isoform [Arabidopsis thaliana] gi|330255078|gb|AEC10172.1| serine/threonine-protein phosphatase 5 [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query486
TAIR|locus:2052345538 PP5.2 "protein phosphatase 5.2 0.672 0.607 0.896 2.6e-228
UNIPROTKB|P53041499 PPP5C "Serine/threonine-protei 0.977 0.951 0.568 1.3e-148
UNIPROTKB|F1N719499 PPP5C "Serine/threonine-protei 0.977 0.951 0.568 1.6e-148
UNIPROTKB|F1RM25499 PPP5C "Serine/threonine-protei 0.977 0.951 0.572 1.6e-148
RGD|68415499 Ppp5c "protein phosphatase 5, 0.973 0.947 0.572 1.6e-148
MGI|MGI:102666499 Ppp5c "protein phosphatase 5, 0.977 0.951 0.570 2.1e-148
FB|FBgn0005777520 PpD3 "Protein phosphatase D3" 0.962 0.9 0.565 5.5e-148
ZFIN|ZDB-GENE-050327-75481 zgc:110801 "zgc:110801" [Danio 0.983 0.993 0.563 5.7e-146
WB|WBGene00012665496 pph-5 [Caenorhabditis elegans 0.954 0.935 0.555 4.2e-143
UNIPROTKB|H0YDU8485 PPP5C "Serine/threonine-protei 0.948 0.950 0.561 1.6e-141
TAIR|locus:2052345 PP5.2 "protein phosphatase 5.2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1585 (563.0 bits), Expect = 2.6e-228, Sum P(2) = 2.6e-228
 Identities = 294/328 (89%), Positives = 314/328 (95%)

Query:   158 EVEPQYSGARIEGDVITLDFVKKMMDDFKNQKCLHKRYAFQIVLQTREMLRALPSLVDID 217
             +VEPQYSGARIEG+ +TLDFVK MM+DFKNQK LHKRYA+QIVLQTR++L ALPSLVDI 
Sbjct:   211 KVEPQYSGARIEGEEVTLDFVKTMMEDFKNQKTLHKRYAYQIVLQTRQILLALPSLVDIS 270

Query:   218 IPDGKHFTVCGDVHGQFYDLLNIFELNGLPSEENPYLFNGDFVDRGSFSVEVILTLFAFK 277
             +P GKH TVCGDVHGQFYDLLNIFELNGLPSEENPYLFNGDFVDRGSFSVE+ILTLFAFK
Sbjct:   271 VPHGKHITVCGDVHGQFYDLLNIFELNGLPSEENPYLFNGDFVDRGSFSVEIILTLFAFK 330

Query:   278 CMCPSAIYLSRGNHESKSMNKIYGFEGEVRSKLSETFVELFAEVFCCLPLAHVLNQKVFV 337
             CMCPS+IYL+RGNHESKSMNKIYGFEGEVRSKLSE FV+LFAEVFC LPLAHV+N KVFV
Sbjct:   331 CMCPSSIYLARGNHESKSMNKIYGFEGEVRSKLSEKFVDLFAEVFCYLPLAHVINGKVFV 390

Query:   338 VHGGLFSVDGVKLSDIKTIDRFCEPPEEGLMCELLWSDPQPLPGRGPSKRGVGLSFGADV 397
             VHGGLFSVDGVKLSDI+ IDRFCEPPEEGLMCELLWSDPQPLPGRGPSKRGVGLSFG DV
Sbjct:   391 VHGGLFSVDGVKLSDIRAIDRFCEPPEEGLMCELLWSDPQPLPGRGPSKRGVGLSFGGDV 450

Query:   398 TKRFLQDNSLGNLVVRSHEVKDEGYEIEHDGKLITVFSAPNYCDQMGNKGAFIRFEAPTL 457
             TKRFLQDN+L +L+VRSHEVKDEGYE+EHDGKLITVFSAPNYCDQMGNKGAFIRFEAP +
Sbjct:   451 TKRFLQDNNL-DLLVRSHEVKDEGYEVEHDGKLITVFSAPNYCDQMGNKGAFIRFEAPDM 509

Query:   458 KPNIVTFAAVPHPDVKPMAYANNFLRMF 485
             KPNIVTF+AVPHPDVKPMAYANNFLRMF
Sbjct:   510 KPNIVTFSAVPHPDVKPMAYANNFLRMF 537


GO:0004721 "phosphoprotein phosphatase activity" evidence=IEA;IDA
GO:0005634 "nucleus" evidence=ISM;IEA;ISS;IDA
GO:0005737 "cytoplasm" evidence=IEA;IDA
GO:0006470 "protein dephosphorylation" evidence=IEA
GO:0016787 "hydrolase activity" evidence=IEA
GO:0006913 "nucleocytoplasmic transport" evidence=ISS
GO:0004722 "protein serine/threonine phosphatase activity" evidence=ISS
GO:0005635 "nuclear envelope" evidence=IDA
GO:0030176 "integral to endoplasmic reticulum membrane" evidence=IDA
GO:0005515 "protein binding" evidence=IPI
GO:0010017 "red or far-red light signaling pathway" evidence=IMP
GO:0046686 "response to cadmium ion" evidence=IEP
GO:0005829 "cytosol" evidence=IDA
GO:0009506 "plasmodesma" evidence=IDA
UNIPROTKB|P53041 PPP5C "Serine/threonine-protein phosphatase 5" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1N719 PPP5C "Serine/threonine-protein phosphatase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1RM25 PPP5C "Serine/threonine-protein phosphatase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|68415 Ppp5c "protein phosphatase 5, catalytic subunit" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:102666 Ppp5c "protein phosphatase 5, catalytic subunit" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
FB|FBgn0005777 PpD3 "Protein phosphatase D3" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050327-75 zgc:110801 "zgc:110801" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
WB|WBGene00012665 pph-5 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|H0YDU8 PPP5C "Serine/threonine-protein phosphatase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P53042PPP5_RAT3, ., 1, ., 3, ., 1, 60.57260.97320.9478yesno
P53041PPP5_HUMAN3, ., 1, ., 3, ., 1, 60.56810.97730.9519yesno
P53043PPT1_YEAST3, ., 1, ., 3, ., 1, 60.41350.95470.9044yesno
Q84K11PPP5_SOLLC3, ., 1, ., 3, ., 1, 60.91790.67480.5899N/Ano
Q60676PPP5_MOUSE3, ., 1, ., 3, ., 1, 60.57020.97730.9519yesno
O43049PPT1_SCHPO3, ., 1, ., 3, ., 1, 60.51160.95470.9809yesno
Q84XU2PPP5_ARATH3, ., 1, ., 3, ., 1, 60.76990.99170.8959nono

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.1.3.160.979
3rd Layer3.1.30.983
3rd Layer3.6.1.13LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
estExt_Genewise1_v1.C_LG_XIV2951
hypothetical protein (488 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query486
cd07417316 cd07417, MPP_PP5_C, PP5, C-terminal metallophospha 0.0
smart00156271 smart00156, PP2Ac, Protein phosphatase 2A homologu 1e-115
cd07420321 cd07420, MPP_RdgC, Drosophila melanogaster RdgC an 1e-95
cd07416305 cd07416, MPP_PP2B, PP2B, metallophosphatase domain 8e-90
cd07415285 cd07415, MPP_PP2A_PP4_PP6, PP2A, PP4, and PP6 phos 2e-89
cd07414293 cd07414, MPP_PP1_PPKL, PP1, PPKL (PP1 and kelch-li 4e-78
cd00144225 cd00144, MPP_PPP_family, phosphoprotein phosphatas 1e-70
cd07418377 cd07418, MPP_PP7, PP7, metallophosphatase domain 6e-69
PTZ00239303 PTZ00239, PTZ00239, serine/threonine protein phosp 1e-64
PTZ00244294 PTZ00244, PTZ00244, serine/threonine-protein phosp 3e-63
PTZ00480320 PTZ00480, PTZ00480, serine/threonine-protein phosp 4e-61
cd07419311 cd07419, MPP_Bsu1_C, Arabidopsis thaliana Bsu1 pho 1e-57
pfam0832195 pfam08321, PPP5, PPP5 TPR repeat region 2e-42
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 4e-29
PLN03088356 PLN03088, PLN03088, SGT1, suppressor of G2 allele 4e-24
COG0639155 COG0639, ApaH, Diadenosine tetraphosphatase and re 6e-22
pfam00149185 pfam00149, Metallophos, Calcineurin-like phosphoes 2e-20
pfam1341469 pfam13414, TPR_11, TPR repeat 5e-18
TIGR00990615 TIGR00990, 3a0801s09, mitochondrial precursor prot 2e-17
pfam1341469 pfam13414, TPR_11, TPR repeat 1e-14
COG0457291 COG0457, NrfG, FOG: TPR repeat [General function p 1e-10
TIGR02552135 TIGR02552, LcrH_SycD, type III secretion low calci 5e-10
COG0457291 COG0457, NrfG, FOG: TPR repeat [General function p 1e-08
TIGR03302235 TIGR03302, OM_YfiO, outer membrane assembly lipopr 4e-08
COG5010257 COG5010, TadD, Flp pilus assembly protein TadD, co 7e-08
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 9e-08
pfam0051534 pfam00515, TPR_1, Tetratricopeptide repeat 2e-07
pfam1343265 pfam13432, TPR_16, Tetratricopeptide repeat 3e-07
COG0457291 COG0457, NrfG, FOG: TPR repeat [General function p 5e-07
TIGR03939 800 TIGR03939, PGA_TPR_OMP, poly-beta-1,6 N-acetyl-D-g 8e-07
TIGR00990615 TIGR00990, 3a0801s09, mitochondrial precursor prot 2e-06
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 2e-06
smart0002834 smart00028, TPR, Tetratricopeptide repeats 2e-06
TIGR00990615 TIGR00990, 3a0801s09, mitochondrial precursor prot 4e-06
pfam0771934 pfam07719, TPR_2, Tetratricopeptide repeat 5e-06
TIGR02917899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 6e-06
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 7e-06
COG0457291 COG0457, NrfG, FOG: TPR repeat [General function p 8e-06
TIGR00990615 TIGR00990, 3a0801s09, mitochondrial precursor prot 1e-05
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 2e-05
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 2e-05
cd07423234 cd07423, MPP_PrpE, Bacillus subtilis PrpE and rela 2e-05
TIGR02917899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 3e-05
pfam1341469 pfam13414, TPR_11, TPR repeat 4e-05
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 4e-05
pfam1337173 pfam13371, TPR_9, Tetratricopeptide repeat 4e-05
COG0457291 COG0457, NrfG, FOG: TPR repeat [General function p 6e-05
COG4783484 COG4783, COG4783, Putative Zn-dependent protease, 7e-05
cd07424207 cd07424, MPP_PrpA_PrpB, PrpA and PrpB, metallophos 8e-05
TIGR02917899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 9e-05
cd00838131 cd00838, MPP_superfamily, metallophosphatase super 1e-04
cd07425208 cd07425, MPP_Shelphs, Shewanella-like phosphatases 1e-04
TIGR02795117 TIGR02795, tol_pal_ybgF, tol-pal system protein Yb 1e-04
TIGR02917899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 2e-04
pfam1343134 pfam13431, TPR_17, Tetratricopeptide repeat 2e-04
PRK13625245 PRK13625, PRK13625, bis(5'-nucleosyl)-tetraphospha 2e-04
pfam0051534 pfam00515, TPR_1, Tetratricopeptide repeat 3e-04
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 4e-04
pfam0051534 pfam00515, TPR_1, Tetratricopeptide repeat 5e-04
TIGR02917899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 6e-04
PRK11788389 PRK11788, PRK11788, tetratricopeptide repeat prote 7e-04
COG4785297 COG4785, NlpI, Lipoprotein NlpI, contains TPR repe 8e-04
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 0.001
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 0.001
smart0002834 smart00028, TPR, Tetratricopeptide repeats 0.001
smart0002834 smart00028, TPR, Tetratricopeptide repeats 0.001
PRK15359144 PRK15359, PRK15359, type III secretion system chap 0.001
pfam0771934 pfam07719, TPR_2, Tetratricopeptide repeat 0.002
PRK11189296 PRK11189, PRK11189, lipoprotein NlpI; Provisional 0.002
pfam1318134 pfam13181, TPR_8, Tetratricopeptide repeat 0.002
COG1729262 COG1729, COG1729, Uncharacterized protein conserve 0.004
>gnl|CDD|163660 cd07417, MPP_PP5_C, PP5, C-terminal metallophosphatase domain Back     alignment and domain information
 Score =  647 bits (1672), Expect = 0.0
 Identities = 225/317 (70%), Positives = 266/317 (83%), Gaps = 1/317 (0%)

Query: 163 YSGARIEGDVITLDFVKKMMDDFKNQKCLHKRYAFQIVLQTREMLRALPSLVDIDIPDGK 222
           Y G R+E + +TL+FVK+M++ FK+QK LHK+YA+QI+LQ +E+L+ LPSLV+I IP+G+
Sbjct: 1   YDGPRLEDEKVTLEFVKEMIEWFKDQKKLHKKYAYQILLQVKELLKKLPSLVEITIPEGE 60

Query: 223 HFTVCGDVHGQFYDLLNIFELNGLPSEENPYLFNGDFVDRGSFSVEVILTLFAFKCMCPS 282
             TVCGD HGQFYDLLNIFELNGLPSE NPYLFNGDFVDRGSFSVEVILTLFAFK + P+
Sbjct: 61  KITVCGDTHGQFYDLLNIFELNGLPSETNPYLFNGDFVDRGSFSVEVILTLFAFKLLYPN 120

Query: 283 AIYLSRGNHESKSMNKIYGFEGEVRSKLSETFVELFAEVFCCLPLAHVLNQKVFVVHGGL 342
             +L+RGNHE+ +MNK+YGFEGEV++K +E   +LF+EVF  LPLAH++N KV VVHGGL
Sbjct: 121 HFHLNRGNHETDNMNKMYGFEGEVKAKYNEQMFDLFSEVFNWLPLAHLINGKVLVVHGGL 180

Query: 343 FSVDGVKLSDIKTIDRFCEPPEEGLMCELLWSDPQPLPGRGPSKRGVGLSFGADVTKRFL 402
           FS DGV L DI+ IDRF +PP+ GLMCELLWSDPQP PGR PSKRGVG  FG DVTKRFL
Sbjct: 181 FSDDGVTLDDIRKIDRFRQPPDSGLMCELLWSDPQPQPGRSPSKRGVGCQFGPDVTKRFL 240

Query: 403 QDNSLGNLVVRSHEVKDEGYEIEHDGKLITVFSAPNYCDQMGNKGAFIRFEAPTLKPNIV 462
           ++N+L   ++RSHEVKDEGYE+EHDGK ITVFSAPNYCDQMGNKGAFIR     LKP   
Sbjct: 241 EENNL-EYIIRSHEVKDEGYEVEHDGKCITVFSAPNYCDQMGNKGAFIRITGSDLKPKFT 299

Query: 463 TFAAVPHPDVKPMAYAN 479
            F AVPHP+VKPMAYAN
Sbjct: 300 QFEAVPHPNVKPMAYAN 316


Serine/threonine protein phosphatase-5 (PP5) is a member of the PPP gene family of protein phosphatases that is highly conserved among eukaryotes and widely expressed in mammalian tissues. PP5 has a C-terminal phosphatase domain and an extended N-terminal TPR (tetratricopeptide repeat) domain containing three TPR motifs. The PPP (phosphoprotein phosphatase) family, to which PP5 belongs, is one of two known protein phosphatase families specific for serine and threonine. The PPP family also includes: PP1, PP2A, PP2B (calcineurin), PP4, PP6, PP7, Bsu1, RdgC, PrpE, PrpA/PrpB, and ApA4 hydrolase. The PPP catalytic domain is defined by three conserved motifs (-GDXHG-, -GDXVDRG- and -GNHE-). The PPP enzyme family is ancient with members found in all eukaryotes, and in most bacterial and archeal genomes. Dephosphorylation of phosphoserines and phosphothreonines on target proteins plays a central role in the regulation of many cellular processes. PPPs belong to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination. Length = 316

>gnl|CDD|197547 smart00156, PP2Ac, Protein phosphatase 2A homologues, catalytic domain Back     alignment and domain information
>gnl|CDD|163663 cd07420, MPP_RdgC, Drosophila melanogaster RdgC and related proteins, metallophosphatase domain Back     alignment and domain information
>gnl|CDD|163659 cd07416, MPP_PP2B, PP2B, metallophosphatase domain Back     alignment and domain information
>gnl|CDD|163658 cd07415, MPP_PP2A_PP4_PP6, PP2A, PP4, and PP6 phosphoprotein phosphatases, metallophosphatase domain Back     alignment and domain information
>gnl|CDD|163657 cd07414, MPP_PP1_PPKL, PP1, PPKL (PP1 and kelch-like) enzymes, and related proteins, metallophosphatase domain Back     alignment and domain information
>gnl|CDD|163613 cd00144, MPP_PPP_family, phosphoprotein phosphatases of the metallophosphatase superfamily, metallophosphatase domain Back     alignment and domain information
>gnl|CDD|163661 cd07418, MPP_PP7, PP7, metallophosphatase domain Back     alignment and domain information
>gnl|CDD|173488 PTZ00239, PTZ00239, serine/threonine protein phosphatase 2A; Provisional Back     alignment and domain information
>gnl|CDD|140271 PTZ00244, PTZ00244, serine/threonine-protein phosphatase PP1; Provisional Back     alignment and domain information
>gnl|CDD|185658 PTZ00480, PTZ00480, serine/threonine-protein phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|163662 cd07419, MPP_Bsu1_C, Arabidopsis thaliana Bsu1 phosphatase and related proteins, C-terminal metallophosphatase domain Back     alignment and domain information
>gnl|CDD|149395 pfam08321, PPP5, PPP5 TPR repeat region Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|215568 PLN03088, PLN03088, SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>gnl|CDD|223712 COG0639, ApaH, Diadenosine tetraphosphatase and related serine/threonine protein phosphatases [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|215750 pfam00149, Metallophos, Calcineurin-like phosphoesterase Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|233223 TIGR00990, 3a0801s09, mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|233924 TIGR02552, LcrH_SycD, type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|234164 TIGR03302, OM_YfiO, outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>gnl|CDD|227343 COG5010, TadD, Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|201277 pfam00515, TPR_1, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|222123 pfam13432, TPR_16, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|234406 TIGR03939, PGA_TPR_OMP, poly-beta-1,6 N-acetyl-D-glucosamine export porin PgaA Back     alignment and domain information
>gnl|CDD|233223 TIGR00990, 3a0801s09, mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|197478 smart00028, TPR, Tetratricopeptide repeats Back     alignment and domain information
>gnl|CDD|233223 TIGR00990, 3a0801s09, mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>gnl|CDD|191825 pfam07719, TPR_2, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|233223 TIGR00990, 3a0801s09, mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|163666 cd07423, MPP_PrpE, Bacillus subtilis PrpE and related proteins, metallophosphatase domain Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|205550 pfam13371, TPR_9, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|227122 COG4783, COG4783, Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>gnl|CDD|163667 cd07424, MPP_PrpA_PrpB, PrpA and PrpB, metallophosphatase domain Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|163614 cd00838, MPP_superfamily, metallophosphatase superfamily, metallophosphatase domain Back     alignment and domain information
>gnl|CDD|163668 cd07425, MPP_Shelphs, Shewanella-like phosphatases, metallophosphatase domain Back     alignment and domain information
>gnl|CDD|188247 TIGR02795, tol_pal_ybgF, tol-pal system protein YbgF Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|205609 pfam13431, TPR_17, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|184187 PRK13625, PRK13625, bis(5'-nucleosyl)-tetraphosphatase PrpE; Provisional Back     alignment and domain information
>gnl|CDD|201277 pfam00515, TPR_1, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|201277 pfam00515, TPR_1, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|236983 PRK11788, PRK11788, tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|227124 COG4785, NlpI, Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|197478 smart00028, TPR, Tetratricopeptide repeats Back     alignment and domain information
>gnl|CDD|197478 smart00028, TPR, Tetratricopeptide repeats Back     alignment and domain information
>gnl|CDD|185257 PRK15359, PRK15359, type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>gnl|CDD|191825 pfam07719, TPR_2, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|236875 PRK11189, PRK11189, lipoprotein NlpI; Provisional Back     alignment and domain information
>gnl|CDD|205362 pfam13181, TPR_8, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|224643 COG1729, COG1729, Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 486
KOG0372303 consensus Serine/threonine specific protein phosph 100.0
KOG0376476 consensus Serine-threonine phosphatase 2A, catalyt 100.0
cd07417316 MPP_PP5_C PP5, C-terminal metallophosphatase domai 100.0
KOG0373306 consensus Serine/threonine specific protein phosph 100.0
cd07420321 MPP_RdgC Drosophila melanogaster RdgC and related 100.0
cd07415285 MPP_PP2A_PP4_PP6 PP2A, PP4, and PP6 phosphoprotein 100.0
PTZ00480320 serine/threonine-protein phosphatase; Provisional 100.0
KOG0375 517 consensus Serine-threonine phosphatase 2B, catalyt 100.0
PTZ00239303 serine/threonine protein phosphatase 2A; Provision 100.0
cd07416305 MPP_PP2B PP2B, metallophosphatase domain. PP2B (ca 100.0
cd07418377 MPP_PP7 PP7, metallophosphatase domain. PP7 is a p 100.0
KOG0374331 consensus Serine/threonine specific protein phosph 100.0
PTZ00244294 serine/threonine-protein phosphatase PP1; Provisio 100.0
cd07414293 MPP_PP1_PPKL PP1, PPKL (PP1 and kelch-like) enzyme 100.0
smart00156271 PP2Ac Protein phosphatase 2A homologues, catalytic 100.0
KOG0371319 consensus Serine/threonine protein phosphatase 2A, 100.0
cd07419311 MPP_Bsu1_C Arabidopsis thaliana Bsu1 phosphatase a 100.0
KOG0377 631 consensus Protein serine/threonine phosphatase RDG 100.0
cd00144225 MPP_PPP_family phosphoprotein phosphatases of the 100.0
cd07425208 MPP_Shelphs Shewanella-like phosphatases, metallop 99.92
PRK13625245 bis(5'-nucleosyl)-tetraphosphatase PrpE; Provision 99.9
PRK00166275 apaH diadenosine tetraphosphatase; Reviewed 99.86
cd07422257 MPP_ApaH Escherichia coli ApaH and related protein 99.86
cd07413222 MPP_PA3087 Pseudomonas aeruginosa PA3087 and relat 99.86
cd07423234 MPP_PrpE Bacillus subtilis PrpE and related protei 99.85
TIGR00668279 apaH bis(5'-nucleosyl)-tetraphosphatase (symmetric 99.84
PRK11439218 pphA serine/threonine protein phosphatase 1; Provi 99.84
cd07424207 MPP_PrpA_PrpB PrpA and PrpB, metallophosphatase do 99.84
cd07421304 MPP_Rhilphs Rhilph phosphatases, metallophosphatas 99.81
PHA02239235 putative protein phosphatase 99.8
PRK09968218 serine/threonine-specific protein phosphatase 2; P 99.78
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.75
KOG0553304 consensus TPR repeat-containing protein [General f 99.72
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.67
PRK15359144 type III secretion system chaperone protein SscB; 99.66
KOG1126638 consensus DNA-binding cell division cycle control 99.65
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.54
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.54
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.53
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.53
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.52
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 99.51
PRK11189296 lipoprotein NlpI; Provisional 99.48
PRK15359144 type III secretion system chaperone protein SscB; 99.46
PRK10370198 formate-dependent nitrite reductase complex subuni 99.46
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.44
PRK10370198 formate-dependent nitrite reductase complex subuni 99.44
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.43
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.41
PRK09782987 bacteriophage N4 receptor, outer membrane subunit; 99.41
PRK12370553 invasion protein regulator; Provisional 99.41
PRK12370553 invasion protein regulator; Provisional 99.4
KOG0547606 consensus Translocase of outer mitochondrial membr 99.4
KOG0547606 consensus Translocase of outer mitochondrial membr 99.39
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.38
KOG1126638 consensus DNA-binding cell division cycle control 99.37
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 99.37
KOG1125579 consensus TPR repeat-containing protein [General f 99.37
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.35
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.34
PRK15174656 Vi polysaccharide export protein VexE; Provisional 99.34
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.34
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.33
PRK15174656 Vi polysaccharide export protein VexE; Provisional 99.33
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.31
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.3
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.29
PRK09782987 bacteriophage N4 receptor, outer membrane subunit; 99.28
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 99.28
KOG1125579 consensus TPR repeat-containing protein [General f 99.25
PRK02603172 photosystem I assembly protein Ycf3; Provisional 99.25
PLN02789320 farnesyltranstransferase 99.24
KOG4234271 consensus TPR repeat-containing protein [General f 99.24
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.23
PRK11189296 lipoprotein NlpI; Provisional 99.22
cd00189100 TPR Tetratricopeptide repeat domain; typically con 99.21
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.21
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.2
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 99.2
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.2
PRK15331165 chaperone protein SicA; Provisional 99.19
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 99.19
PLN02789320 farnesyltranstransferase 99.18
KOG2076 895 consensus RNA polymerase III transcription factor 99.18
KOG4648536 consensus Uncharacterized conserved protein, conta 99.16
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.15
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.15
KOG0553304 consensus TPR repeat-containing protein [General f 99.15
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.13
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.12
PRK11788389 tetratricopeptide repeat protein; Provisional 99.12
PRK11788389 tetratricopeptide repeat protein; Provisional 99.11
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.11
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.11
CHL00033168 ycf3 photosystem I assembly protein Ycf3 99.11
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 99.09
PF00149200 Metallophos: Calcineurin-like phosphoesterase; Int 99.08
COG4783484 Putative Zn-dependent protease, contains TPR repea 99.06
COG4235287 Cytochrome c biogenesis factor [Posttranslational 99.06
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.06
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.03
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.03
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.03
KOG2003840 consensus TPR repeat-containing protein [General f 99.02
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 99.01
COG0639155 ApaH Diadenosine tetraphosphatase and related seri 99.01
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 99.01
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.0
PRK10803263 tol-pal system protein YbgF; Provisional 99.0
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.99
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 98.97
PRK14574 822 hmsH outer membrane protein; Provisional 98.97
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 98.96
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 98.94
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 98.94
cd00841155 MPP_YfcE Escherichia coli YfcE and related protein 98.92
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 98.92
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.91
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.89
KOG4555175 consensus TPR repeat-containing protein [Function 98.87
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.86
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 98.86
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.86
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 98.84
KOG4162799 consensus Predicted calmodulin-binding protein [Si 98.83
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 98.83
PF12688120 TPR_5: Tetratrico peptide repeat 98.83
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.82
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.8
KOG4162799 consensus Predicted calmodulin-binding protein [Si 98.8
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.79
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 98.79
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 98.78
KOG1128777 consensus Uncharacterized conserved protein, conta 98.78
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 98.77
TIGR00040158 yfcE phosphoesterase, MJ0936 family. Members of th 98.77
PRK11906458 transcriptional regulator; Provisional 98.77
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.77
PF1337173 TPR_9: Tetratricopeptide repeat 98.77
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.76
PF13512142 TPR_18: Tetratricopeptide repeat 98.76
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 98.76
PF1337173 TPR_9: Tetratricopeptide repeat 98.74
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.72
PF12850156 Metallophos_2: Calcineurin-like phosphoesterase su 98.72
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.72
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.71
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.71
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.71
KOG0551390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 98.71
KOG2076 895 consensus RNA polymerase III transcription factor 98.7
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.7
KOG2003840 consensus TPR repeat-containing protein [General f 98.7
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.69
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 98.68
KOG1129478 consensus TPR repeat-containing protein [General f 98.67
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.67
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 98.66
PRK14574 822 hmsH outer membrane protein; Provisional 98.66
COG1729262 Uncharacterized protein conserved in bacteria [Fun 98.66
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 98.65
PRK11906458 transcriptional regulator; Provisional 98.65
KOG1129478 consensus TPR repeat-containing protein [General f 98.63
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 98.61
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.61
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 98.59
PF06552186 TOM20_plant: Plant specific mitochondrial import r 98.59
PRK10747398 putative protoheme IX biogenesis protein; Provisio 98.58
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.58
PRK09453182 phosphodiesterase; Provisional 98.58
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 98.57
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 98.57
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 98.57
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.55
cd07379135 MPP_239FB Homo sapiens 239FB and related proteins, 98.54
cd07397238 MPP_DevT Myxococcus xanthus DevT and related prote 98.52
PRK15331165 chaperone protein SicA; Provisional 98.51
PRK10747398 putative protoheme IX biogenesis protein; Provisio 98.5
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 98.5
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 98.5
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.49
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 98.42
KOG1128777 consensus Uncharacterized conserved protein, conta 98.41
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.41
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 98.4
PRK10803263 tol-pal system protein YbgF; Provisional 98.39
cd07394178 MPP_Vps29 Homo sapiens Vps29 and related proteins, 98.36
KOG3785557 consensus Uncharacterized conserved protein [Funct 98.36
PF12688120 TPR_5: Tetratrico peptide repeat 98.34
cd00838131 MPP_superfamily metallophosphatase superfamily, me 98.32
cd07388224 MPP_Tt1561 Thermus thermophilus Tt1561 and related 98.32
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.27
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.27
KOG0495913 consensus HAT repeat protein [RNA processing and m 98.26
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 98.25
PF0832195 PPP5: PPP5 TPR repeat region; InterPro: IPR013235 98.25
COG4700251 Uncharacterized protein conserved in bacteria cont 98.24
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 98.22
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.22
COG4105254 ComL DNA uptake lipoprotein [General function pred 98.2
cd07404166 MPP_MS158 Microscilla MS158 and related proteins, 98.2
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 98.18
KOG0495913 consensus HAT repeat protein [RNA processing and m 98.17
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 98.16
KOG4234271 consensus TPR repeat-containing protein [General f 98.13
PRK05340241 UDP-2,3-diacylglucosamine hydrolase; Provisional 98.12
KOG4648536 consensus Uncharacterized conserved protein, conta 98.1
KOG1308377 consensus Hsp70-interacting protein Hip/Transient 98.08
PF1342844 TPR_14: Tetratricopeptide repeat 98.04
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 98.03
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.03
PF1343134 TPR_17: Tetratricopeptide repeat 98.03
KOG4555175 consensus TPR repeat-containing protein [Function 98.02
PF1342844 TPR_14: Tetratricopeptide repeat 98.02
PF1343134 TPR_17: Tetratricopeptide repeat 98.0
cd07392188 MPP_PAE1087 Pyrobaculum aerophilum PAE1087 and rel 98.0
COG0622172 Predicted phosphoesterase [General function predic 98.0
cd07403129 MPP_TTHA0053 Thermus thermophilus TTHA0053 and rel 98.0
COG1729262 Uncharacterized protein conserved in bacteria [Fun 97.94
PF06552186 TOM20_plant: Plant specific mitochondrial import r 97.94
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 97.9
TIGR01854231 lipid_A_lpxH UDP-2,3-diacylglucosamine hydrolase. 97.89
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 97.85
KOG1130639 consensus Predicted G-alpha GTPase interaction pro 97.83
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 97.82
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 97.81
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.81
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 97.77
KOG1586288 consensus Protein required for fusion of vesicles 97.77
cd07399214 MPP_YvnB Bacillus subtilis YvnB and related protei 97.76
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 97.76
PF06874640 FBPase_2: Firmicute fructose-1,6-bisphosphatase; I 97.76
KOG4340459 consensus Uncharacterized conserved protein [Funct 97.72
PF13512142 TPR_18: Tetratricopeptide repeat 97.72
KOG1941518 consensus Acetylcholine receptor-associated protei 97.69
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 97.69
KOG3785557 consensus Uncharacterized conserved protein [Funct 97.69
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.68
COG0457291 NrfG FOG: TPR repeat [General function prediction 97.67
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 97.66
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.64
KOG2376 652 consensus Signal recognition particle, subunit Srp 97.61
COG4700251 Uncharacterized protein conserved in bacteria cont 97.58
cd07400144 MPP_YydB Bacillus subtilis YydB and related protei 97.58
KOG2376652 consensus Signal recognition particle, subunit Srp 97.58
PLN032181060 maturation of RBCL 1; Provisional 97.57
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 97.55
PLN03077857 Protein ECB2; Provisional 97.49
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 97.46
cd07395262 MPP_CSTP1 Homo sapiens CSTP1 and related proteins, 97.43
cd07383199 MPP_Dcr2 Saccharomyces cerevisiae DCR2 phosphatase 97.43
PLN032181060 maturation of RBCL 1; Provisional 97.42
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 97.4
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 97.4
COG0457291 NrfG FOG: TPR repeat [General function prediction 97.36
KOG1130639 consensus Predicted G-alpha GTPase interaction pro 97.35
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 97.34
PRK11340271 phosphodiesterase YaeI; Provisional 97.33
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.32
KOG1941518 consensus Acetylcholine receptor-associated protei 97.28
KOG1310758 consensus WD40 repeat protein [General function pr 97.27
COG3118304 Thioredoxin domain-containing protein [Posttransla 97.26
KOG2471696 consensus TPR repeat-containing protein [General f 97.26
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 97.25
cd07402240 MPP_GpdQ Enterobacter aerogenes GpdQ and related p 97.25
PRK04036504 DNA polymerase II small subunit; Validated 97.24
KOG0551390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 97.22
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 97.21
KOG4340459 consensus Uncharacterized conserved protein [Funct 97.21
cd07385223 MPP_YkuE_C Bacillus subtilis YkuE and related prot 97.2
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 97.19
KOG1915677 consensus Cell cycle control protein (crooked neck 97.17
cd07390168 MPP_AQ1575 Aquifex aeolicus AQ1575 and related pro 97.15
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 97.14
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.09
COG2976207 Uncharacterized protein conserved in bacteria [Fun 97.08
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 97.07
cd07391172 MPP_PF1019 Pyrococcus furiosus PF1019 and related 97.04
PRK10941269 hypothetical protein; Provisional 97.03
KOG4507886 consensus Uncharacterized conserved protein, conta 97.02
cd07384171 MPP_Cdc1_like Saccharomyces cerevisiae CDC1 and re 97.01
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 97.0
cd08163257 MPP_Cdc1 Saccharomyces cerevisiae CDC1 and related 96.91
PLN03077857 Protein ECB2; Provisional 96.91
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 96.9
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 96.87
KOG2610491 consensus Uncharacterized conserved protein [Funct 96.82
TIGR03729239 acc_ester putative phosphoesterase. Members of thi 96.81
KOG1915 677 consensus Cell cycle control protein (crooked neck 96.8
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 96.75
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 96.74
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.73
PRK04841903 transcriptional regulator MalT; Provisional 96.72
PF15015569 NYD-SP12_N: Spermatogenesis-associated, N-terminal 96.7
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 96.7
KOG3824472 consensus Huntingtin interacting protein HYPE [Gen 96.65
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 96.63
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 96.63
TIGR00619253 sbcd exonuclease SbcD. This family is based on the 96.62
PRK04841903 transcriptional regulator MalT; Provisional 96.62
COG4105254 ComL DNA uptake lipoprotein [General function pred 96.58
cd07396267 MPP_Nbla03831 Homo sapiens Nbla03831 and related p 96.58
cd08166195 MPP_Cdc1_like_1 uncharacterized subgroup related t 96.52
KOG3824472 consensus Huntingtin interacting protein HYPE [Gen 96.52
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 96.51
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 96.5
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 96.49
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 96.49
PRK10941269 hypothetical protein; Provisional 96.48
KOG1586288 consensus Protein required for fusion of vesicles 96.46
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 96.45
KOG3364149 consensus Membrane protein involved in organellar 96.35
KOG1585308 consensus Protein required for fusion of vesicles 96.33
PRK11148275 cyclic 3',5'-adenosine monophosphate phosphodieste 96.31
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 96.3
PHA02546340 47 endonuclease subunit; Provisional 96.29
cd00844262 MPP_Dbr1_N Dbr1 RNA lariat debranching enzyme, N-t 96.28
KOG2396568 consensus HAT (Half-A-TPR) repeat-containing prote 96.18
PF13281374 DUF4071: Domain of unknown function (DUF4071) 96.15
KOG1308377 consensus Hsp70-interacting protein Hip/Transient 96.12
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 96.07
KOG4814872 consensus Uncharacterized conserved protein [Funct 96.05
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 96.0
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 95.99
cd07393232 MPP_DR1119 Deinococcus radiodurans DR1119 and rela 95.96
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 95.94
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 95.88
COG4976287 Predicted methyltransferase (contains TPR repeat) 95.86
KOG2047835 consensus mRNA splicing factor [RNA processing and 95.84
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 95.83
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 95.82
cd00840223 MPP_Mre11_N Mre11 nuclease, N-terminal metallophos 95.81
KOG0530318 consensus Protein farnesyltransferase, alpha subun 95.73
KOG0546372 consensus HSP90 co-chaperone CPR7/Cyclophilin [Pos 95.66
COG4976287 Predicted methyltransferase (contains TPR repeat) 95.63
COG4186186 Predicted phosphoesterase or phosphohydrolase [Gen 95.61
KOG2610491 consensus Uncharacterized conserved protein [Funct 95.54
PF09986214 DUF2225: Uncharacterized protein conserved in bact 95.53
TIGR00024225 SbcD_rel_arch putative phosphoesterase, SbcD/Mre11 95.47
KOG0918 476 consensus Selenium-binding protein [Inorganic ion 95.41
cd08165156 MPP_MPPE1 human MPPE1 and related proteins, metall 95.38
TIGR00583405 mre11 DNA repair protein (mre11). All proteins in 95.38
PRK10966 407 exonuclease subunit SbcD; Provisional 95.37
cd07398217 MPP_YbbF-LpxH Escherichia coli YbbF/LpxH and relat 95.22
cd07380150 MPP_CWF19_N Schizosaccharomyces pombe CWF19 and re 95.22
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 95.21
COG3914620 Spy Predicted O-linked N-acetylglucosamine transfe 95.09
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 95.08
KOG2471696 consensus TPR repeat-containing protein [General f 95.03
COG2908237 Uncharacterized protein conserved in bacteria [Fun 94.91
KOG2047835 consensus mRNA splicing factor [RNA processing and 94.88
cd00839294 MPP_PAPs purple acid phosphatases of the metalloph 94.86
KOG36171416 consensus WD40 and TPR repeat-containing protein [ 94.86
KOG3325183 consensus Membrane coat complex Retromer, subunit 94.79
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 94.72
cd08164193 MPP_Ted1 Saccharomyces cerevisiae Ted1 and related 94.71
COG2912269 Uncharacterized conserved protein [Function unknow 94.69
PF13281374 DUF4071: Domain of unknown function (DUF4071) 94.53
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 94.49
cd07386243 MPP_DNA_pol_II_small_archeal_C archeal DNA polymer 94.3
KOG1550552 consensus Extracellular protein SEL-1 and related 94.29
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 94.25
COG1407235 Predicted ICC-like phosphoesterases [General funct 94.16
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 94.04
COG1409301 Icc Predicted phosphohydrolases [General function 93.99
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 93.93
COG5191435 Uncharacterized conserved protein, contains HAT (H 93.85
cd07401256 MPP_TMEM62_N Homo sapiens TMEM62, N-terminal metal 93.8
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 93.79
COG2912269 Uncharacterized conserved protein [Function unknow 93.77
COG1408284 Predicted phosphohydrolases [General function pred 93.68
COG2129226 Predicted phosphoesterases, related to the Icc pro 93.65
PRK13184932 pknD serine/threonine-protein kinase; Reviewed 93.54
COG1311481 HYS2 Archaeal DNA polymerase II, small subunit/DNA 93.51
COG2976207 Uncharacterized protein conserved in bacteria [Fun 93.48
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 93.37
KOG1585308 consensus Protein required for fusion of vesicles 93.2
KOG4507 886 consensus Uncharacterized conserved protein, conta 93.11
KOG3364149 consensus Membrane protein involved in organellar 93.01
cd00845252 MPP_UshA_N_like Escherichia coli UshA-like family, 92.65
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 92.65
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 92.59
KOG3662410 consensus Cell division control protein/predicted 92.51
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 92.38
KOG2300629 consensus Uncharacterized conserved protein [Funct 92.34
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 92.24
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 92.01
PF1286294 Apc5: Anaphase-promoting complex subunit 5 91.97
COG3118304 Thioredoxin domain-containing protein [Posttransla 91.85
PF1286294 Apc5: Anaphase-promoting complex subunit 5 91.82
KOG0529421 consensus Protein geranylgeranyltransferase type I 91.74
PF04910360 Tcf25: Transcriptional repressor TCF25; InterPro: 91.58
KOG2300 629 consensus Uncharacterized conserved protein [Funct 91.49
KOG4151 748 consensus Myosin assembly protein/sexual cycle pro 91.44
COG3629280 DnrI DNA-binding transcriptional activator of the 91.39
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 91.22
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 91.17
KOG1550552 consensus Extracellular protein SEL-1 and related 91.05
PF0772036 TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 91.04
PRK15180831 Vi polysaccharide biosynthesis protein TviD; Provi 90.92
PF10373278 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterP 90.81
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 90.78
cd07378277 MPP_ACP5 Homo sapiens acid phosphatase 5 and relat 90.58
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 90.52
COG3629280 DnrI DNA-binding transcriptional activator of the 90.43
KOG4814872 consensus Uncharacterized conserved protein [Funct 90.38
PF0772036 TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 90.3
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 90.24
PF09986214 DUF2225: Uncharacterized protein conserved in bact 90.24
PF10373278 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterP 89.95
COG0420 390 SbcD DNA repair exonuclease [DNA replication, reco 89.68
PF04910360 Tcf25: Transcriptional repressor TCF25; InterPro: 89.64
COG5191435 Uncharacterized conserved protein, contains HAT (H 89.61
KOG0530318 consensus Protein farnesyltransferase, alpha subun 89.57
KOG2396568 consensus HAT (Half-A-TPR) repeat-containing prote 89.32
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 89.3
COG3914 620 Spy Predicted O-linked N-acetylglucosamine transfe 89.29
KOG20411189 consensus WD40 repeat protein [General function pr 89.23
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 88.63
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 88.58
KOG1310758 consensus WD40 repeat protein [General function pr 88.39
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 88.27
COG4649221 Uncharacterized protein conserved in bacteria [Fun 88.21
KOG36171416 consensus WD40 and TPR repeat-containing protein [ 88.2
PF14863141 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB 88.0
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 87.44
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 87.22
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 87.04
PRK15180831 Vi polysaccharide biosynthesis protein TviD; Provi 87.02
KOG18391236 consensus Uncharacterized protein CLU1/cluA/TIF31 86.99
cd07410277 MPP_CpdB_N Escherichia coli CpdB and related prote 86.74
COG3898531 Uncharacterized membrane-bound protein [Function u 86.61
PLN02533427 probable purple acid phosphatase 86.39
PF14582255 Metallophos_3: Metallophosphoesterase, calcineurin 86.33
KOG1258577 consensus mRNA processing protein [RNA processing 86.27
COG2909894 MalT ATP-dependent transcriptional regulator [Tran 85.96
KOG09851666 consensus Vesicle coat protein clathrin, heavy cha 85.79
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 85.37
cd0268275 MIT_AAA_Arch MIT: domain contained within Microtub 85.31
KOG0529421 consensus Protein geranylgeranyltransferase type I 85.02
KOG0546372 consensus HSP90 co-chaperone CPR7/Cyclophilin [Pos 84.97
PF15015569 NYD-SP12_N: Spermatogenesis-associated, N-terminal 84.86
KOG18391236 consensus Uncharacterized protein CLU1/cluA/TIF31 84.83
COG4941415 Predicted RNA polymerase sigma factor containing a 84.42
KOG2422665 consensus Uncharacterized conserved protein [Funct 83.78
KOG2863 456 consensus RNA lariat debranching enzyme [RNA proce 83.59
cd07412288 MPP_YhcR_N Bacillus subtilis YhcR endonuclease and 83.5
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 83.49
COG3855648 Fbp Uncharacterized protein conserved in bacteria 83.41
COG3898531 Uncharacterized membrane-bound protein [Function u 83.24
PF10255404 Paf67: RNA polymerase I-associated factor PAF67; I 83.03
cd0268275 MIT_AAA_Arch MIT: domain contained within Microtub 83.01
COG3947361 Response regulator containing CheY-like receiver a 82.93
COG3947361 Response regulator containing CheY-like receiver a 82.7
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 82.17
cd07408257 MPP_SA0022_N Staphylococcus aureus SA0022 and rela 81.75
KOG3807556 consensus Predicted membrane protein ST7 (tumor su 81.17
PF09670379 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02 80.6
PF10255404 Paf67: RNA polymerase I-associated factor PAF67; I 80.31
>KOG0372 consensus Serine/threonine specific protein phosphatase involved in glycogen accumulation, PP2A-related [Carbohydrate transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
Probab=100.00  E-value=3.6e-84  Score=570.06  Aligned_cols=285  Identities=41%  Similarity=0.750  Sum_probs=275.8

Q ss_pred             HHHHHHHHhcccchhhHHHHHHHHHHHHHHhcCCCcccccCCCCCceEEEccCCCChHHHHHHHHHcCCCCCCCCeEEcc
Q 011417          178 VKKMMDDFKNQKCLHKRYAFQIVLQTREMLRALPSLVDIDIPDGKHFTVCGDVHGQFYDLLNIFELNGLPSEENPYLFNG  257 (486)
Q Consensus       178 l~~l~e~l~~~~~l~~~e~~~ll~~a~~~l~~ep~~~~i~~~~~~~~~v~GDihG~~~~l~~~l~~~~~~~~~~~~~~lG  257 (486)
                      +++.++.+.+...+.+.++..+|.++.++|.+|+++..++.|    +.|+||+|||+.||+.+|+..|-++++ +|+|||
T Consensus         3 ldr~ie~L~~~~li~E~eV~~LC~~~~eiL~~E~NV~~i~tP----vtvcGDIHGQf~Dllelf~igG~~~~t-~YLFLG   77 (303)
T KOG0372|consen    3 LDRQIEQLRRCELIAESEVKALCAKVREILVEESNVQRIDTP----VTVCGDIHGQFYDLLELFRIGGDVPET-NYLFLG   77 (303)
T ss_pred             HHHHHHHHHhcCCCcHHHHHHHHHHHHHHHhcCCCceecCCC----cEEeecccchHHHHHHHHHhCCCCCCC-ceEeec
Confidence            677888899999999999999999999999999999999988    999999999999999999998888766 699999


Q ss_pred             cccCCCCChHHHHHHHHhchhcCCCeEEEeccCCcccccccccCChhhhhhhcc-HHHHHHHHHHhhcccccceeCCcEE
Q 011417          258 DFVDRGSFSVEVILTLFAFKCMCPSAIYLSRGNHESKSMNKIYGFEGEVRSKLS-ETFVELFAEVFCCLPLAHVLNQKVF  336 (486)
Q Consensus       258 d~vdrG~~~~e~l~~l~~lk~~~p~~v~~lrGNHE~~~~~~~~~~~~e~~~~~~-~~~~~~~~~~~~~lp~~~~i~~~~~  336 (486)
                      ||||||..|+|++.||+.||++||++|.|||||||++.++..|||++||.+||+ ..+|+.++++|+.||++|+|++++|
T Consensus        78 DyVDRG~~SvEt~lLLl~lK~rYP~ritLiRGNHEsRqitqvYGFY~EclrKYG~~~vWr~c~eiFdyL~l~aiid~kif  157 (303)
T KOG0372|consen   78 DYVDRGYYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFYDECLRKYGSANVWRYCTEIFDYLSLAAIIDGKIF  157 (303)
T ss_pred             chhccccchHHHHHHHHHHhhcCcceeEEeeccchhhhhhhhhhHHHHHHHHcCChHHHHHHHHHHHhhhHhheecCcEE
Confidence            999999999999999999999999999999999999999999999999999995 6899999999999999999999999


Q ss_pred             EEeCcccCCCCCCchhhcccccCCCCCCCCcccccccCCCCCCCCCCCCCCCCceEcCHHHHHHHHHHCCCCceeeeccc
Q 011417          337 VVHGGLFSVDGVKLSDIKTIDRFCEPPEEGLMCELLWSDPQPLPGRGPSKRGVGLSFGADVTKRFLQDNSLGNLVVRSHE  416 (486)
Q Consensus       337 ~vHgGi~~~~~~~~~~i~~~~r~~~~~~~~~~~~llw~dp~~~~~~~~~~rg~~~~fg~~~~~~~l~~~~~~~~iir~H~  416 (486)
                      |||||+ ||.+.++++|+.++|..+.|+.+.++|+|||||.+..||..|+||+|+.||.++++.||+.||+ ++|+|+||
T Consensus       158 CVHGGl-SP~i~~lDqIr~lDR~~Eiph~g~m~DllWSDPee~~g~~~SPRGaGylFG~dvv~~F~~~N~~-~~I~RaHQ  235 (303)
T KOG0372|consen  158 CVHGGL-SPSIQTLDQIRVLDRKQEVPHDGAMCDLLWSDPEEGPGWGLSPRGAGYLFGEDVVESFLEANGL-SLICRAHQ  235 (303)
T ss_pred             EEcCCC-CcchhhHHHHHHhhccccCCCCCcchheeccCcccCCCcccCCCCccccccHHHHHHHHHhCCh-HHHHHHHH
Confidence            999999 9999999999999999999999999999999999999999999999999999999999999999 99999999


Q ss_pred             ccccCceEecCCeEEEEecCCCCCCCCCCeEEEEEEecCCCceeEEEEeccCCC
Q 011417          417 VKDEGYEIEHDGKLITVFSAPNYCDQMGNKGAFIRFEAPTLKPNIVTFAAVPHP  470 (486)
Q Consensus       417 ~~~~G~~~~~~~~~~tifsa~~y~~~~~n~~a~~~~~~~~~~~~~~~~~~~~~~  470 (486)
                      .+++||++.|+++|+|||||||||+.++|.||||.| +++....|..|++.|..
T Consensus       236 Lv~eGyk~~F~~~v~TVWSAPNYCYrCGN~AsIl~l-de~~~~~F~vFeaa~~~  288 (303)
T KOG0372|consen  236 LVMEGYKWHFDEKVVTVWSAPNYCYRCGNVAAILEL-DEDLDKDFRVFEAAPQE  288 (303)
T ss_pred             HHHhhHHHhcCCceEEEecCCchhhhcCChHHheee-ccccCcceEeeecchhh
Confidence            999999999999999999999999999999999999 88889999999998743



>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>cd07417 MPP_PP5_C PP5, C-terminal metallophosphatase domain Back     alignment and domain information
>KOG0373 consensus Serine/threonine specific protein phosphatase involved in cell cycle control, PP2A-related [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms] Back     alignment and domain information
>cd07420 MPP_RdgC Drosophila melanogaster RdgC and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07415 MPP_PP2A_PP4_PP6 PP2A, PP4, and PP6 phosphoprotein phosphatases, metallophosphatase domain Back     alignment and domain information
>PTZ00480 serine/threonine-protein phosphatase; Provisional Back     alignment and domain information
>KOG0375 consensus Serine-threonine phosphatase 2B, catalytic subunit [General function prediction only] Back     alignment and domain information
>PTZ00239 serine/threonine protein phosphatase 2A; Provisional Back     alignment and domain information
>cd07416 MPP_PP2B PP2B, metallophosphatase domain Back     alignment and domain information
>cd07418 MPP_PP7 PP7, metallophosphatase domain Back     alignment and domain information
>KOG0374 consensus Serine/threonine specific protein phosphatase PP1, catalytic subunit [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PTZ00244 serine/threonine-protein phosphatase PP1; Provisional Back     alignment and domain information
>cd07414 MPP_PP1_PPKL PP1, PPKL (PP1 and kelch-like) enzymes, and related proteins, metallophosphatase domain Back     alignment and domain information
>smart00156 PP2Ac Protein phosphatase 2A homologues, catalytic domain Back     alignment and domain information
>KOG0371 consensus Serine/threonine protein phosphatase 2A, catalytic subunit [Signal transduction mechanisms] Back     alignment and domain information
>cd07419 MPP_Bsu1_C Arabidopsis thaliana Bsu1 phosphatase and related proteins, C-terminal metallophosphatase domain Back     alignment and domain information
>KOG0377 consensus Protein serine/threonine phosphatase RDGC/PPEF, contains STphosphatase and EF-hand domains [Signal transduction mechanisms] Back     alignment and domain information
>cd00144 MPP_PPP_family phosphoprotein phosphatases of the metallophosphatase superfamily, metallophosphatase domain Back     alignment and domain information
>cd07425 MPP_Shelphs Shewanella-like phosphatases, metallophosphatase domain Back     alignment and domain information
>PRK13625 bis(5'-nucleosyl)-tetraphosphatase PrpE; Provisional Back     alignment and domain information
>PRK00166 apaH diadenosine tetraphosphatase; Reviewed Back     alignment and domain information
>cd07422 MPP_ApaH Escherichia coli ApaH and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07413 MPP_PA3087 Pseudomonas aeruginosa PA3087 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07423 MPP_PrpE Bacillus subtilis PrpE and related proteins, metallophosphatase domain Back     alignment and domain information
>TIGR00668 apaH bis(5'-nucleosyl)-tetraphosphatase (symmetrical) Back     alignment and domain information
>PRK11439 pphA serine/threonine protein phosphatase 1; Provisional Back     alignment and domain information
>cd07424 MPP_PrpA_PrpB PrpA and PrpB, metallophosphatase domain Back     alignment and domain information
>cd07421 MPP_Rhilphs Rhilph phosphatases, metallophosphatase domain Back     alignment and domain information
>PHA02239 putative protein phosphatase Back     alignment and domain information
>PRK09968 serine/threonine-specific protein phosphatase 2; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF00149 Metallophos: Calcineurin-like phosphoesterase; InterPro: IPR004843 This domain is found in a diverse range of phosphoesterases [], including protein phosphoserine phosphatases, nucleotidases, sphingomyelin phosphodiesterases and 2'-3' cAMP phosphodiesterases, as well as nucleases such as bacterial SbcD or yeast MRE11 Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>COG0639 ApaH Diadenosine tetraphosphatase and related serine/threonine protein phosphatases [Signal transduction mechanisms] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>cd00841 MPP_YfcE Escherichia coli YfcE and related proteins, metallophosphatase domain Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00040 yfcE phosphoesterase, MJ0936 family Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF12850 Metallophos_2: Calcineurin-like phosphoesterase superfamily domain; InterPro: IPR024654 Domains in this entry are members of the calcineurin-like phosphoesterase domain superfamily [] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PRK09453 phosphodiesterase; Provisional Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>cd07379 MPP_239FB Homo sapiens 239FB and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07397 MPP_DevT Myxococcus xanthus DevT and related proteins, metallophosphatase domain Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>cd07394 MPP_Vps29 Homo sapiens Vps29 and related proteins, metallophosphatase domain Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>cd00838 MPP_superfamily metallophosphatase superfamily, metallophosphatase domain Back     alignment and domain information
>cd07388 MPP_Tt1561 Thermus thermophilus Tt1561 and related proteins, metallophosphatase domain Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PF08321 PPP5: PPP5 TPR repeat region; InterPro: IPR013235 This domain is specific to the PPP5 subfamily of serine/threonine phosphatases Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>cd07404 MPP_MS158 Microscilla MS158 and related proteins, metallophosphatase domain Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK05340 UDP-2,3-diacylglucosamine hydrolase; Provisional Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>cd07392 MPP_PAE1087 Pyrobaculum aerophilum PAE1087 and related proteins, metallophosphatase domain Back     alignment and domain information
>COG0622 Predicted phosphoesterase [General function prediction only] Back     alignment and domain information
>cd07403 MPP_TTHA0053 Thermus thermophilus TTHA0053 and related proteins, metallophosphatase domain Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>TIGR01854 lipid_A_lpxH UDP-2,3-diacylglucosamine hydrolase Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd07399 MPP_YvnB Bacillus subtilis YvnB and related proteins, metallophosphatase domain Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF06874 FBPase_2: Firmicute fructose-1,6-bisphosphatase; InterPro: IPR009164 Fructose 1,6-bisphosphatase catalyses the hydrolysis of fructose 1,6-bisphosphate to fructose 6-phosphate [] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>cd07400 MPP_YydB Bacillus subtilis YydB and related proteins, metallophosphatase domain Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>cd07395 MPP_CSTP1 Homo sapiens CSTP1 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07383 MPP_Dcr2 Saccharomyces cerevisiae DCR2 phosphatase and related proteins, metallophosphatase domain Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PRK11340 phosphodiesterase YaeI; Provisional Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>cd07402 MPP_GpdQ Enterobacter aerogenes GpdQ and related proteins, metallophosphatase domain Back     alignment and domain information
>PRK04036 DNA polymerase II small subunit; Validated Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd07385 MPP_YkuE_C Bacillus subtilis YkuE and related proteins, C-terminal metallophosphatase domain Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd07390 MPP_AQ1575 Aquifex aeolicus AQ1575 and related proteins, metallophosphatase domain Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>cd07391 MPP_PF1019 Pyrococcus furiosus PF1019 and related proteins, metallophosphatase domain Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>cd07384 MPP_Cdc1_like Saccharomyces cerevisiae CDC1 and related proteins, metallophosphatase domain Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>cd08163 MPP_Cdc1 Saccharomyces cerevisiae CDC1 and related proteins, metallophosphatase domain Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR03729 acc_ester putative phosphoesterase Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>TIGR00619 sbcd exonuclease SbcD Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>cd07396 MPP_Nbla03831 Homo sapiens Nbla03831 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd08166 MPP_Cdc1_like_1 uncharacterized subgroup related to Saccharomyces cerevisiae CDC1, metallophosphatase domain Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK11148 cyclic 3',5'-adenosine monophosphate phosphodiesterase; Provisional Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PHA02546 47 endonuclease subunit; Provisional Back     alignment and domain information
>cd00844 MPP_Dbr1_N Dbr1 RNA lariat debranching enzyme, N-terminal metallophosphatase domain Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>KOG4814 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>cd07393 MPP_DR1119 Deinococcus radiodurans DR1119 and related proteins, metallophosphatase domain Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>cd00840 MPP_Mre11_N Mre11 nuclease, N-terminal metallophosphatase domain Back     alignment and domain information
>KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0546 consensus HSP90 co-chaperone CPR7/Cyclophilin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>COG4186 Predicted phosphoesterase or phosphohydrolase [General function prediction only] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>TIGR00024 SbcD_rel_arch putative phosphoesterase, SbcD/Mre11-related Back     alignment and domain information
>KOG0918 consensus Selenium-binding protein [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd08165 MPP_MPPE1 human MPPE1 and related proteins, metallophosphatase domain Back     alignment and domain information
>TIGR00583 mre11 DNA repair protein (mre11) Back     alignment and domain information
>PRK10966 exonuclease subunit SbcD; Provisional Back     alignment and domain information
>cd07398 MPP_YbbF-LpxH Escherichia coli YbbF/LpxH and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07380 MPP_CWF19_N Schizosaccharomyces pombe CWF19 and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG2908 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>cd00839 MPP_PAPs purple acid phosphatases of the metallophosphatase superfamily, metallophosphatase domain Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3325 consensus Membrane coat complex Retromer, subunit VPS29/PEP11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>cd08164 MPP_Ted1 Saccharomyces cerevisiae Ted1 and related proteins, metallophosphatase domain Back     alignment and domain information
>COG2912 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>cd07386 MPP_DNA_pol_II_small_archeal_C archeal DNA polymerase II, small subunit, C-terminal metallophosphatase domain Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>COG1407 Predicted ICC-like phosphoesterases [General function prediction only] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>COG1409 Icc Predicted phosphohydrolases [General function prediction only] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] Back     alignment and domain information
>cd07401 MPP_TMEM62_N Homo sapiens TMEM62, N-terminal metallophosphatase domain Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>COG2912 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG1408 Predicted phosphohydrolases [General function prediction only] Back     alignment and domain information
>COG2129 Predicted phosphoesterases, related to the Icc protein [General function prediction only] Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>COG1311 HYS2 Archaeal DNA polymerase II, small subunit/DNA polymerase delta, subunit B [DNA replication, recombination, and repair] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>cd00845 MPP_UshA_N_like Escherichia coli UshA-like family, N-terminal metallophosphatase domain Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>KOG3662 consensus Cell division control protein/predicted DNA repair exonuclease [Replication, recombination and repair] Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>KOG0529 consensus Protein geranylgeranyltransferase type II, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4151 consensus Myosin assembly protein/sexual cycle protein and related proteins [Posttranslational modification, protein turnover, chaperones; Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>PF10373 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterPro: IPR018834 Est1 is a protein which recruits or activates telomerase at the site of polymerisation [, ] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>cd07378 MPP_ACP5 Homo sapiens acid phosphatase 5 and related proteins, metallophosphatase domain Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>KOG4814 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>PF10373 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterPro: IPR018834 Est1 is a protein which recruits or activates telomerase at the site of polymerisation [, ] Back     alignment and domain information
>COG0420 SbcD DNA repair exonuclease [DNA replication, recombination, and repair] Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] Back     alignment and domain information
>KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF14863 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB: 2YHE_C 2CG2_A 2CG3_A 2CFU_A 2CFZ_A Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only] Back     alignment and domain information
>cd07410 MPP_CpdB_N Escherichia coli CpdB and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PLN02533 probable purple acid phosphatase Back     alignment and domain information
>PF14582 Metallophos_3: Metallophosphoesterase, calcineurin superfamily; PDB: 1UF3_B 2YVT_A Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>cd02682 MIT_AAA_Arch MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>KOG0529 consensus Protein geranylgeranyltransferase type II, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0546 consensus HSP90 co-chaperone CPR7/Cyclophilin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal Back     alignment and domain information
>KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only] Back     alignment and domain information
>COG4941 Predicted RNA polymerase sigma factor containing a TPR repeat domain [Transcription] Back     alignment and domain information
>KOG2422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2863 consensus RNA lariat debranching enzyme [RNA processing and modification] Back     alignment and domain information
>cd07412 MPP_YhcR_N Bacillus subtilis YhcR endonuclease and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>COG3855 Fbp Uncharacterized protein conserved in bacteria [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF10255 Paf67: RNA polymerase I-associated factor PAF67; InterPro: IPR019382 RNA polymerase I is a multi-subunit enzyme and its transcription competence is dependent on the presence of PAF67 [] Back     alignment and domain information
>cd02682 MIT_AAA_Arch MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>cd07408 MPP_SA0022_N Staphylococcus aureus SA0022 and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>KOG3807 consensus Predicted membrane protein ST7 (tumor suppressor in humans) [General function prediction only] Back     alignment and domain information
>PF09670 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02710) Back     alignment and domain information
>PF10255 Paf67: RNA polymerase I-associated factor PAF67; InterPro: IPR019382 RNA polymerase I is a multi-subunit enzyme and its transcription competence is dependent on the presence of PAF67 [] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query486
1wao_1477 Pp5 Structure Length = 477 1e-165
1s95_A333 Structure Of SerineTHREONINE PROTEIN PHOSPHATASE 5 1e-117
3h60_A315 Catalytic Domain Of Human SerineTHREONINE PHOSPHATA 1e-114
3icf_A335 Structure Of Protein SerineTHREONINE PHOSPHATASE FR 2e-75
2o8a_A329 Rat Pp1cgamma Complexed With Mouse Inhibitor-2 Leng 1e-57
1jk7_A323 Crystal Structure Of The Tumor-Promoter Okadaic Aci 1e-57
4g9j_A331 Protein SerTHR PHOSPHATASE-1 In Complex With Cell-P 2e-57
1fjm_A330 Protein SerineTHREONINE PHOSPHATASE-1 (Alpha Isofor 2e-57
3n5u_B300 Crystal Structure Of An Rb C-Terminal Peptide Bound 2e-57
3egg_A329 Crystal Structure Of A Complex Between Protein Phos 2e-57
3e7a_A299 Crystal Structure Of Protein Phosphatase-1 Bound To 3e-57
3v4y_A306 Crystal Structure Of The First Nuclear Pp1 Holoenzy 3e-57
1u32_A293 Crystal Structure Of A Protein Phosphatase-1: Calci 2e-56
1s70_A330 Complex Between Protein Ser/thr Phosphatase-1 (delt 5e-56
1aui_A 521 Human Calcineurin Heterodimer Length = 521 6e-56
1m63_A372 Crystal Structure Of Calcineurin-Cyclophilin-Cyclos 1e-55
2p6b_A383 Crystal Structure Of Human Calcineurin In Complex W 1e-55
1mf8_A373 Crystal Structure Of Human Calcineurin Complexed Wi 1e-55
1tco_A375 Ternary Complex Of A Calcineurin A Fragment, Calcin 2e-55
3ll8_A357 Crystal Structure Of Calcineurin In Complex With Ak 2e-55
2jog_A327 Structure Of The Calcineurin-Nfat Complex Length = 3e-55
3p71_C304 Crystal Structure Of The Complex Of Lcmt-1 And Pp2a 8e-53
2nyl_C293 Crystal Structure Of Protein Phosphatase 2a (Pp2a) 6e-52
2ie3_C309 Structure Of The Protein Phosphatase 2a Core Enzyme 6e-52
2ie4_C309 Structure Of The Protein Phosphatase 2a Core Enzyme 6e-52
3c5w_C310 Complex Between Pp2a-Specific Methylesterase Pme-1 7e-52
2iae_C309 Crystal Structure Of A Protein Phosphatase 2a (Pp2a 2e-51
3fga_C309 Structural Basis Of Pp2a And Sgo Interaction Length 2e-51
1a17_A166 Tetratricopeptide Repeats Of Protein Phosphatase 5 5e-41
2bug_A140 Solution Structure Of The Tpr Domain From Protein P 7e-33
2vyi_A131 Crystal Structure Of The Tpr Domain Of Human Sgt Le 9e-17
3kd7_A125 Designed Tpr Module (Ctpr390) In Complex With Its P 4e-16
4gco_A126 Central Domain Of Stress-Induced Protein-1 (Sti-1) 2e-13
2lni_A133 Solution Nmr Structure Of Stress-Induced-Phosphopro 8e-13
1na0_A125 Design Of Stable Alpha-Helical Arrays From An Ideal 1e-12
2dba_A148 The Solution Structure Of The Tetratrico Peptide Re 4e-12
1elw_A118 Crystal Structure Of The Tpr1 Domain Of Hop In Comp 1e-11
2fo7_A136 Crystal Structure Of An 8 Repeat Consensus Tpr Supe 2e-11
3sz7_A164 Crystal Structure Of The Sgt2 Tpr Domain From Asper 3e-11
2wqh_A125 Crystal Structure Of Ctpr3y3 Length = 125 4e-11
1qz2_A336 Crystal Structure Of Fkbp52 C-Terminal Domain Compl 1e-10
2c2l_A281 Crystal Structure Of The Chip U-Box E3 Ubiquitin Li 2e-10
1p5q_A336 Crystal Structure Of Fkbp52 C-Terminal Domain Lengt 6e-10
3q47_B137 Crystal Structure Of Tpr Domain Of Chip Complexed W 7e-10
1kt0_A457 Structure Of The Large Fkbp-like Protein, Fkbp51, I 2e-08
2gw1_A514 Crystal Structure Of The Yeast Tom70 Length = 514 2e-08
3fp2_A537 Crystal Structure Of Tom71 Complexed With Hsp82 C-T 3e-08
3fp2_A537 Crystal Structure Of Tom71 Complexed With Hsp82 C-T 7e-05
3lca_A533 Structure Of Tom71 Complexed With Hsp70 Ssa1 C Term 3e-08
3lca_A533 Structure Of Tom71 Complexed With Hsp70 Ssa1 C Term 7e-05
1kt1_A457 Structure Of The Large Fkbp-Like Protein, Fkbp51, I 5e-08
3upv_A126 Tpr2b-Domain:phsp70-Complex Of Yeast Sti1 Length = 1e-07
3uq3_A258 Tpr2ab-Domain:phsp90-Complex Of Yeast Sti1 Length = 2e-07
1na3_A91 Design Of Stable Alpha-Helical Arrays From An Ideal 2e-06
1ihg_A370 Bovine Cyclophilin 40, Monoclinic Form Length = 370 3e-06
2avp_A70 Crystal Structure Of An 8 Repeat Consensus Tpr Supe 5e-05
2avp_A70 Crystal Structure Of An 8 Repeat Consensus Tpr Supe 8e-05
3pe3_A 723 Structure Of Human O-Glcnac Transferase And Its Com 8e-05
2fbn_A198 Plasmodium Falciparum Putative Fk506-Binding Protei 9e-05
4gcn_A127 N-Terminal Domain Of Stress-Induced Protein-1 (Sti- 1e-04
1elr_A131 Crystal Structure Of The Tpr2a Domain Of Hop In Com 2e-04
3esk_A129 Structure Of Hop Tpr2a Domain In Complex With The N 3e-04
2l6j_A111 Tah1 Complexed By Meevd Length = 111 5e-04
>pdb|1WAO|1 Chain 1, Pp5 Structure Length = 477 Back     alignment and structure

Iteration: 1

Score = 577 bits (1486), Expect = e-165, Method: Compositional matrix adjust. Identities = 271/475 (57%), Positives = 356/475 (74%), Gaps = 2/475 (0%) Query: 10 SVSRAEELKALANEAFRAKKYSQAIDLYSQAIELNSQNAVYYANRAFAHTKLEEYGSAIQ 69 ++ RAEELK AN+ F+AK Y AI YSQAIELN NA+YY NR+ A+ + E YG A+ Sbjct: 2 ALKRAEELKTQANDYFKAKDYENAIKFYSQAIELNPSNAIYYGNRSLAYLRTECYGYALG 61 Query: 70 DASKAIEIDPRYPKGYYRRGAAYLAMGKFKEALKDFQQVKKLSPNDPDAAQKVKECEKAV 129 DA++AIE+D +Y KGYYRR A+ +A+GKF+ AL+D++ V K+ P+D DA K +EC K V Sbjct: 62 DATRAIELDKKYIKGYYRRAASNMALGKFRAALRDYETVVKVKPHDKDAKMKYQECNKIV 121 Query: 130 KKLKFEEAIAVPESERHSVADSIDYQSIEVEPQYSGARIEGDVITLDFVKKMMDDFKNQK 189 K+ FE AIA E +R SV DS+D +S+ +E +YSG ++E +T+ F+K++M +K+QK Sbjct: 122 KQKAFERAIAGDEHKR-SVVDSLDIESMTIEDEYSGPKLEDGKVTISFMKELMQWYKDQK 180 Query: 190 CLHKRYAFQIVLQTREMLRALPSLVDIDIPDGKHFTVCGDVHGQFYDLLNIFELNGLPSE 249 LH++ A+QI++Q +E+L L +LV+ + + + TVCGD HGQFYDLLNIFELNGLPSE Sbjct: 181 KLHRKCAYQILVQVKEVLSKLSTLVETTLKETEKITVCGDTHGQFYDLLNIFELNGLPSE 240 Query: 250 ENPYLFNGDFVDRGSFSVEVILTLFAFKCMCPSAIYLSRGNHESKSMNKIYGFEGEVRSK 309 NPY+FNGDFVDRGSFSVEVILTLF FK + P +L RGNHE+ +MN+IYGFEGEV++K Sbjct: 241 TNPYIFNGDFVDRGSFSVEVILTLFGFKLLYPDHFHLLRGNHETDNMNQIYGFEGEVKAK 300 Query: 310 LSETFVELFAEVFCCLPLAHVLNQKVFVVHGGLFSVDGVKLSDIKTIDRFCEPPEEGLMC 369 + ELF+EVF LPLA +N KV ++HGGLFS DGV L DI+ I+R +PP+ G MC Sbjct: 301 YTAQMYELFSEVFEWLPLAQCINGKVLIMHGGLFSEDGVTLDDIRKIERNRQPPDSGPMC 360 Query: 370 ELLWSDPQPLPGRGPSKRGVGLSFGADVTKRFLQDNSLGNLVVRSHEVKDEGYEIEHDGK 429 +LLWSDPQP GR SKRGV FG DVTK FL++N+L + ++RSHEVK EGYE+ H G+ Sbjct: 361 DLLWSDPQPQNGRSISKRGVSCQFGPDVTKAFLEENNL-DYIIRSHEVKAEGYEVAHGGR 419 Query: 430 LITVFSAPNYCDQMGNKGAFIRFEAPTLKPNIVTFAAVPHPDVKPMAYANNFLRM 484 +TVFSAPNYCDQMGNK ++I + L+P F AVPHP+VKPMAYAN L++ Sbjct: 420 CVTVFSAPNYCDQMGNKASYIHLQGSDLRPQFHQFTAVPHPNVKPMAYANTLLQL 474
>pdb|1S95|A Chain A, Structure Of SerineTHREONINE PROTEIN PHOSPHATASE 5 Length = 333 Back     alignment and structure
>pdb|3H60|A Chain A, Catalytic Domain Of Human SerineTHREONINE PHOSPHATASE 5 (Pp5c)with Two Mn2+ Atoms Length = 315 Back     alignment and structure
>pdb|3ICF|A Chain A, Structure Of Protein SerineTHREONINE PHOSPHATASE FROM SACCHAROMYCES Cerevisiae With Similarity To Human Phosphatase Pp5 Length = 335 Back     alignment and structure
>pdb|2O8A|A Chain A, Rat Pp1cgamma Complexed With Mouse Inhibitor-2 Length = 329 Back     alignment and structure
>pdb|1JK7|A Chain A, Crystal Structure Of The Tumor-Promoter Okadaic Acid Bound To Protein Phosphatase-1 Length = 323 Back     alignment and structure
>pdb|4G9J|A Chain A, Protein SerTHR PHOSPHATASE-1 In Complex With Cell-Permeable Peptide Length = 331 Back     alignment and structure
>pdb|1FJM|A Chain A, Protein SerineTHREONINE PHOSPHATASE-1 (Alpha Isoform, Type 1) Complexed With Microcystin-Lr Toxin Length = 330 Back     alignment and structure
>pdb|3EGG|A Chain A, Crystal Structure Of A Complex Between Protein Phosphatase 1 Alpha (Pp1) And The Pp1 Binding And Pdz Domains Of Spinophilin Length = 329 Back     alignment and structure
>pdb|3E7A|A Chain A, Crystal Structure Of Protein Phosphatase-1 Bound To The Natural Toxin Nodularin-R Length = 299 Back     alignment and structure
>pdb|3V4Y|A Chain A, Crystal Structure Of The First Nuclear Pp1 Holoenzyme Length = 306 Back     alignment and structure
>pdb|1U32|A Chain A, Crystal Structure Of A Protein Phosphatase-1: Calcineurin Hybrid Bound To Okadaic Acid Length = 293 Back     alignment and structure
>pdb|1S70|A Chain A, Complex Between Protein Ser/thr Phosphatase-1 (delta) And The Myosin Phosphatase Targeting Subunit 1 (mypt1) Length = 330 Back     alignment and structure
>pdb|1AUI|A Chain A, Human Calcineurin Heterodimer Length = 521 Back     alignment and structure
>pdb|1M63|A Chain A, Crystal Structure Of Calcineurin-Cyclophilin-Cyclosporin Shows Common But Distinct Recognition Of Immunophilin-Drug Complexes Length = 372 Back     alignment and structure
>pdb|2P6B|A Chain A, Crystal Structure Of Human Calcineurin In Complex With Pvivit Peptide Length = 383 Back     alignment and structure
>pdb|1MF8|A Chain A, Crystal Structure Of Human Calcineurin Complexed With Cyclosporin A And Human Cyclophilin Length = 373 Back     alignment and structure
>pdb|1TCO|A Chain A, Ternary Complex Of A Calcineurin A Fragment, Calcineurin B, Fkbp12 And The Immunosuppressant Drug Fk506 (tacrolimus) Length = 375 Back     alignment and structure
>pdb|3LL8|A Chain A, Crystal Structure Of Calcineurin In Complex With Akap79 Peptide Length = 357 Back     alignment and structure
>pdb|2JOG|A Chain A, Structure Of The Calcineurin-Nfat Complex Length = 327 Back     alignment and structure
>pdb|3P71|C Chain C, Crystal Structure Of The Complex Of Lcmt-1 And Pp2a Length = 304 Back     alignment and structure
>pdb|2NYL|C Chain C, Crystal Structure Of Protein Phosphatase 2a (Pp2a) Holoenzyme With The Catalytic Subunit Carboxyl Terminus Truncated Length = 293 Back     alignment and structure
>pdb|2IE3|C Chain C, Structure Of The Protein Phosphatase 2a Core Enzyme Bound To Tumor- Inducing Toxins Length = 309 Back     alignment and structure
>pdb|2IE4|C Chain C, Structure Of The Protein Phosphatase 2a Core Enzyme Bound To Okadaic Acid Length = 309 Back     alignment and structure
>pdb|3C5W|C Chain C, Complex Between Pp2a-Specific Methylesterase Pme-1 And Pp2a Core Enzyme Length = 310 Back     alignment and structure
>pdb|2IAE|C Chain C, Crystal Structure Of A Protein Phosphatase 2a (Pp2a) Holoenzyme. Length = 309 Back     alignment and structure
>pdb|3FGA|C Chain C, Structural Basis Of Pp2a And Sgo Interaction Length = 309 Back     alignment and structure
>pdb|1A17|A Chain A, Tetratricopeptide Repeats Of Protein Phosphatase 5 Length = 166 Back     alignment and structure
>pdb|2VYI|A Chain A, Crystal Structure Of The Tpr Domain Of Human Sgt Length = 131 Back     alignment and structure
>pdb|3KD7|A Chain A, Designed Tpr Module (Ctpr390) In Complex With Its Peptide-Ligand (Hsp90 Peptide) Length = 125 Back     alignment and structure
>pdb|4GCO|A Chain A, Central Domain Of Stress-Induced Protein-1 (Sti-1) From C.Elegans Length = 126 Back     alignment and structure
>pdb|2LNI|A Chain A, Solution Nmr Structure Of Stress-Induced-Phosphoprotein 1 Sti1 From Homo Sapiens, Northeast Structural Genomics Consortium Target Hr4403e Length = 133 Back     alignment and structure
>pdb|1NA0|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif Length = 125 Back     alignment and structure
>pdb|2DBA|A Chain A, The Solution Structure Of The Tetratrico Peptide Repeat Of Human Smooth Muscle Cell Associated Protein-1, Isoform 2 Length = 148 Back     alignment and structure
>pdb|1ELW|A Chain A, Crystal Structure Of The Tpr1 Domain Of Hop In Complex With A Hsc70 Peptide Length = 118 Back     alignment and structure
>pdb|2FO7|A Chain A, Crystal Structure Of An 8 Repeat Consensus Tpr Superhelix (Trigonal Crystal Form) Length = 136 Back     alignment and structure
>pdb|3SZ7|A Chain A, Crystal Structure Of The Sgt2 Tpr Domain From Aspergillus Fumigatus Length = 164 Back     alignment and structure
>pdb|2WQH|A Chain A, Crystal Structure Of Ctpr3y3 Length = 125 Back     alignment and structure
>pdb|1QZ2|A Chain A, Crystal Structure Of Fkbp52 C-Terminal Domain Complex With The C-Terminal Peptide Meevd Of Hsp90 Length = 336 Back     alignment and structure
>pdb|2C2L|A Chain A, Crystal Structure Of The Chip U-Box E3 Ubiquitin Ligase Length = 281 Back     alignment and structure
>pdb|1P5Q|A Chain A, Crystal Structure Of Fkbp52 C-Terminal Domain Length = 336 Back     alignment and structure
>pdb|3Q47|B Chain B, Crystal Structure Of Tpr Domain Of Chip Complexed With Pseudophosphorylated Smad1 Peptide Length = 137 Back     alignment and structure
>pdb|1KT0|A Chain A, Structure Of The Large Fkbp-like Protein, Fkbp51, Involved In Steroid Receptor Complexes Length = 457 Back     alignment and structure
>pdb|2GW1|A Chain A, Crystal Structure Of The Yeast Tom70 Length = 514 Back     alignment and structure
>pdb|3FP2|A Chain A, Crystal Structure Of Tom71 Complexed With Hsp82 C-Terminal Fragment Length = 537 Back     alignment and structure
>pdb|3FP2|A Chain A, Crystal Structure Of Tom71 Complexed With Hsp82 C-Terminal Fragment Length = 537 Back     alignment and structure
>pdb|3LCA|A Chain A, Structure Of Tom71 Complexed With Hsp70 Ssa1 C Terminal Tail Indicating Conformational Plasticity Length = 533 Back     alignment and structure
>pdb|3LCA|A Chain A, Structure Of Tom71 Complexed With Hsp70 Ssa1 C Terminal Tail Indicating Conformational Plasticity Length = 533 Back     alignment and structure
>pdb|1KT1|A Chain A, Structure Of The Large Fkbp-Like Protein, Fkbp51, Involved In Steroid Receptor Complexes Length = 457 Back     alignment and structure
>pdb|3UPV|A Chain A, Tpr2b-Domain:phsp70-Complex Of Yeast Sti1 Length = 126 Back     alignment and structure
>pdb|3UQ3|A Chain A, Tpr2ab-Domain:phsp90-Complex Of Yeast Sti1 Length = 258 Back     alignment and structure
>pdb|1NA3|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif Length = 91 Back     alignment and structure
>pdb|1IHG|A Chain A, Bovine Cyclophilin 40, Monoclinic Form Length = 370 Back     alignment and structure
>pdb|2AVP|A Chain A, Crystal Structure Of An 8 Repeat Consensus Tpr Superhelix Length = 70 Back     alignment and structure
>pdb|2AVP|A Chain A, Crystal Structure Of An 8 Repeat Consensus Tpr Superhelix Length = 70 Back     alignment and structure
>pdb|3PE3|A Chain A, Structure Of Human O-Glcnac Transferase And Its Complex With A Peptide Substrate Length = 723 Back     alignment and structure
>pdb|2FBN|A Chain A, Plasmodium Falciparum Putative Fk506-Binding Protein Pfl2275c, C-Terminal Tpr-Containing Domain Length = 198 Back     alignment and structure
>pdb|4GCN|A Chain A, N-Terminal Domain Of Stress-Induced Protein-1 (Sti-1) From C.Elegans Length = 127 Back     alignment and structure
>pdb|1ELR|A Chain A, Crystal Structure Of The Tpr2a Domain Of Hop In Complex With The Hsp90 Peptide Meevd Length = 131 Back     alignment and structure
>pdb|3ESK|A Chain A, Structure Of Hop Tpr2a Domain In Complex With The Non-Cognate Hsc70 Peptide Ligand Length = 129 Back     alignment and structure
>pdb|2L6J|A Chain A, Tah1 Complexed By Meevd Length = 111 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query486
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 0.0
3h63_A315 Serine/threonine-protein phosphatase 5; metalloenz 0.0
3icf_A335 PPT, serine/threonine-protein phosphatase T; IRO m 0.0
3ll8_A357 Serine/threonine-protein phosphatase 2B catalytic 1e-117
1aui_A 521 Calcineurin, serine/threonine phosphatase 2B; hydr 1e-112
2ie4_C309 PP2A-alpha;, serine/threonine-protein phosphatase 1e-109
1fjm_A330 Protein serine/threonine phosphatase-1 (alpha ISO 1e-107
3e7a_A299 PP-1A, serine/threonine-protein phosphatase PP1-al 1e-106
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 3e-70
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 4e-57
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 2e-55
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 5e-55
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 7e-55
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 6e-17
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 7e-55
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 2e-54
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 8e-53
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 1e-52
3q49_B137 STIP1 homology and U box-containing protein 1; E3 1e-51
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 3e-47
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 2e-44
2l6j_A111 TPR repeat-containing protein associated with HSP; 4e-41
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 7e-39
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 8e-39
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 4e-38
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 2e-33
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 1e-29
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 2e-19
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 4e-18
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 2e-16
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 3e-37
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 1e-31
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 3e-29
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 1e-19
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 5e-19
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 3e-18
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 2e-08
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 7e-36
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 1e-35
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 2e-30
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 4e-25
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 2e-23
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 2e-17
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 5e-15
2gw1_A514 Mitochondrial precursor proteins import receptor; 2e-34
2gw1_A514 Mitochondrial precursor proteins import receptor; 1e-27
2gw1_A514 Mitochondrial precursor proteins import receptor; 3e-26
2gw1_A514 Mitochondrial precursor proteins import receptor; 6e-26
2gw1_A514 Mitochondrial precursor proteins import receptor; 3e-25
2gw1_A514 Mitochondrial precursor proteins import receptor; 2e-21
2gw1_A514 Mitochondrial precursor proteins import receptor; 9e-21
2gw1_A514 Mitochondrial precursor proteins import receptor; 4e-13
2gw1_A514 Mitochondrial precursor proteins import receptor; 9e-07
2gw1_A514 Mitochondrial precursor proteins import receptor; 4e-06
2gw1_A 514 Mitochondrial precursor proteins import receptor; 5e-04
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-30
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 3e-25
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-22
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 1e-20
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-20
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-19
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 1e-14
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-06
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 7e-06
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 2e-29
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 4e-16
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 5e-27
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 2e-26
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 2e-23
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 2e-23
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 1e-22
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 3e-22
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 7e-22
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 1e-14
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 9e-14
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 1e-04
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 4e-26
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 2e-23
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 1e-20
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 8e-15
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 4e-07
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 2e-25
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 3e-13
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 3e-25
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 9e-16
3u4t_A272 TPR repeat-containing protein; structural genomics 6e-25
3u4t_A272 TPR repeat-containing protein; structural genomics 7e-25
3u4t_A272 TPR repeat-containing protein; structural genomics 5e-23
3u4t_A272 TPR repeat-containing protein; structural genomics 4e-22
3u4t_A272 TPR repeat-containing protein; structural genomics 2e-15
3u4t_A272 TPR repeat-containing protein; structural genomics 8e-11
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 1e-24
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 4e-24
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 7e-24
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 9e-24
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 1e-23
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 1e-23
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 4e-23
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 4e-23
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 3e-21
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 8e-17
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 3e-12
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 7e-24
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 3e-23
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 2e-19
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 8e-13
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 9e-08
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 3e-23
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 2e-20
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 4e-17
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 1e-16
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 3e-06
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-22
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-21
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 3e-20
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 3e-19
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 3e-19
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 9e-19
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-18
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 3e-18
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 4e-18
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-17
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-16
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-14
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 4e-13
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-12
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-09
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-09
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-09
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 2e-22
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 3e-21
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 7e-12
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 2e-22
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 1e-19
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 6e-19
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 7e-18
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 1e-17
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 2e-16
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 2e-12
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 5e-11
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 2e-09
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 3e-09
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 2e-07
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 5e-04
2z72_A342 Protein-tyrosine-phosphatase; cold-active enzyme, 2e-22
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 3e-22
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 9e-21
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 7e-17
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 5e-22
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 8e-20
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 9e-19
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 1e-13
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 3e-10
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 5e-22
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 3e-17
2kat_A115 Uncharacterized protein; NESG, structure, structur 2e-21
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 4e-21
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 7e-20
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 9e-14
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 6e-21
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 9e-18
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 3e-17
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 4e-11
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 2e-05
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 2e-20
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 2e-19
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 9e-19
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 9e-16
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 1e-15
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 1e-15
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 1e-12
4eqf_A365 PEX5-related protein; accessory protein, tetratric 4e-20
4eqf_A365 PEX5-related protein; accessory protein, tetratric 2e-18
4eqf_A365 PEX5-related protein; accessory protein, tetratric 8e-17
4eqf_A365 PEX5-related protein; accessory protein, tetratric 5e-16
4eqf_A365 PEX5-related protein; accessory protein, tetratric 1e-12
4eqf_A365 PEX5-related protein; accessory protein, tetratric 7e-10
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 5e-20
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 1e-13
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 1e-13
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 8e-19
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 1e-18
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 1e-16
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 4e-16
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 4e-14
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 6e-18
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 1e-15
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 3e-15
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 7e-13
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 1e-17
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 2e-14
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 4e-09
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 3e-08
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 1e-17
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 3e-17
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 4e-12
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 2e-08
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 2e-17
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 4e-17
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 1e-15
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 4e-15
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 2e-14
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 9e-17
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 1e-09
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 2e-16
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 1e-11
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 2e-16
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 1e-15
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 7e-14
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 7e-12
3k9i_A117 BH0479 protein; putative protein binding protein, 9e-16
3k9i_A117 BH0479 protein; putative protein binding protein, 5e-08
3k9i_A117 BH0479 protein; putative protein binding protein, 6e-07
4g1t_A472 Interferon-induced protein with tetratricopeptide 1e-15
4g1t_A472 Interferon-induced protein with tetratricopeptide 2e-14
4g1t_A472 Interferon-induced protein with tetratricopeptide 3e-13
4g1t_A472 Interferon-induced protein with tetratricopeptide 1e-10
4g1t_A472 Interferon-induced protein with tetratricopeptide 2e-09
4g1t_A472 Interferon-induced protein with tetratricopeptide 5e-09
4g1t_A472 Interferon-induced protein with tetratricopeptide 2e-06
4g1t_A472 Interferon-induced protein with tetratricopeptide 2e-06
1g5b_A221 Serine/threonine protein phosphatase; bacteriophag 4e-15
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 5e-15
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 2e-12
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 6e-04
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 1e-14
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 2e-14
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 3e-11
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 1e-05
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 3e-13
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 9e-13
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 1e-08
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 3e-06
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 7e-13
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 1e-12
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 1e-12
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 3e-11
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 9e-12
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 2e-10
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 2e-07
2qjc_A262 Diadenosine tetraphosphatase, putative; putative d 1e-10
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 2e-09
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 2e-06
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 4e-05
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 1e-04
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 2e-04
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 6e-09
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 3e-06
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 3e-05
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 1e-04
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 3e-04
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 2e-08
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 4e-08
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 3e-05
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 7e-08
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 2e-07
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 4e-06
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 1e-04
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 1e-04
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 2e-07
3q15_A378 PSP28, response regulator aspartate phosphatase H; 2e-07
3q15_A378 PSP28, response regulator aspartate phosphatase H; 2e-06
3q15_A378 PSP28, response regulator aspartate phosphatase H; 2e-06
3q15_A378 PSP28, response regulator aspartate phosphatase H; 3e-06
3q15_A378 PSP28, response regulator aspartate phosphatase H; 2e-04
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 3e-07
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 3e-06
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 8e-06
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 1e-04
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 7e-04
2dfj_A280 Diadenosinetetraphosphatase; helices and strands m 3e-07
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 6e-07
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 3e-04
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 6e-07
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 5e-06
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 2e-05
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 6e-05
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 5e-05
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 2e-04
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 6e-05
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 5e-04
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 9e-05
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 9e-05
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 1e-04
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 9e-04
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 2e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-04
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Length = 477 Back     alignment and structure
 Score =  757 bits (1956), Expect = 0.0
 Identities = 271/477 (56%), Positives = 356/477 (74%), Gaps = 2/477 (0%)

Query: 9   SSVSRAEELKALANEAFRAKKYSQAIDLYSQAIELNSQNAVYYANRAFAHTKLEEYGSAI 68
            ++ RAEELK  AN+ F+AK Y  AI  YSQAIELN  NA+YY NR+ A+ + E YG A+
Sbjct: 1   GALKRAEELKTQANDYFKAKDYENAIKFYSQAIELNPSNAIYYGNRSLAYLRTECYGYAL 60

Query: 69  QDASKAIEIDPRYPKGYYRRGAAYLAMGKFKEALKDFQQVKKLSPNDPDAAQKVKECEKA 128
            DA++AIE+D +Y KGYYRR A+ +A+GKF+ AL+D++ V K+ P+D DA  K +EC K 
Sbjct: 61  GDATRAIELDKKYIKGYYRRAASNMALGKFRAALRDYETVVKVKPHDKDAKMKYQECNKI 120

Query: 129 VKKLKFEEAIAVPESERHSVADSIDYQSIEVEPQYSGARIEGDVITLDFVKKMMDDFKNQ 188
           VK+  FE AIA  E +R SV DS+D +S+ +E +YSG ++E   +T+ F+K++M  +K+Q
Sbjct: 121 VKQKAFERAIAGDEHKR-SVVDSLDIESMTIEDEYSGPKLEDGKVTISFMKELMQWYKDQ 179

Query: 189 KCLHKRYAFQIVLQTREMLRALPSLVDIDIPDGKHFTVCGDVHGQFYDLLNIFELNGLPS 248
           K LH++ A+QI++Q +E+L  L +LV+  + + +  TVCGD HGQFYDLLNIFELNGLPS
Sbjct: 180 KKLHRKCAYQILVQVKEVLSKLSTLVETTLKETEKITVCGDTHGQFYDLLNIFELNGLPS 239

Query: 249 EENPYLFNGDFVDRGSFSVEVILTLFAFKCMCPSAIYLSRGNHESKSMNKIYGFEGEVRS 308
           E NPY+FNGDFVDRGSFSVEVILTLF FK + P   +L RGNHE+ +MN+IYGFEGEV++
Sbjct: 240 ETNPYIFNGDFVDRGSFSVEVILTLFGFKLLYPDHFHLLRGNHETDNMNQIYGFEGEVKA 299

Query: 309 KLSETFVELFAEVFCCLPLAHVLNQKVFVVHGGLFSVDGVKLSDIKTIDRFCEPPEEGLM 368
           K +    ELF+EVF  LPLA  +N KV ++HGGLFS DGV L DI+ I+R  +PP+ G M
Sbjct: 300 KYTAQMYELFSEVFEWLPLAQCINGKVLIMHGGLFSEDGVTLDDIRKIERNRQPPDSGPM 359

Query: 369 CELLWSDPQPLPGRGPSKRGVGLSFGADVTKRFLQDNSLGNLVVRSHEVKDEGYEIEHDG 428
           C+LLWSDPQP  GR  SKRGV   FG DVTK FL++N+L + ++RSHEVK EGYE+ H G
Sbjct: 360 CDLLWSDPQPQNGRSISKRGVSCQFGPDVTKAFLEENNL-DYIIRSHEVKAEGYEVAHGG 418

Query: 429 KLITVFSAPNYCDQMGNKGAFIRFEAPTLKPNIVTFAAVPHPDVKPMAYANNFLRMF 485
           + +TVFSAPNYCDQMGNK ++I  +   L+P    F AVPHP+VKPMAYAN  L++ 
Sbjct: 419 RCVTVFSAPNYCDQMGNKASYIHLQGSDLRPQFHQFTAVPHPNVKPMAYANTLLQLG 475


>3h63_A Serine/threonine-protein phosphatase 5; metalloenzyme, inhibitors, drug design, cytoplasm, hydrolase, iron, manganese, metal-binding, nucleus; HET: NHC; 1.30A {Homo sapiens} PDB: 3h60_A* 3h61_A* 3h62_C* 3h64_A* 3h66_A 3h67_A* 3h68_A* 3h69_A* 1s95_A Length = 315 Back     alignment and structure
>3icf_A PPT, serine/threonine-protein phosphatase T; IRO metalloprotein, structural genomics, PSI-2, protein structu initiative; 2.30A {Saccharomyces cerevisiae} Length = 335 Back     alignment and structure
>3ll8_A Serine/threonine-protein phosphatase 2B catalytic alpha isoform; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 2p6b_A 1m63_A* 1tco_A* 1mf8_A* 2jog_A Length = 357 Back     alignment and structure
>1aui_A Calcineurin, serine/threonine phosphatase 2B; hydrolase, immunosuppression; 2.10A {Homo sapiens} SCOP: d.159.1.3 Length = 521 Back     alignment and structure
>2ie4_C PP2A-alpha;, serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform; protein-protein complex, heat repeat, signaling protein; HET: OKA; 2.60A {Homo sapiens} SCOP: d.159.1.3 PDB: 2npp_C* 3dw8_C* 3k7v_C* 3k7w_C* 3c5w_C 2ie3_C* 3fga_C* 2iae_C* 3p71_C* 2nym_C* 2nyl_C* Length = 309 Back     alignment and structure
>1fjm_A Protein serine/threonine phosphatase-1 (alpha ISO 1); hydrolase, toxin, hydrolase-hydrolase inhibitor complex; HET: 1ZN; 2.10A {Oryctolagus cuniculus} SCOP: d.159.1.3 Length = 330 Back     alignment and structure
>3e7a_A PP-1A, serine/threonine-protein phosphatase PP1-alpha Ca subunit; carbohydrate metabolism, cell cycle, cell division; HET: 1ZN; 1.63A {Homo sapiens} PDB: 3e7b_A* 3egg_A* 3egh_A* 3hvq_A 3n5u_A 1jk7_A* 1it6_A* 2bcd_A* 2bdx_A* 2o8g_A 2o8a_A 1u32_A* 1s70_A* Length = 299 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Length = 166 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Length = 118 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Length = 126 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 148 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Length = 111 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Length = 162 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Length = 198 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Length = 338 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Length = 370 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2z72_A Protein-tyrosine-phosphatase; cold-active enzyme, psychrophIle, hydrolase; 1.10A {Shewanella SP} PDB: 1v73_A 2zbm_A Length = 342 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>1g5b_A Serine/threonine protein phosphatase; bacteriophage lambda, Ser/Thr protein phosphatase, ppase, manganese, sulfate, viral protein; 2.15A {Enterobacteria phage lambda} SCOP: d.159.1.3 Length = 221 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Length = 159 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Length = 372 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Length = 372 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Length = 372 Back     alignment and structure
>2qjc_A Diadenosine tetraphosphatase, putative; putative diadenosine tetraphosphatase, monomer, PSI- 2, protein structure initiative, nysgrc; 2.05A {Trypanosoma brucei} Length = 262 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Length = 129 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>2dfj_A Diadenosinetetraphosphatase; helices and strands mixture, hydrolase; 2.72A {Shigella flexneri 2A} Length = 280 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Length = 261 Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Length = 282 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Length = 292 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Length = 292 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Length = 373 Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Length = 225 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Length = 293 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query486
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 100.0
3h63_A315 Serine/threonine-protein phosphatase 5; metalloenz 100.0
3icf_A335 PPT, serine/threonine-protein phosphatase T; IRO m 100.0
3ll8_A357 Serine/threonine-protein phosphatase 2B catalytic 100.0
3e7a_A299 PP-1A, serine/threonine-protein phosphatase PP1-al 100.0
1aui_A 521 Calcineurin, serine/threonine phosphatase 2B; hydr 100.0
2ie4_C309 PP2A-alpha;, serine/threonine-protein phosphatase 100.0
1fjm_A330 Protein serine/threonine phosphatase-1 (alpha ISO 100.0
2z72_A342 Protein-tyrosine-phosphatase; cold-active enzyme, 100.0
2dfj_A280 Diadenosinetetraphosphatase; helices and strands m 99.97
2qjc_A262 Diadenosine tetraphosphatase, putative; putative d 99.87
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.84
1g5b_A221 Serine/threonine protein phosphatase; bacteriophag 99.8
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.78
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.76
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.75
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.74
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.74
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.74
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.74
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.73
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.72
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.72
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.71
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.71
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.71
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.7
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.7
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.7
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.7
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.69
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.68
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.68
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.67
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.67
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.65
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.65
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.64
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.63
3rqz_A246 Metallophosphoesterase; PSI-biology, midwest cente 99.63
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.63
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.62
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.62
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.62
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.62
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.62
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.61
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.6
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.6
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.59
1nnw_A252 Hypothetical protein; structural genomics, PSI, pr 99.59
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.58
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.58
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.58
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.58
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.58
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.57
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.56
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.56
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.55
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 99.55
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.55
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.55
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.55
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.54
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 99.54
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.54
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.54
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.54
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.54
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.53
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.53
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.53
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.52
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.52
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.52
3u4t_A272 TPR repeat-containing protein; structural genomics 99.52
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.51
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.51
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.51
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.51
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.51
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.51
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.5
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.5
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.5
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.5
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.5
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.5
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.49
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.49
3qfm_A270 SAPH, putative uncharacterized protein; sandwich f 99.49
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.48
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.48
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.48
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.48
3k9i_A117 BH0479 protein; putative protein binding protein, 99.47
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.47
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.46
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.46
3u4t_A272 TPR repeat-containing protein; structural genomics 99.45
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.44
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.44
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.42
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.4
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.39
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.39
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.39
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.39
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.39
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.38
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.37
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.37
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.37
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.36
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.35
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.35
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.35
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.35
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.35
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.35
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.34
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.34
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.33
2l6j_A111 TPR repeat-containing protein associated with HSP; 99.33
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.33
2kat_A115 Uncharacterized protein; NESG, structure, structur 99.32
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.32
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.32
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.31
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.3
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.29
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.29
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.29
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 99.28
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.27
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.27
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.27
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.26
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.25
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.24
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.23
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.23
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 99.22
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.21
2l6j_A111 TPR repeat-containing protein associated with HSP; 99.21
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 99.21
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.2
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 99.2
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.2
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.2
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.19
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.18
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.18
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 99.17
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.17
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.16
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 99.16
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.16
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.16
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.16
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 99.14
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.14
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 99.14
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.14
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.14
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.14
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.13
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.12
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.12
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.12
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 99.1
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.1
3k9i_A117 BH0479 protein; putative protein binding protein, 99.1
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.08
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 99.08
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 99.08
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.08
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.07
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.07
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.07
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.06
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.06
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 99.06
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.06
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.06
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.06
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.04
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.0
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.99
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 98.99
3q15_A378 PSP28, response regulator aspartate phosphatase H; 98.97
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.97
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.97
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.91
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.9
2kat_A115 Uncharacterized protein; NESG, structure, structur 98.9
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 98.9
1pc2_A152 Mitochondria fission protein; unknown function; NM 98.89
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.84
1s3l_A190 Hypothetical protein MJ0936; phosphodiesterase, nu 98.84
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 98.8
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 98.77
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 98.75
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 98.74
3qww_A433 SET and MYND domain-containing protein 2; methyltr 98.7
1uf3_A228 Hypothetical protein TT1561; metallo-dependent pho 98.7
2a22_A215 Vacuolar protein sorting 29; alpha-beta-BETA-alpha 98.7
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 98.69
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 98.68
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 98.68
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 98.67
2kkn_A178 Uncharacterized protein; protein phosphatase 2A ho 98.67
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.67
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 98.65
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 98.63
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.63
3ck2_A176 Conserved uncharacterized protein (predicted phosp 98.61
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 98.61
1z2w_A192 Vacuolar protein sorting 29; VPS29, retromer, phos 98.61
1xi4_A1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 98.59
1su1_A208 Hypothetical protein YFCE; structural genomics, ph 98.58
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.57
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 98.47
1xm7_A195 Hypothetical protein AQ_1665; structural genomics, 98.45
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 98.44
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.4
3ib7_A330 ICC protein; metallophosphoesterase, alpha-beta fo 98.4
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 98.35
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 98.34
1xi4_A1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 98.29
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.26
1pc2_A152 Mitochondria fission protein; unknown function; NM 98.25
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 98.25
3d03_A274 Phosphohydrolase; glycerophosphodiesterase, metall 98.23
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 98.21
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 98.19
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 98.17
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 98.15
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.94
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.92
2nxf_A322 Putative dimetal phosphatase; dinuclear metal cent 97.9
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 97.9
3rl5_A296 Metallophosphoesterase mpped2; alpha-beta fold, me 97.8
2yvt_A260 Hypothetical protein AQ_1956; structural genomics, 97.77
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 97.68
2xmo_A 443 LMO2642 protein; phosphodiesterase, hydrolase; 1.7 97.62
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 97.61
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 97.6
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 97.52
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 97.48
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 97.32
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 97.25
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 97.03
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 96.94
3av0_A386 DNA double-strand break repair protein MRE11; DNA 96.77
2q8u_A336 Exonuclease, putative; structural genomics, joint 96.69
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 96.68
1ii7_A333 MRE11 nuclease; RAD50, DNA double-strand break rep 96.61
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 96.27
1ute_A313 Protein (II purple acid phosphatase); tartrate res 96.23
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 96.07
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 95.79
4g26_A501 Pentatricopeptide repeat-containing protein AT2G3 95.66
3kae_A242 CDC27, possible protein of nuclear scaffold; tetra 95.51
3tho_B379 Exonuclease, putative; adenosine triphosphate, bac 95.45
4fbk_A 472 DNA repair and telomere maintenance protein NBS1, 95.24
4g26_A501 Pentatricopeptide repeat-containing protein AT2G3 95.18
1ya0_A497 SMG-7 transcript variant 2; alpha-helical repeat, 95.17
4fbw_A 417 DNA repair protein RAD32; DNA double-strand break 95.16
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 95.16
4gns_B754 Protein CSD3, chitin biosynthesis protein CHS6; FN 95.04
3t1i_A 431 Double-strand break repair protein MRE11A; DNA rep 95.04
4gns_B754 Protein CSD3, chitin biosynthesis protein CHS6; FN 95.03
1ya0_A497 SMG-7 transcript variant 2; alpha-helical repeat, 94.8
2qfp_A424 Purple acid phosphatase; binuclear, Fe-Zn, hydrola 94.65
1xzw_A426 Purple acid phosphatase; hydrolase; HET: NAG FUC M 93.84
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 93.31
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 92.64
3kae_A242 CDC27, possible protein of nuclear scaffold; tetra 92.55
4b4t_R429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 92.46
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 91.46
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 91.02
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 90.88
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 90.16
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 89.21
3tgh_A342 Glideosome-associated protein 50; phosphatase fold 88.9
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 88.82
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 88.36
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 87.68
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 87.55
3qfk_A 527 Uncharacterized protein; structural genomics, cent 86.53
2z1a_A 552 5'-nucleotidase; metal-binding, nucleotide-binding 81.53
1hp1_A 516 5'-nucleotidase; metallophosphatase, dinuclear, me 80.85
4h2g_A 546 5'-nucleotidase; dimer, hydrolase, phosphatase, ex 80.32
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 80.13
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
Probab=100.00  E-value=1.4e-90  Score=722.22  Aligned_cols=471  Identities=58%  Similarity=0.997  Sum_probs=440.7

Q ss_pred             cHHHHHHHHHHHHHHHHccCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHccCHHHHHHHHHHHHHhCCCCHHHHHHHH
Q 011417           10 SVSRAEELKALANEAFRAKKYSQAIDLYSQAIELNSQNAVYYANRAFAHTKLEEYGSAIQDASKAIEIDPRYPKGYYRRG   89 (486)
Q Consensus        10 ~~~~~~~~~~~g~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~lg~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~lg   89 (486)
                      .++.+.++..+|..+++.|+|++|+++|++|++++|+++.++.++|.+|..+|++++|++.+++|++++|+++.+++++|
T Consensus         2 ~~~~a~~~~~lg~~~~~~g~~~~A~~~~~~Al~~~p~~~~~~~~lg~~~~~~g~~~~A~~~~~~al~l~p~~~~~~~~lg   81 (477)
T 1wao_1            2 ALKRAEELKTQANDYFKAKDYENAIKFYSQAIELNPSNAIYYGNRSLAYLRTECYGYALGDATRAIELDKKYIKGYYRRA   81 (477)
T ss_dssp             CHHHHTTSSSSSSSTTTTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHSCTTCHHHHHHHH
T ss_pred             hHhHHHHHHHHHHHHHHhCCHHHHHHHHHHHHHhCCccHHHHHHHHHHHHHhcCHHHHHHHHHHHHHhCCCCHHHHHHHH
Confidence            45677888999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHHhhHHHHHhhcCcccccccccccccccccccCCcCCCCccc
Q 011417           90 AAYLAMGKFKEALKDFQQVKKLSPNDPDAAQKVKECEKAVKKLKFEEAIAVPESERHSVADSIDYQSIEVEPQYSGARIE  169 (486)
Q Consensus        90 ~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~l~~~~~~~A~~~~~~~~~~~a~~~~~~~l~~~~~~~~~~l~  169 (486)
                      .+|..+|++++|++.|+++++++|+++.++..++.+......+++++|+..++... ........+++.++|.+.++.+.
T Consensus        82 ~~~~~~g~~~eA~~~~~~al~~~p~~~~~~~~l~~~~~~~~~g~~~~A~~~~~~~~-~~~~~~~~~al~~~~~~~~~~~~  160 (477)
T 1wao_1           82 ASNMALGKFRAALRDYETVVKVKPHDKDAKMKYQECNKIVKQKAFERAIAGDEHKR-SVVDSLDIESMTIEDEYSGPKLE  160 (477)
T ss_dssp             HHHHHHTCHHHHHHHHHHHHHHSTTCTTHHHHHHHHHHHHHHHHHCCC------CC-STTTCCTTSSCCCCTTCCSCCCG
T ss_pred             HHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHHHHHHHHHHhccccccc-hhHhhhhhhhccccccccccccc
Confidence            99999999999999999999999999999999999966677777999999877422 23334455888999999999888


Q ss_pred             CCCccHHHHHHHHHHHhcccchhhHHHHHHHHHHHHHHhcCCCcccccCCCCCceEEEccCCCChHHHHHHHHHcCCCCC
Q 011417          170 GDVITLDFVKKMMDDFKNQKCLHKRYAFQIVLQTREMLRALPSLVDIDIPDGKHFTVCGDVHGQFYDLLNIFELNGLPSE  249 (486)
Q Consensus       170 ~~~l~~~~l~~l~e~l~~~~~l~~~e~~~ll~~a~~~l~~ep~~~~i~~~~~~~~~v~GDihG~~~~l~~~l~~~~~~~~  249 (486)
                      ...++...++.+++.++..+.+++.++..+|.++.+++.++|+++++..|...++.++||+||++.+|.++|+..+.++.
T Consensus       161 ~~~itl~~l~~lie~l~~~~~l~e~~v~~L~~~a~eil~~e~~~~~~~~~~~~~~~vigDiHG~~~~l~~~l~~~~~~~~  240 (477)
T 1wao_1          161 DGKVTISFMKELMQWYKDQKKLHRKCAYQILVQVKEVLSKLSTLVETTLKETEKITVCGDTHGQFYDLLNIFELNGLPSE  240 (477)
T ss_dssp             GGSCCHHHHHHHHHHHHTCCCCCHHHHHHHHHHHHHHHHTSCSEEEECCCSSCEEEEECBCTTCHHHHHHHHHHHCCCBT
T ss_pred             cccccHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHHHHccCCCeEEeecCCCcceEEEeCCCCCHHHHHHHHHHcCCCCC
Confidence            76688999999999999999999999999999999999999999999988888999999999999999999999998876


Q ss_pred             CCCeEEcccccCCCCChHHHHHHHHhchhcCCCeEEEeccCCcccccccccCChhhhhhhccHHHHHHHHHHhhcccccc
Q 011417          250 ENPYLFNGDFVDRGSFSVEVILTLFAFKCMCPSAIYLSRGNHESKSMNKIYGFEGEVRSKLSETFVELFAEVFCCLPLAH  329 (486)
Q Consensus       250 ~~~~~~lGd~vdrG~~~~e~l~~l~~lk~~~p~~v~~lrGNHE~~~~~~~~~~~~e~~~~~~~~~~~~~~~~~~~lp~~~  329 (486)
                      .+.|+|+|||||||++|+||+.+|++||+.+|.+|++||||||.+.++..|||.+++.++|+..+|..+.++|++||+++
T Consensus       241 ~~~~v~lGD~vdrG~~s~e~~~~l~~l~~~~~~~~~~lrGNHE~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~lp~~~  320 (477)
T 1wao_1          241 TNPYIFNGDFVDRGSFSVEVILTLFGFKLLYPDHFHLLRGNHETDNMNQIYGFEGEVKAKYTAQMYELFSEVFEWLPLAQ  320 (477)
T ss_dssp             TBCEEEESCCSSSSTTHHHHHHHHHHHHHHSTTTEEEECCTTSSHHHHHHHSHHHHHHHHSCTTHHHHHHHHHTTSCSEE
T ss_pred             cCeEEEeccccCCCcchHHHHHHHHHHHhhCCCceEeecCCccHHHHhhhcChHHHHHHHhhHHHHHHHHHHhccCCcEE
Confidence            66799999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eeCCcEEEEeCcccCCCCCCchhhcccccCCCCCCCCcccccccCCCCCCCCCCCCCCCCceEcCHHHHHHHHHHCCCCc
Q 011417          330 VLNQKVFVVHGGLFSVDGVKLSDIKTIDRFCEPPEEGLMCELLWSDPQPLPGRGPSKRGVGLSFGADVTKRFLQDNSLGN  409 (486)
Q Consensus       330 ~i~~~~~~vHgGi~~~~~~~~~~i~~~~r~~~~~~~~~~~~llw~dp~~~~~~~~~~rg~~~~fg~~~~~~~l~~~~~~~  409 (486)
                      ++++++||||||+++|...++++|+++.|+.+++..++++|+|||||....+|.+++||.|+.||++++++||+++|+ +
T Consensus       321 ~~~~~~~~vHgg~~~~~~~~l~~i~~~~r~~~~~~~~~~~dllWsdp~~~~~~~~~~rg~~~~fg~~~~~~fl~~~~~-~  399 (477)
T 1wao_1          321 CINGKVLIMHGGLFSEDGVTLDDIRKIERNRQPPDSGPMCDLLWSDPQPQNGRSISKRGVSCQFGPDVTKAFLEENNL-D  399 (477)
T ss_dssp             EETTTEEECSSCCCSSSCCCHHHHHTCCCSSCCCSSSHHHHHHHCEECSSSSCEECTTSSSEEECHHHHHHHHHHTTC-C
T ss_pred             EEcCcEEEECCCCCccccCCHHHHHhccCCCCCchhhhhhhhccCCCCccCCcCcCCCCCceeECHHHHHHHHHHcCC-e
Confidence            999999999999988888999999999999999999999999999999988999999999999999999999999999 9


Q ss_pred             eeeecccccccCceEecCCeEEEEecCCCCCCCCCCeEEEEEEecCCCceeEEEEeccCCCCCCCcccchhhh
Q 011417          410 LVVRSHEVKDEGYEIEHDGKLITVFSAPNYCDQMGNKGAFIRFEAPTLKPNIVTFAAVPHPDVKPMAYANNFL  482 (486)
Q Consensus       410 ~iir~H~~~~~G~~~~~~~~~~tifsa~~y~~~~~n~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  482 (486)
                      +||||||++++||+++++|+|||||||||||+.++|.||+|.|.+++++++|++|+++|+|.++||+||.+++
T Consensus       400 ~iir~H~~~~~g~~~~~~~~~~tvfsa~~y~~~~~n~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  472 (477)
T 1wao_1          400 YIIRSHEVKAEGYEVAHGGRCVTVFSAPNYCDQMGNKASYIHLQGSDLRPQFHQFTAVPHPNVKPMAYANTLL  472 (477)
T ss_dssp             EEEECCSCCTEEEEEEGGGTEEEEBCCTTTTSSSCCEEEEEEEETTEEEEEEEEECCCCCCSCCTTCSSCHHH
T ss_pred             EEEECCCCCcCCeEEecCCeEEEEeCCcccccCCCccEEEEEEECCCCeEEEEEEeCCCCCCCChhhhhhhhh
Confidence            9999999999999999999999999999999999999999999667899999999999999999999998887



>3h63_A Serine/threonine-protein phosphatase 5; metalloenzyme, inhibitors, drug design, cytoplasm, hydrolase, iron, manganese, metal-binding, nucleus; HET: NHC; 1.30A {Homo sapiens} SCOP: d.159.1.3 PDB: 3h60_A* 3h61_A* 3h62_C* 3h64_A* 3h66_A 3h67_A* 3h68_A* 3h69_A* 1s95_A Back     alignment and structure
>3icf_A PPT, serine/threonine-protein phosphatase T; IRO metalloprotein, structural genomics, PSI-2, protein structu initiative; 2.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3ll8_A Serine/threonine-protein phosphatase 2B catalytic alpha isoform; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 2p6b_A 1m63_A* 1tco_A* 1mf8_A* 2jog_A Back     alignment and structure
>3e7a_A PP-1A, serine/threonine-protein phosphatase PP1-alpha Ca subunit; carbohydrate metabolism, cell cycle, cell division; HET: 1ZN; 1.63A {Homo sapiens} SCOP: d.159.1.3 PDB: 3e7b_A* 3egg_A* 3egh_A* 3hvq_A 3v4y_A* 3n5u_A 1jk7_A* 1it6_A* 2bcd_A* 2bdx_A* 2o8g_A 2o8a_A 1u32_A* 1s70_A* Back     alignment and structure
>1aui_A Calcineurin, serine/threonine phosphatase 2B; hydrolase, immunosuppression; 2.10A {Homo sapiens} SCOP: d.159.1.3 Back     alignment and structure
>2ie4_C PP2A-alpha;, serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform; protein-protein complex, heat repeat, signaling protein; HET: OKA; 2.60A {Homo sapiens} SCOP: d.159.1.3 PDB: 2npp_C* 3dw8_C* 3k7v_C* 3k7w_C* 3c5w_C 2ie3_C* 3fga_C* 2iae_C* 3p71_C* 2nym_C* 2nyl_C* Back     alignment and structure
>1fjm_A Protein serine/threonine phosphatase-1 (alpha ISO 1); hydrolase, toxin, hydrolase-hydrolase inhibitor complex; HET: 1ZN; 2.10A {Oryctolagus cuniculus} SCOP: d.159.1.3 Back     alignment and structure
>2z72_A Protein-tyrosine-phosphatase; cold-active enzyme, psychrophIle, hydrolase; 1.10A {Shewanella SP} PDB: 1v73_A 2zbm_A Back     alignment and structure
>2dfj_A Diadenosinetetraphosphatase; helices and strands mixture, hydrolase; 2.72A {Shigella flexneri 2A} Back     alignment and structure
>2qjc_A Diadenosine tetraphosphatase, putative; putative diadenosine tetraphosphatase, monomer, PSI- 2, protein structure initiative, nysgrc; 2.05A {Trypanosoma brucei} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>1g5b_A Serine/threonine protein phosphatase; bacteriophage lambda, Ser/Thr protein phosphatase, ppase, manganese, sulfate, viral protein; 2.15A {Enterobacteria phage lambda} SCOP: d.159.1.3 Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3rqz_A Metallophosphoesterase; PSI-biology, midwest center for structural genomics, MCSG, Zn binding, hydrolase; 1.95A {Sphaerobacter thermophilus} SCOP: d.159.1.0 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1nnw_A Hypothetical protein; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 1.90A {Pyrococcus furiosus} SCOP: d.159.1.5 PDB: 2gju_A Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3qfm_A SAPH, putative uncharacterized protein; sandwich fold, asymmetric AP4A hydrolase, phosphodiesterase, binding, Mn2+ binding, hydrolase; 1.90A {Streptococcus pneumoniae} PDB: 3qfn_A 3qfo_A* Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>1s3l_A Hypothetical protein MJ0936; phosphodiesterase, nuclease, structural genomics, BSGC struc funded by NIH; 2.40A {Methanocaldococcus jannaschii} SCOP: d.159.1.7 PDB: 1s3m_A 1s3n_A 2ahd_A Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>1uf3_A Hypothetical protein TT1561; metallo-dependent phosphatases, structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.10A {Thermus thermophilus} SCOP: d.159.1.6 Back     alignment and structure
>2a22_A Vacuolar protein sorting 29; alpha-beta-BETA-alpha sandwich, structural genomics, structural genomics consortium, SGC, protein transport; 2.20A {Cryptosporidium parvum} SCOP: d.159.1.7 Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>2kkn_A Uncharacterized protein; protein phosphatase 2A homologue, structural genomics, PSI- 2, protein structure initiative; NMR {Thermotoga maritima} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3ck2_A Conserved uncharacterized protein (predicted phosphoesterase COG0622); structural genomics, predicted phosphodiesterase, PSI-2; HET: SRT; 2.30A {Streptococcus pneumoniae} SCOP: d.159.1.7 Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1z2w_A Vacuolar protein sorting 29; VPS29, retromer, phosphatase, manganese, protein transport; 2.00A {Mus musculus} SCOP: d.159.1.7 PDB: 1z2x_A 3lh6_A 3lh7_A 3psn_A 3pso_A 1w24_A 2r17_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1su1_A Hypothetical protein YFCE; structural genomics, phosphoesterase, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.25A {Escherichia coli} SCOP: d.159.1.7 Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>1xm7_A Hypothetical protein AQ_1665; structural genomics, protein structure initi midwest center for structural genomics, PSI, MCSG, unknown; 2.40A {Aquifex aeolicus} SCOP: d.159.1.8 Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3ib7_A ICC protein; metallophosphoesterase, alpha-beta fold, swapped-dimer, HYDR; HET: BTB; 1.60A {Mycobacterium tuberculosis} PDB: 3ib8_A* 2hy1_A 2hyp_A 2hyo_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3d03_A Phosphohydrolase; glycerophosphodiesterase, metallohydrolase, phosphatase, metal ION; 1.90A {Enterobacter aerogenes} SCOP: d.159.1.11 PDB: 2zoa_A 2zo9_B 2dxn_A 2dxl_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>2nxf_A Putative dimetal phosphatase; dinuclear metal center phosphatase, metalloprotein, metallophosphoesterase, protein structure initiative; 1.70A {Danio rerio} SCOP: d.159.1.12 Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3rl5_A Metallophosphoesterase mpped2; alpha-beta fold, metallophosphodiesterase, active site mutan nucleotide polymorphism, hydrolase; 1.26A {Rattus norvegicus} PDB: 3rl3_A* 3rl4_A* Back     alignment and structure
>2yvt_A Hypothetical protein AQ_1956; structural genomics, unknown function, NPPSFA, national PROJ protein structural and functional analyses; 1.60A {Aquifex aeolicus} SCOP: d.159.1.6 Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2xmo_A LMO2642 protein; phosphodiesterase, hydrolase; 1.70A {Listeria monocytogenes} Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3av0_A DNA double-strand break repair protein MRE11; DNA repair, calcineurin-like phosphoesterase, ABC transporte domain-like; HET: DNA AGS; 3.10A {Methanocaldococcus jannaschii} PDB: 3auz_A* Back     alignment and structure
>2q8u_A Exonuclease, putative; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 2.20A {Thermotoga maritima MSB8} PDB: 3thn_A Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>1ii7_A MRE11 nuclease; RAD50, DNA double-strand break repair, DAMP, manganese, replication; HET: DA; 2.20A {Pyrococcus furiosus} SCOP: d.159.1.4 PDB: 3dsc_A* 3dsd_A* 1s8e_A Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>1ute_A Protein (II purple acid phosphatase); tartrate resistant acid phosphatase metalloenzyme, uteroferrin, hydrolase; HET: NAG; 1.55A {Sus scrofa} SCOP: d.159.1.1 PDB: 1war_A* 2bq8_X 1qfc_A* 1qhw_A* Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} Back     alignment and structure
>3tho_B Exonuclease, putative; adenosine triphosphate, bacterial proteins, DNA breaks, DOUB stranded, DNA repair, DNA repair enzymes; HET: ADP; 2.61A {Thermotoga maritima} PDB: 3qg5_C Back     alignment and structure
>4fbk_A DNA repair and telomere maintenance protein NBS1, protein RAD32 chimeric protein; DNA double-strand break repair, nuclease; HET: DNA; 2.38A {Schizosaccharomyces pombe} PDB: 4fbq_A* Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4fbw_A DNA repair protein RAD32; DNA double-strand break repair, nuclease, hydrolase; HET: DNA; 2.20A {Schizosaccharomyces pombe} PDB: 4fcx_B* Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>3t1i_A Double-strand break repair protein MRE11A; DNA repair, MRN complex, metallophosphatase, exonuclease, endonuclease, RAD50, NBS1, hydrolase; 3.00A {Homo sapiens} Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2qfp_A Purple acid phosphatase; binuclear, Fe-Zn, hydrolase; HET: NAG NDG; 2.20A {Phaseolus vulgaris} SCOP: b.1.12.1 d.159.1.1 PDB: 2qfr_A* 1kbp_A* 3kbp_A* 4kbp_A* Back     alignment and structure
>1xzw_A Purple acid phosphatase; hydrolase; HET: NAG FUC MAN; 2.50A {Ipomoea batatas} SCOP: b.1.12.1 d.159.1.1 Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>3tgh_A Glideosome-associated protein 50; phosphatase fold, NOT A phosphatase, motor protein, structur protein, membrane protein; 1.70A {Plasmodium falciparum 3D7} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>3qfk_A Uncharacterized protein; structural genomics, center for structural genomics of infec diseases, csgid, phosphoesterase, hydrolase; HET: MSE AKG; 2.05A {Staphylococcus aureus subsp} Back     alignment and structure
>2z1a_A 5'-nucleotidase; metal-binding, nucleotide-binding, hydrolase, structural genomics, NPPSFA; HET: THM; 1.75A {Thermus thermophilus} SCOP: d.114.1.1 d.159.1.2 Back     alignment and structure
>1hp1_A 5'-nucleotidase; metallophosphatase, dinuclear, metalloenzyme, hydrolase, domain movement; HET: ATP; 1.70A {Escherichia coli} SCOP: d.114.1.1 d.159.1.2 PDB: 1ush_A 2ush_A 1hpu_A* 1ho5_A* 1oi8_A 1oid_A 1oie_A Back     alignment and structure
>4h2g_A 5'-nucleotidase; dimer, hydrolase, phosphatase, extracellular; HET: ADN; 1.55A {Homo sapiens} PDB: 4h2f_A* 4h1y_P* 4h2i_A* 4h1s_A* 4h2b_A* Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 486
d1s95a_324 d.159.1.3 (A:) Serine/threonine protein phosphatas 1e-139
d1auia_ 473 d.159.1.3 (A:) Protein phosphatase-2B (PP-2B, calc 1e-102
d3c5wc1288 d.159.1.3 (C:6-293) Protein phosphatase 2A catalyt 1e-96
d1jk7a_294 d.159.1.3 (A:) Protein phosphatase-1 (PP-1) {Human 5e-91
d1a17a_159 a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo 3e-29
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 7e-23
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 3e-08
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 4e-20
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 4e-04
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 2e-16
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 6e-15
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 1e-14
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 9e-14
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 2e-13
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 2e-10
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 3e-08
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 0.002
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 0.002
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 0.004
d1g5ba_219 d.159.1.3 (A:) lambda ser/thr protein phosphatase 2e-16
d1kt1a1168 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {M 6e-16
d1elwa_117 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 7e-16
d1ihga1169 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos tau 2e-15
d2fbna1153 a.118.8.1 (A:22-174) Putative 70 kda peptidylproly 2e-14
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 4e-14
d1hh8a_192 a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- 5e-13
d1hh8a_192 a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- 5e-06
d1p5qa1170 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal d 9e-13
d1ya0a1497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 9e-11
d1ya0a1497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 4e-07
d1ya0a1497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 1e-06
d1ya0a1497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 6e-06
d1ya0a1497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 1e-04
d1qqea_290 a.118.8.1 (A:) Vesicular transport protein sec17 { 2e-09
d1qqea_290 a.118.8.1 (A:) Vesicular transport protein sec17 { 3e-05
d1qqea_290 a.118.8.1 (A:) Vesicular transport protein sec17 { 0.004
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 5e-09
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 4e-06
d1nnwa_251 d.159.1.5 (A:) Hypothetical protein PF1291 {Archae 3e-08
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 1e-07
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 6e-06
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 3e-05
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 1e-04
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 4e-04
d2hr2a1156 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {C 2e-07
d2h6fa1315 a.118.6.1 (A:55-369) Protein farnesyltransferase a 2e-07
d2h6fa1315 a.118.6.1 (A:55-369) Protein farnesyltransferase a 1e-06
d2h6fa1315 a.118.6.1 (A:55-369) Protein farnesyltransferase a 2e-06
d2h6fa1315 a.118.6.1 (A:55-369) Protein farnesyltransferase a 2e-04
d1hz4a_366 a.118.8.2 (A:) Transcription factor MalT domain II 3e-07
d1hz4a_366 a.118.8.2 (A:) Transcription factor MalT domain II 4e-06
d1hz4a_366 a.118.8.2 (A:) Transcription factor MalT domain II 1e-05
d1dcea1334 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr 7e-07
d1dcea1334 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr 6e-05
d1tjca_95 a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subuni 3e-06
d1nzna_122 a.118.8.1 (A:) Mitochondria fission protein Fis1 { 2e-04
d1su1a_184 d.159.1.7 (A:) Phosphodiesterase yfcE {Escherichia 0.001
d1ouva_265 a.118.18.1 (A:) Cysteine rich protein C (HcpC) {He 0.003
d1wr0a177 a.7.14.1 (A:5-81) Vacuolar sorting protein 4b (VPS 0.004
>d1s95a_ d.159.1.3 (A:) Serine/threonine protein phosphatase 5, PP5 {Human (Homo sapiens) [TaxId: 9606]} Length = 324 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Metallo-dependent phosphatases
superfamily: Metallo-dependent phosphatases
family: Protein serine/threonine phosphatase
domain: Serine/threonine protein phosphatase 5, PP5
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  400 bits (1029), Expect = e-139
 Identities = 191/323 (59%), Positives = 246/323 (76%), Gaps = 1/323 (0%)

Query: 163 YSGARIEGDVITLDFVKKMMDDFKNQKCLHKRYAFQIVLQTREMLRALPSLVDIDIPDGK 222
           YSG ++E   +T+ F+K++M  +K+QK LH++ A+QI++Q +E+L  L +LV+  + + +
Sbjct: 1   YSGPKLEDGKVTISFMKELMQWYKDQKKLHRKCAYQILVQVKEVLSKLSTLVETTLKETE 60

Query: 223 HFTVCGDVHGQFYDLLNIFELNGLPSEENPYLFNGDFVDRGSFSVEVILTLFAFKCMCPS 282
             TVCGD HGQFYDLLNIFELNGLPSE NPY+FNGDFVDRGSFSVEVILTLF FK + P 
Sbjct: 61  KITVCGDTHGQFYDLLNIFELNGLPSETNPYIFNGDFVDRGSFSVEVILTLFGFKLLYPD 120

Query: 283 AIYLSRGNHESKSMNKIYGFEGEVRSKLSETFVELFAEVFCCLPLAHVLNQKVFVVHGGL 342
             +L RGNHE+ +MN+IYGFEGEV++K +    ELF+EVF  LPLA  +N KV ++HGGL
Sbjct: 121 HFHLLRGNHETDNMNQIYGFEGEVKAKYTAQMYELFSEVFEWLPLAQCINGKVLIMHGGL 180

Query: 343 FSVDGVKLSDIKTIDRFCEPPEEGLMCELLWSDPQPLPGRGPSKRGVGLSFGADVTKRFL 402
           FS DGV L DI+ I+R  +PP+ G MC+LLWSDPQP  GR  SKRGV   FG DVTK FL
Sbjct: 181 FSEDGVTLDDIRKIERNRQPPDSGPMCDLLWSDPQPQNGRSISKRGVSCQFGPDVTKAFL 240

Query: 403 QDNSLGNLVVRSHEVKDEGYEIEHDGKLITVFSAPNYCDQMGNKGAFIRFEAPTLKPNIV 462
           ++N+L + ++RSHEVK EGYE+ H G+ +TVFSAPNYCDQMGNK ++I  +   L+P   
Sbjct: 241 EENNL-DYIIRSHEVKAEGYEVAHGGRCVTVFSAPNYCDQMGNKASYIHLQGSDLRPQFH 299

Query: 463 TFAAVPHPDVKPMAYANNFLRMF 485
            F AVPHP+VKPMAYAN  L++ 
Sbjct: 300 QFTAVPHPNVKPMAYANTLLQLG 322


>d1auia_ d.159.1.3 (A:) Protein phosphatase-2B (PP-2B, calcineurin A subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 473 Back     information, alignment and structure
>d3c5wc1 d.159.1.3 (C:6-293) Protein phosphatase 2A catalytic subunit alpha isoform, PP2A-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1jk7a_ d.159.1.3 (A:) Protein phosphatase-1 (PP-1) {Human (Homo sapiens), beta isoform [TaxId: 9606]} Length = 294 Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Length = 159 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1g5ba_ d.159.1.3 (A:) lambda ser/thr protein phosphatase {Bacteriophage lambda [TaxId: 10710]} Length = 219 Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 168 Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Length = 169 Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Length = 153 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 290 Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 290 Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 290 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1nnwa_ d.159.1.5 (A:) Hypothetical protein PF1291 {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 251 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Length = 156 Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 315 Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 315 Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 315 Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 315 Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure
>d1su1a_ d.159.1.7 (A:) Phosphodiesterase yfcE {Escherichia coli [TaxId: 562]} Length = 184 Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Length = 265 Back     information, alignment and structure
>d1wr0a1 a.7.14.1 (A:5-81) Vacuolar sorting protein 4b (VPS4B, SKD1 protein) {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query486
d1s95a_324 Serine/threonine protein phosphatase 5, PP5 {Human 100.0
d3c5wc1288 Protein phosphatase 2A catalytic subunit alpha iso 100.0
d1jk7a_294 Protein phosphatase-1 (PP-1) {Human (Homo sapiens) 100.0
d1auia_ 473 Protein phosphatase-2B (PP-2B, calcineurin A subun 100.0
d1g5ba_219 lambda ser/thr protein phosphatase {Bacteriophage 99.84
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.81
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.78
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.69
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.69
d1nnwa_251 Hypothetical protein PF1291 {Archaeon Pyrococcus f 99.68
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.67
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.67
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.66
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.63
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.62
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.62
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.61
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.61
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.6
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.58
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.57
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.57
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 99.53
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.53
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.52
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.49
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.43
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.42
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.38
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 99.35
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.35
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.34
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 99.28
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 99.27
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.23
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.22
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.2
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.13
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.11
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.1
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 99.07
d1uf3a_228 Hypothetical protein TT1561 {Thermus thermophilus 99.05
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.03
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.02
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.02
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.98
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.98
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.93
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 98.86
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 98.8
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.78
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.77
d1s3la_165 Putative phosphodiesterase MJ0936 {Methanococcus j 98.73
d1hz4a_366 Transcription factor MalT domain III {Escherichia 98.71
d3ck2a1173 Uncharacterized protein SP1879 {Streptococcus pneu 98.55
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 98.49
d2a22a1193 Vacuolar protein sorting 29, VPS29 {Cryptosporidiu 98.49
d1z2wa1182 Vacuolar protein sorting 29, VPS29 {Mouse (Mus mus 98.49
d1su1a_184 Phosphodiesterase yfcE {Escherichia coli [TaxId: 5 98.43
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.4
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.36
d2yvta1257 Uncharacterized protein Aq_1956 {Aquifex aeolicus 98.33
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.29
d1hz4a_366 Transcription factor MalT domain III {Escherichia 98.29
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 98.24
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.07
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 97.55
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 97.53
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 97.48
d3d03a1271 Glycerophosphodiesterase GpdQ {Enterobacter aeroge 97.42
d2hy1a1256 Rv0805 cyclic nucleotide phosphodiesterase {Mycoba 97.08
d1xm7a_188 Hypothetical protein aq_1666 {Aquifex aeolicus [Ta 96.66
d1ii7a_333 Mre11 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 96.57
d2nxfa1320 Uncharacterized C17orf48 homolog zgc:64213 {Zebraf 93.56
d2qfra2312 Plant purple acid phosphatase, catalytic domain {K 93.31
d1utea_302 Mammalian purple acid phosphatase {Pig (Sus scrofa 90.37
>d1s95a_ d.159.1.3 (A:) Serine/threonine protein phosphatase 5, PP5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Metallo-dependent phosphatases
superfamily: Metallo-dependent phosphatases
family: Protein serine/threonine phosphatase
domain: Serine/threonine protein phosphatase 5, PP5
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=2.2e-84  Score=622.10  Aligned_cols=319  Identities=60%  Similarity=1.073  Sum_probs=304.2

Q ss_pred             CCCCcccCCCccHHHHHHHHHHHhcccchhhHHHHHHHHHHHHHHhcCCCcccccCCCCCceEEEccCCCChHHHHHHHH
Q 011417          163 YSGARIEGDVITLDFVKKMMDDFKNQKCLHKRYAFQIVLQTREMLRALPSLVDIDIPDGKHFTVCGDVHGQFYDLLNIFE  242 (486)
Q Consensus       163 ~~~~~l~~~~l~~~~l~~l~e~l~~~~~l~~~e~~~ll~~a~~~l~~ep~~~~i~~~~~~~~~v~GDihG~~~~l~~~l~  242 (486)
                      |.++++....++.+.++++++.++..+.++.+++.++|.+++++|+++|+++++......++.|+||+||++.||.++|+
T Consensus         1 ~~gp~~~~~~~t~~~~~~li~~~~~~~~l~~~~~~~ll~~~~~il~~e~~l~~i~~~~~~pv~VvGDiHGq~~DL~~if~   80 (324)
T d1s95a_           1 YSGPKLEDGKVTISFMKELMQWYKDQKKLHRKCAYQILVQVKEVLSKLSTLVETTLKETEKITVCGDTHGQFYDLLNIFE   80 (324)
T ss_dssp             CCSSCCBTTBCCHHHHHHHHHHHHTTCCCCHHHHHHHHHHHHHHHHTSCSEEEECCCTTCEEEEECCCTTCHHHHHHHHH
T ss_pred             CCCCcCCCCCcCHHHHHHHHHHHHhcCCCCHHHHHHHHHHHHHHHHhCCCeEEeecCCCCCEEEEEECCCCHHHHHHHHH
Confidence            45677766669999999999999999999999999999999999999999999976666679999999999999999999


Q ss_pred             HcCCCCCCCCeEEcccccCCCCChHHHHHHHHhchhcCCCeEEEeccCCcccccccccCChhhhhhhccHHHHHHHHHHh
Q 011417          243 LNGLPSEENPYLFNGDFVDRGSFSVEVILTLFAFKCMCPSAIYLSRGNHESKSMNKIYGFEGEVRSKLSETFVELFAEVF  322 (486)
Q Consensus       243 ~~~~~~~~~~~~~lGd~vdrG~~~~e~l~~l~~lk~~~p~~v~~lrGNHE~~~~~~~~~~~~e~~~~~~~~~~~~~~~~~  322 (486)
                      ..|+|+++.+|+|||||||||++|+||+.+|++||+.+|++|++||||||++.++..|||.+||..+|+.++|..++++|
T Consensus        81 ~~g~p~~~~~ylFLGDYVDRG~~slEvi~lL~~lKi~yP~~v~LLRGNHE~~~~n~~ygF~~e~~~k~~~~l~~~~~~~F  160 (324)
T d1s95a_          81 LNGLPSETNPYIFNGDFVDRGSFSVEVILTLFGFKLLYPDHFHLLRGNHETDNMNQIYGFEGEVKAKYTAQMYELFSEVF  160 (324)
T ss_dssp             HHCCCBTTBCEEEESCCSSSSTTHHHHHHHHHHHHHHSTTTEEEECCTTSSHHHHHHHSHHHHHHHHSCHHHHHHHHHHH
T ss_pred             HCCCCCCCCeEEEecccccCcCcceeehHHHHHHHHhCCCcEEeccCCccccccccccccchHhhhhcCHHHHHHHHHHH
Confidence            99999887779999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hcccccceeCCcEEEEeCcccCCCCCCchhhcccccCCCCCCCCcccccccCCCCCCCCCCCCCCCCceEcCHHHHHHHH
Q 011417          323 CCLPLAHVLNQKVFVVHGGLFSVDGVKLSDIKTIDRFCEPPEEGLMCELLWSDPQPLPGRGPSKRGVGLSFGADVTKRFL  402 (486)
Q Consensus       323 ~~lp~~~~i~~~~~~vHgGi~~~~~~~~~~i~~~~r~~~~~~~~~~~~llw~dp~~~~~~~~~~rg~~~~fg~~~~~~~l  402 (486)
                      ++||+||+|++++||||||||++...++++|++++|+.+++++++++|+|||||....++.++.||.|+.||++++++||
T Consensus       161 ~~LPlaa~I~~~ilcvHGGi~~~~~~~l~~i~~i~r~~~~~~~~~~~dlLWSDP~~~~~~~~~~Rg~g~~FG~~~~~~Fl  240 (324)
T d1s95a_         161 EWLPLAQCINGKVLIMHGGLFSEDGVTLDDIRKIERNRQPPDSGPMCDLLWSDPQPQNGRSISKRGVSCQFGPDVTKAFL  240 (324)
T ss_dssp             TTSCSEEEETTTEEECSSCCCSSSCCCHHHHHTCCCSSSCCSSSHHHHHHHCEECSSSSEEECTTSSSEEECHHHHHHHH
T ss_pred             hhcchhhhccCcEEEecCCcCccccCCHHHHHhccCCCCCcchhhhhhhhccCccccCCcCcCCCCCcCCcCHHHHHHHH
Confidence            99999999999999999999667789999999999999999999999999999999889999999999999999999999


Q ss_pred             HHCCCCceeeecccccccCceEecCCeEEEEecCCCCCCCCCCeEEEEEEecCCCceeEEEEeccCCCCCCCcccchhhh
Q 011417          403 QDNSLGNLVVRSHEVKDEGYEIEHDGKLITVFSAPNYCDQMGNKGAFIRFEAPTLKPNIVTFAAVPHPDVKPMAYANNFL  482 (486)
Q Consensus       403 ~~~~~~~~iir~H~~~~~G~~~~~~~~~~tifsa~~y~~~~~n~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  482 (486)
                      ++||+ ++||||||++++||++.+++||||||||||||+..+|+||+|.|.+++++++|+||++.|+|.++||.||+.++
T Consensus       241 ~~n~l-~lIIR~He~v~~G~~~~~~~kviTvFSa~nY~~~~~N~~a~l~i~~~~~~~~~~~f~~~p~p~~~p~~~~~~~~  319 (324)
T d1s95a_         241 EENNL-DYIIRSHEVKAEGYEVAHGGRCVTVFSAPNYCDQMGNKASYIHLQGSDLRPQFHQFTAVPHPNVKPMAYANTLL  319 (324)
T ss_dssp             HHHTC-CEEEECCSCCTTSEEEEGGGTEEEECCCSSGGGTSCCCEEEEEEETTEEEEEEEEECCCCCCSCCTTTTSCHHH
T ss_pred             HHcCC-cEEEEcCccccCceEEecCCcEEEEeCCCccCCCCCcceEEEEEECCCceeEEEEecCCCCCCCChhhhhhHHH
Confidence            99999 99999999999999999999999999999999999999999999556689999999999999999999997765



>d3c5wc1 d.159.1.3 (C:6-293) Protein phosphatase 2A catalytic subunit alpha isoform, PP2A-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jk7a_ d.159.1.3 (A:) Protein phosphatase-1 (PP-1) {Human (Homo sapiens), beta isoform [TaxId: 9606]} Back     information, alignment and structure
>d1auia_ d.159.1.3 (A:) Protein phosphatase-2B (PP-2B, calcineurin A subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g5ba_ d.159.1.3 (A:) lambda ser/thr protein phosphatase {Bacteriophage lambda [TaxId: 10710]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nnwa_ d.159.1.5 (A:) Hypothetical protein PF1291 {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1uf3a_ d.159.1.6 (A:) Hypothetical protein TT1561 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1s3la_ d.159.1.7 (A:) Putative phosphodiesterase MJ0936 {Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3ck2a1 d.159.1.7 (A:1-173) Uncharacterized protein SP1879 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2a22a1 d.159.1.7 (A:4-196) Vacuolar protein sorting 29, VPS29 {Cryptosporidium parvum [TaxId: 5807]} Back     information, alignment and structure
>d1z2wa1 d.159.1.7 (A:1-182) Vacuolar protein sorting 29, VPS29 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1su1a_ d.159.1.7 (A:) Phosphodiesterase yfcE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2yvta1 d.159.1.6 (A:4-260) Uncharacterized protein Aq_1956 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d3d03a1 d.159.1.11 (A:1-271) Glycerophosphodiesterase GpdQ {Enterobacter aerogenes [TaxId: 548]} Back     information, alignment and structure
>d2hy1a1 d.159.1.11 (A:10-265) Rv0805 cyclic nucleotide phosphodiesterase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xm7a_ d.159.1.8 (A:) Hypothetical protein aq_1666 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ii7a_ d.159.1.4 (A:) Mre11 {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2nxfa1 d.159.1.12 (A:3-322) Uncharacterized C17orf48 homolog zgc:64213 {Zebrafish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d2qfra2 d.159.1.1 (A:121-432) Plant purple acid phosphatase, catalytic domain {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1utea_ d.159.1.1 (A:) Mammalian purple acid phosphatase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure