Citrus Sinensis ID: 011431
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 486 | ||||||
| 255564976 | 944 | TMV resistance protein N, putative [Rici | 0.388 | 0.200 | 0.486 | 2e-44 | |
| 224145030 | 1435 | tir-nbs-lrr resistance protein [Populus | 0.358 | 0.121 | 0.528 | 4e-43 | |
| 255561496 | 876 | TMV resistance protein N, putative [Rici | 0.337 | 0.187 | 0.530 | 4e-43 | |
| 224127917 | 1470 | tir-nbs-lrr resistance protein [Populus | 0.355 | 0.117 | 0.519 | 5e-43 | |
| 357486483 | 242 | TMV resistance protein N [Medicago trunc | 0.337 | 0.677 | 0.518 | 2e-42 | |
| 224145021 | 1561 | tir-nbs-lrr resistance protein [Populus | 0.382 | 0.119 | 0.494 | 3e-42 | |
| 357486473 | 274 | TIR-NBS disease resistance-like protein | 0.329 | 0.583 | 0.511 | 4e-42 | |
| 255537137 | 1034 | leucine-rich repeat containing protein, | 0.364 | 0.171 | 0.5 | 4e-42 | |
| 255555349 | 1109 | leucine-rich repeat containing protein, | 0.337 | 0.147 | 0.536 | 7e-42 | |
| 255537139 | 1137 | leucine-rich repeat-containing protein, | 0.349 | 0.149 | 0.535 | 2e-41 |
| >gi|255564976|ref|XP_002523481.1| TMV resistance protein N, putative [Ricinus communis] gi|223537309|gb|EEF38940.1| TMV resistance protein N, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 186 bits (472), Expect = 2e-44, Method: Compositional matrix adjust.
Identities = 93/191 (48%), Positives = 134/191 (70%), Gaps = 2/191 (1%)
Query: 19 RYKHDVFVTFSGEDIRENFGSYLFAALFRESVKTFRDEQIRRGDEIMPALLQAIEESKIS 78
+ K+DVFV+F GED R+NF S+L+AAL ++ +K F D+++ RG+EI AL++ IEES +S
Sbjct: 13 QLKYDVFVSFRGEDTRDNFTSHLYAALHQKQIKAFVDDKLSRGEEISAALVKVIEESMVS 72
Query: 79 LVIFSKRFAFSRWCLEELVKIIECNK-LYQTVIPVFYKVLPSDVRNQLGSFGEAFLEHEK 137
++IFS+ +AFS WCL+ELVKI+EC K + Q V+PVFY V PSDV Q G FG AF+EHEK
Sbjct: 73 VIIFSENYAFSPWCLDELVKILECKKTVGQIVLPVFYHVDPSDVAEQKGGFGAAFIEHEK 132
Query: 138 SHDLR-PKVGRWRDALREASDLAGWDSNVTRPESKLTDEIVNGVVENLKSFAELMEKELV 196
R K+ +WR AL EA++++GW S+V R ESKL EI +++ L + + + +
Sbjct: 133 CFKERIDKLQKWRAALTEAANISGWSSSVIRSESKLIQEIAEDILKKLNHMSSSTDSKGL 192
Query: 197 VLFNRARDKLD 207
V N DK++
Sbjct: 193 VGINSRIDKIE 203
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224145030|ref|XP_002325501.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222862376|gb|EEE99882.1| tir-nbs-lrr resistance protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255561496|ref|XP_002521758.1| TMV resistance protein N, putative [Ricinus communis] gi|223538971|gb|EEF40568.1| TMV resistance protein N, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224127917|ref|XP_002329209.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222870990|gb|EEF08121.1| tir-nbs-lrr resistance protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|357486483|ref|XP_003613529.1| TMV resistance protein N [Medicago truncatula] gi|355514864|gb|AES96487.1| TMV resistance protein N [Medicago truncatula] gi|388497304|gb|AFK36718.1| unknown [Medicago truncatula] gi|388511843|gb|AFK43983.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|224145021|ref|XP_002325498.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222862373|gb|EEE99879.1| tir-nbs-lrr resistance protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|357486473|ref|XP_003613524.1| TIR-NBS disease resistance-like protein [Medicago truncatula] gi|355514859|gb|AES96482.1| TIR-NBS disease resistance-like protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|255537137|ref|XP_002509635.1| leucine-rich repeat containing protein, putative [Ricinus communis] gi|223549534|gb|EEF51022.1| leucine-rich repeat containing protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|255555349|ref|XP_002518711.1| leucine-rich repeat containing protein, putative [Ricinus communis] gi|223542092|gb|EEF43636.1| leucine-rich repeat containing protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|255537139|ref|XP_002509636.1| leucine-rich repeat-containing protein, putative [Ricinus communis] gi|223549535|gb|EEF51023.1| leucine-rich repeat-containing protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 486 | ||||||
| TAIR|locus:2175991 | 1294 | AT5G17680 [Arabidopsis thalian | 0.329 | 0.123 | 0.452 | 4.3e-34 | |
| TAIR|locus:2153072 | 1229 | AT5G51630 [Arabidopsis thalian | 0.333 | 0.131 | 0.458 | 2.6e-33 | |
| TAIR|locus:2151466 | 1353 | VICTL "VARIATION IN COMPOUND T | 0.339 | 0.121 | 0.441 | 6.8e-32 | |
| UNIPROTKB|Q40392 | 1144 | N "TMV resistance protein N" [ | 0.652 | 0.277 | 0.347 | 8.1e-32 | |
| TAIR|locus:2151476 | 1168 | VICTR "VARIATION IN COMPOUND T | 0.333 | 0.138 | 0.419 | 1.2e-31 | |
| TAIR|locus:2028681 | 1161 | AT1G31540 [Arabidopsis thalian | 0.360 | 0.150 | 0.413 | 1.4e-31 | |
| TAIR|locus:2098145 | 1240 | AT3G44630 [Arabidopsis thalian | 0.405 | 0.158 | 0.361 | 3.6e-31 | |
| TAIR|locus:2032753 | 371 | AT1G72940 [Arabidopsis thalian | 0.419 | 0.549 | 0.380 | 6.9e-31 | |
| TAIR|locus:2115870 | 1234 | AT4G08450 [Arabidopsis thalian | 0.331 | 0.130 | 0.437 | 1.1e-30 | |
| TAIR|locus:2130319 | 796 | RLM3 "RESISTANCE TO LEPTOSPHAE | 0.333 | 0.203 | 0.481 | 2.6e-30 |
| TAIR|locus:2175991 AT5G17680 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 374 (136.7 bits), Expect = 4.3e-34, Sum P(2) = 4.3e-34
Identities = 76/168 (45%), Positives = 114/168 (67%)
Query: 20 YKHDVFVTFSGEDIRENFGSYLFAALFRESVKTFRDE-QIRRGDEIMPALLQAIEESKIS 78
+K DVFV+F GED+R+ F S+LF R +K FRD+ ++RG I P L+ AI+ S+ +
Sbjct: 16 WKTDVFVSFRGEDVRKTFVSHLFCEFDRMGIKAFRDDLDLQRGKSISPELIDAIKGSRFA 75
Query: 79 LVIFSKRFAFSRWCLEELVKIIECNKLYQTVIPVFYKVLPSDVRNQLGSFGEAFLEHEKS 138
+V+ S+ +A S WCL+EL+KI+ECNK T++P+FY+V PSDVR Q GSFGE +S
Sbjct: 76 IVVVSRNYAASSWCLDELLKIMECNK--DTIVPIFYEVDPSDVRRQRGSFGEDV----ES 129
Query: 139 HDLRPKVGRWRDALREASDLAGWDSNVTRPESKLTDEIVNGVVENLKS 186
H + KVG+W++AL++ + ++G DS +SKL +IV + + L S
Sbjct: 130 HSDKEKVGKWKEALKKLAAISGEDSR-NWDDSKLIKKIVKDISDKLVS 176
|
|
| TAIR|locus:2153072 AT5G51630 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2151466 VICTL "VARIATION IN COMPOUND TRIGGERED ROOT growth response-like" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q40392 N "TMV resistance protein N" [Nicotiana glutinosa (taxid:35889)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2151476 VICTR "VARIATION IN COMPOUND TRIGGERED ROOT growth response" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2028681 AT1G31540 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2098145 AT3G44630 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2032753 AT1G72940 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2115870 AT4G08450 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2130319 RLM3 "RESISTANCE TO LEPTOSPHAERIA MACULANS 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| eugene3.01250002 | annotation not avaliable (1627 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 486 | |||
| PLN03210 | 1153 | PLN03210, PLN03210, Resistant to P | 3e-37 | |
| pfam01582 | 135 | pfam01582, TIR, TIR domain | 1e-33 | |
| smart00255 | 140 | smart00255, TIR, Toll - interleukin 1 - resistance | 2e-27 | |
| PLN03194 | 187 | PLN03194, PLN03194, putative disease resistance pr | 1e-11 | |
| pfam13676 | 102 | pfam13676, TIR_2, TIR domain | 5e-09 |
| >gnl|CDD|215633 PLN03210, PLN03210, Resistant to P | Back alignment and domain information |
|---|
Score = 145 bits (368), Expect = 3e-37
Identities = 81/187 (43%), Positives = 114/187 (60%), Gaps = 15/187 (8%)
Query: 1 MASSSLSSSSSRRLRDQWRYKHDVFVTFSGEDIRENFGSYLFAALFRESVKTFRDEQIRR 60
MASSS SSSR W Y DVF +FSGED+R F S+ L R+ + F+D +I R
Sbjct: 1 MASSS---SSSR----NWVY--DVFPSFSGEDVRITFLSHFLKELDRKLIIAFKDNEIER 51
Query: 61 GDEIMPALLQAIEESKISLVIFSKRFAFSRWCLEELVKIIECNK-LYQTVIPVFYKVLPS 119
+ P L QAI +S+I++V+FSK +A S WCL EL++I+ C + L Q VIPVFY + PS
Sbjct: 52 SQSLDPELKQAIRDSRIAVVVFSKNYASSSWCLNELLEIVRCKEELGQLVIPVFYGLDPS 111
Query: 120 DVRNQLGSFGEAFLE--HEKSHDLRPKVGRWRDALREASDLAGWDSNVTRPESKLTDEIV 177
VR Q G FGEAF + K+ D + +W+ AL + +++ G+ S E+K+ +EI
Sbjct: 112 HVRKQTGDFGEAFEKTCQNKTEDEKI---QWKQALTDVANILGYHSQNWPNEAKMIEEIA 168
Query: 178 NGVVENL 184
N V+ L
Sbjct: 169 NDVLGKL 175
|
syringae 6; Provisional. Length = 1153 |
| >gnl|CDD|216585 pfam01582, TIR, TIR domain | Back alignment and domain information |
|---|
| >gnl|CDD|214587 smart00255, TIR, Toll - interleukin 1 - resistance | Back alignment and domain information |
|---|
| >gnl|CDD|215626 PLN03194, PLN03194, putative disease resistance protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222311 pfam13676, TIR_2, TIR domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 486 | |||
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 100.0 | |
| PLN03194 | 187 | putative disease resistance protein; Provisional | 100.0 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 99.93 | |
| PF01582 | 141 | TIR: TIR domain; InterPro: IPR000157 In Drosophila | 99.87 | |
| PF00931 | 287 | NB-ARC: NB-ARC domain; InterPro: IPR002182 This is | 99.87 | |
| smart00255 | 140 | TIR Toll - interleukin 1 - resistance. | 99.8 | |
| PF13676 | 102 | TIR_2: TIR domain; PDB: 3H16_B 3UB4_A 2Y92_A 3UB3_ | 99.48 | |
| KOG1603 | 73 | consensus Copper chaperone [Inorganic ion transpor | 99.31 | |
| PF00403 | 62 | HMA: Heavy-metal-associated domain; InterPro: IPR0 | 98.49 | |
| KOG3678 | 832 | consensus SARM protein (with sterile alpha and arm | 98.24 | |
| PF05729 | 166 | NACHT: NACHT domain | 98.04 | |
| PF08937 | 130 | DUF1863: MTH538 TIR-like domain (DUF1863); InterPr | 97.76 | |
| PRK06893 | 229 | DNA replication initiation factor; Validated | 97.66 | |
| KOG4656 | 247 | consensus Copper chaperone for superoxide dismutas | 97.41 | |
| PF13173 | 128 | AAA_14: AAA domain | 97.38 | |
| COG2608 | 71 | CopZ Copper chaperone [Inorganic ion transport and | 97.37 | |
| TIGR03015 | 269 | pepcterm_ATPase putative secretion ATPase, PEP-CTE | 97.15 | |
| PRK00411 | 394 | cdc6 cell division control protein 6; Reviewed | 96.94 | |
| cd01128 | 249 | rho_factor Transcription termination factor rho is | 96.65 | |
| cd00009 | 151 | AAA The AAA+ (ATPases Associated with a wide varie | 96.63 | |
| PRK13342 | 413 | recombination factor protein RarA; Reviewed | 96.47 | |
| COG2256 | 436 | MGS1 ATPase related to the helicase subunit of the | 96.45 | |
| PRK09376 | 416 | rho transcription termination factor Rho; Provisio | 96.17 | |
| TIGR00635 | 305 | ruvB Holliday junction DNA helicase, RuvB subunit. | 96.13 | |
| PLN02957 | 238 | copper, zinc superoxide dismutase | 96.12 | |
| PF08357 | 150 | SEFIR: SEFIR domain; InterPro: IPR013568 This doma | 96.06 | |
| TIGR02903 | 615 | spore_lon_C ATP-dependent protease, Lon family. Me | 95.98 | |
| PRK00080 | 328 | ruvB Holliday junction DNA helicase RuvB; Reviewed | 95.9 | |
| TIGR01242 | 364 | 26Sp45 26S proteasome subunit P45 family. Many pro | 95.89 | |
| PRK09087 | 226 | hypothetical protein; Validated | 95.81 | |
| PRK13341 | 725 | recombination factor protein RarA/unknown domain f | 95.81 | |
| TIGR03420 | 226 | DnaA_homol_Hda DnaA regulatory inactivator Hda. Me | 95.79 | |
| PF01637 | 234 | Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 | 95.58 | |
| PRK08727 | 233 | hypothetical protein; Validated | 95.15 | |
| PRK05564 | 313 | DNA polymerase III subunit delta'; Validated | 94.99 | |
| PRK08116 | 268 | hypothetical protein; Validated | 94.96 | |
| PRK04841 | 903 | transcriptional regulator MalT; Provisional | 94.96 | |
| PF10137 | 125 | TIR-like: Predicted nucleotide-binding protein con | 94.9 | |
| PF13401 | 131 | AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S | 94.7 | |
| PF00308 | 219 | Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 | 94.68 | |
| TIGR02928 | 365 | orc1/cdc6 family replication initiation protein. M | 94.56 | |
| PRK05642 | 234 | DNA replication initiation factor; Validated | 94.53 | |
| PLN03025 | 319 | replication factor C subunit; Provisional | 94.43 | |
| PRK08084 | 235 | DNA replication initiation factor; Provisional | 94.39 | |
| PF05673 | 249 | DUF815: Protein of unknown function (DUF815); Inte | 94.15 | |
| PRK06620 | 214 | hypothetical protein; Validated | 94.07 | |
| TIGR00362 | 405 | DnaA chromosomal replication initiator protein Dna | 94.03 | |
| TIGR00767 | 415 | rho transcription termination factor Rho. Members | 93.8 | |
| PRK14963 | 504 | DNA polymerase III subunits gamma and tau; Provisi | 93.7 | |
| PRK07003 | 830 | DNA polymerase III subunits gamma and tau; Validat | 93.67 | |
| PHA02544 | 316 | 44 clamp loader, small subunit; Provisional | 93.51 | |
| PF13207 | 121 | AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 | 93.43 | |
| PRK08118 | 167 | topology modulation protein; Reviewed | 93.42 | |
| PRK14088 | 440 | dnaA chromosomal replication initiation protein; P | 93.17 | |
| PRK12402 | 337 | replication factor C small subunit 2; Reviewed | 93.07 | |
| PRK12422 | 445 | chromosomal replication initiation protein; Provis | 92.97 | |
| PRK14961 | 363 | DNA polymerase III subunits gamma and tau; Provisi | 92.95 | |
| PRK00149 | 450 | dnaA chromosomal replication initiation protein; R | 92.7 | |
| PRK09270 | 229 | nucleoside triphosphate hydrolase domain-containin | 92.63 | |
| PRK07667 | 193 | uridine kinase; Provisional | 92.57 | |
| PRK14086 | 617 | dnaA chromosomal replication initiation protein; P | 92.51 | |
| PRK14087 | 450 | dnaA chromosomal replication initiation protein; P | 92.38 | |
| PRK04195 | 482 | replication factor C large subunit; Provisional | 92.33 | |
| PRK07261 | 171 | topology modulation protein; Provisional | 92.16 | |
| PF13238 | 129 | AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB | 92.04 | |
| TIGR02881 | 261 | spore_V_K stage V sporulation protein K. Members o | 92.03 | |
| PRK06696 | 223 | uridine kinase; Validated | 91.99 | |
| PRK05480 | 209 | uridine/cytidine kinase; Provisional | 91.93 | |
| TIGR00678 | 188 | holB DNA polymerase III, delta' subunit. At positi | 91.89 | |
| PF00485 | 194 | PRK: Phosphoribulokinase / Uridine kinase family; | 91.82 | |
| PRK12377 | 248 | putative replication protein; Provisional | 91.79 | |
| PRK06645 | 507 | DNA polymerase III subunits gamma and tau; Validat | 91.76 | |
| PRK10671 | 834 | copA copper exporting ATPase; Provisional | 91.73 | |
| PRK03992 | 389 | proteasome-activating nucleotidase; Provisional | 91.68 | |
| TIGR01425 | 429 | SRP54_euk signal recognition particle protein SRP5 | 91.38 | |
| PRK14949 | 944 | DNA polymerase III subunits gamma and tau; Provisi | 91.19 | |
| COG1373 | 398 | Predicted ATPase (AAA+ superfamily) [General funct | 91.1 | |
| PRK14951 | 618 | DNA polymerase III subunits gamma and tau; Provisi | 91.09 | |
| PRK08233 | 182 | hypothetical protein; Provisional | 91.08 | |
| TIGR03689 | 512 | pup_AAA proteasome ATPase. In the Actinobacteria, | 90.83 | |
| PRK12323 | 700 | DNA polymerase III subunits gamma and tau; Provisi | 90.77 | |
| PRK06921 | 266 | hypothetical protein; Provisional | 90.71 | |
| PRK00440 | 319 | rfc replication factor C small subunit; Reviewed | 90.64 | |
| TIGR00235 | 207 | udk uridine kinase. Model contains a number of lon | 90.43 | |
| COG0572 | 218 | Udk Uridine kinase [Nucleotide transport and metab | 90.29 | |
| cd01858 | 157 | NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei | 90.25 | |
| PRK14957 | 546 | DNA polymerase III subunits gamma and tau; Provisi | 89.93 | |
| PRK14962 | 472 | DNA polymerase III subunits gamma and tau; Provisi | 89.81 | |
| PF13191 | 185 | AAA_16: AAA ATPase domain; PDB: 2V1U_A. | 89.73 | |
| PTZ00301 | 210 | uridine kinase; Provisional | 89.65 | |
| TIGR00064 | 272 | ftsY signal recognition particle-docking protein F | 89.3 | |
| PRK10416 | 318 | signal recognition particle-docking protein FtsY; | 89.24 | |
| PRK06835 | 329 | DNA replication protein DnaC; Validated | 89.22 | |
| COG1618 | 179 | Predicted nucleotide kinase [Nucleotide transport | 89.03 | |
| PRK06762 | 166 | hypothetical protein; Provisional | 88.38 | |
| PRK14970 | 367 | DNA polymerase III subunits gamma and tau; Provisi | 88.11 | |
| TIGR02880 | 284 | cbbX_cfxQ probable Rubsico expression protein CbbX | 87.98 | |
| PF13271 | 83 | DUF4062: Domain of unknown function (DUF4062) | 87.97 | |
| PTZ00112 | 1164 | origin recognition complex 1 protein; Provisional | 87.73 | |
| PRK05541 | 176 | adenylylsulfate kinase; Provisional | 87.51 | |
| cd02023 | 198 | UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. | 87.45 | |
| PRK03839 | 180 | putative kinase; Provisional | 87.43 | |
| cd02024 | 187 | NRK1 Nicotinamide riboside kinase (NRK) is an enzy | 87.16 | |
| cd01857 | 141 | HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t | 87.03 | |
| PRK06547 | 172 | hypothetical protein; Provisional | 86.89 | |
| PRK04040 | 188 | adenylate kinase; Provisional | 86.83 | |
| PRK14960 | 702 | DNA polymerase III subunits gamma and tau; Provisi | 86.83 | |
| PF04665 | 241 | Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 | 86.68 | |
| PRK07994 | 647 | DNA polymerase III subunits gamma and tau; Validat | 86.68 | |
| PF03205 | 140 | MobB: Molybdopterin guanine dinucleotide synthesis | 86.64 | |
| cd02042 | 104 | ParA ParA and ParB of Caulobacter crescentus belon | 86.5 | |
| cd02025 | 220 | PanK Pantothenate kinase (PanK) catalyzes the phos | 86.48 | |
| CHL00181 | 287 | cbbX CbbX; Provisional | 86.47 | |
| PRK07940 | 394 | DNA polymerase III subunit delta'; Validated | 86.46 | |
| COG1428 | 216 | Deoxynucleoside kinases [Nucleotide transport and | 86.43 | |
| KOG2028 | 554 | consensus ATPase related to the helicase subunit o | 86.1 | |
| PF05496 | 233 | RuvB_N: Holliday junction DNA helicase ruvB N-term | 86.03 | |
| PRK07764 | 824 | DNA polymerase III subunits gamma and tau; Validat | 86.02 | |
| PRK00771 | 437 | signal recognition particle protein Srp54; Provisi | 85.93 | |
| PF13604 | 196 | AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL | 85.91 | |
| PRK00131 | 175 | aroK shikimate kinase; Reviewed | 85.69 | |
| PRK12608 | 380 | transcription termination factor Rho; Provisional | 85.65 | |
| PRK11889 | 436 | flhF flagellar biosynthesis regulator FlhF; Provis | 85.59 | |
| TIGR03596 | 276 | GTPase_YlqF ribosome biogenesis GTP-binding protei | 85.57 | |
| PRK11331 | 459 | 5-methylcytosine-specific restriction enzyme subun | 85.52 | |
| COG1763 | 161 | MobB Molybdopterin-guanine dinucleotide biosynthes | 85.27 | |
| cd02028 | 179 | UMPK_like Uridine monophosphate kinase_like (UMPK_ | 85.23 | |
| cd02019 | 69 | NK Nucleoside/nucleotide kinase (NK) is a protein | 85.18 | |
| PRK08691 | 709 | DNA polymerase III subunits gamma and tau; Validat | 85.05 | |
| PRK05439 | 311 | pantothenate kinase; Provisional | 84.82 | |
| COG4916 | 329 | Uncharacterized protein containing a TIR (Toll-Int | 84.65 | |
| PF13671 | 143 | AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 | 84.56 | |
| PRK14964 | 491 | DNA polymerase III subunits gamma and tau; Provisi | 84.39 | |
| TIGR03156 | 351 | GTP_HflX GTP-binding protein HflX. This protein fa | 84.36 | |
| TIGR00554 | 290 | panK_bact pantothenate kinase, bacterial type. Sho | 84.34 | |
| PTZ00454 | 398 | 26S protease regulatory subunit 6B-like protein; P | 84.33 | |
| TIGR01360 | 188 | aden_kin_iso1 adenylate kinase, isozyme 1 subfamil | 84.32 | |
| COG4240 | 300 | Predicted kinase [General function prediction only | 84.27 | |
| PF13614 | 157 | AAA_31: AAA domain; PDB: 2VED_B 2PH1_A 3EA0_B 3FKQ | 84.2 | |
| COG1100 | 219 | GTPase SAR1 and related small G proteins [General | 84.08 | |
| PRK00889 | 175 | adenylylsulfate kinase; Provisional | 83.95 | |
| PRK06217 | 183 | hypothetical protein; Validated | 83.9 | |
| CHL00176 | 638 | ftsH cell division protein; Validated | 83.79 | |
| smart00382 | 148 | AAA ATPases associated with a variety of cellular | 83.49 | |
| PF06564 | 243 | YhjQ: YhjQ protein; InterPro: IPR017746 The YhjQ p | 83.29 | |
| TIGR00176 | 155 | mobB molybdopterin-guanine dinucleotide biosynthes | 83.16 | |
| PF08477 | 119 | Miro: Miro-like protein; InterPro: IPR013684 Mitoc | 83.15 | |
| cd01133 | 274 | F1-ATPase_beta F1 ATP synthase beta subunit, nucle | 82.83 | |
| PRK10751 | 173 | molybdopterin-guanine dinucleotide biosynthesis pr | 82.74 | |
| PRK10867 | 433 | signal recognition particle protein; Provisional | 82.71 | |
| PF01926 | 116 | MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I | 82.64 | |
| PF01656 | 195 | CbiA: CobQ/CobB/MinD/ParA nucleotide binding domai | 82.63 | |
| COG2019 | 189 | AdkA Archaeal adenylate kinase [Nucleotide transpo | 82.58 | |
| PRK14493 | 274 | putative bifunctional molybdopterin-guanine dinucl | 82.55 | |
| PRK09563 | 287 | rbgA GTPase YlqF; Reviewed | 82.46 | |
| TIGR00073 | 207 | hypB hydrogenase accessory protein HypB. HypB is i | 82.42 | |
| cd04139 | 164 | RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) | 82.28 | |
| cd01983 | 99 | Fer4_NifH The Fer4_NifH superfamily contains a var | 82.25 | |
| PF02680 | 95 | DUF211: Uncharacterized ArCR, COG1888; InterPro: I | 82.18 | |
| PRK14956 | 484 | DNA polymerase III subunits gamma and tau; Provisi | 82.1 | |
| PF00004 | 132 | AAA: ATPase family associated with various cellula | 82.05 | |
| smart00763 | 361 | AAA_PrkA PrkA AAA domain. This is a family of PrkA | 81.94 | |
| PRK03846 | 198 | adenylylsulfate kinase; Provisional | 81.94 | |
| PF00910 | 107 | RNA_helicase: RNA helicase; InterPro: IPR000605 He | 81.89 | |
| TIGR02322 | 179 | phosphon_PhnN phosphonate metabolism protein/1,5-b | 81.87 | |
| cd00227 | 175 | CPT Chloramphenicol (Cm) phosphotransferase (CPT). | 81.83 | |
| PRK08903 | 227 | DnaA regulatory inactivator Hda; Validated | 81.72 | |
| PF07726 | 131 | AAA_3: ATPase family associated with various cellu | 81.59 | |
| PHA00729 | 226 | NTP-binding motif containing protein | 81.54 | |
| PRK13975 | 196 | thymidylate kinase; Provisional | 81.27 | |
| PRK13947 | 171 | shikimate kinase; Provisional | 81.14 | |
| TIGR02397 | 355 | dnaX_nterm DNA polymerase III, subunit gamma and t | 81.14 | |
| PF01583 | 156 | APS_kinase: Adenylylsulphate kinase; InterPro: IPR | 81.1 | |
| TIGR03263 | 180 | guanyl_kin guanylate kinase. Members of this famil | 81.08 | |
| PRK00625 | 173 | shikimate kinase; Provisional | 81.07 | |
| PLN02348 | 395 | phosphoribulokinase | 81.02 | |
| COG0593 | 408 | DnaA ATPase involved in DNA replication initiation | 80.99 | |
| PRK07471 | 365 | DNA polymerase III subunit delta'; Validated | 80.88 | |
| PRK00300 | 205 | gmk guanylate kinase; Provisional | 80.88 | |
| PRK13695 | 174 | putative NTPase; Provisional | 80.36 | |
| PHA02518 | 211 | ParA-like protein; Provisional | 80.32 | |
| cd02020 | 147 | CMPK Cytidine monophosphate kinase (CMPK) catalyze | 80.29 | |
| PRK13768 | 253 | GTPase; Provisional | 80.28 | |
| cd04155 | 173 | Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f | 80.28 | |
| cd00879 | 190 | Sar1 Sar1 subfamily. Sar1 is an essential componen | 80.12 | |
| TIGR00959 | 428 | ffh signal recognition particle protein. This mode | 80.07 | |
| TIGR01287 | 275 | nifH nitrogenase iron protein. This model describe | 80.05 |
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.8e-69 Score=625.38 Aligned_cols=342 Identities=27% Similarity=0.396 Sum_probs=289.4
Q ss_pred CCceecCceEEecccCccCcChHHHHHHHHhcCCCeEEEeCCcCCCCCchHHHHHHHhhccceEEEeecccccChhhHHH
Q 011431 16 DQWRYKHDVFVTFSGEDIRENFGSYLFAALFRESVKTFRDEQIRRGDEIMPALLQAIEESKISLVIFSKRFAFSRWCLEE 95 (486)
Q Consensus 16 ~~~~y~~dVFis~~~~D~~~~f~~~L~~~L~~~gi~~~~d~~~~~g~~i~~~i~~~I~~s~~~ivv~S~~y~~S~wcl~E 95 (486)
+.|+| ||||||||+|+|++|++||+.||.++||++|+|+++.+|+.|++++.+||++|+++|||||++||+|+|||+|
T Consensus 9 ~~~~~--~vf~sfrg~d~r~~f~~hl~~~l~~~~i~~f~d~~~~~g~~~~~~l~~~i~~s~~~ivv~s~~ya~s~wcl~e 86 (1153)
T PLN03210 9 RNWVY--DVFPSFSGEDVRITFLSHFLKELDRKLIIAFKDNEIERSQSLDPELKQAIRDSRIAVVVFSKNYASSSWCLNE 86 (1153)
T ss_pred CCCCC--cEEeeCCCcccccCHHHHHHHHHHHCCCeEEccCCccCCCcccHHHHHHHHhCeEEEEEecCCcccchHHHHH
Confidence 46888 9999999999999999999999999999999998999999999999999999999999999999999999999
Q ss_pred HHHHHHH-hcCCCEEEEEEeeecCCccccccCchHHHHHHhHhhCCCchhhccHHHHHHHhhhccCCCCCCCCCcchhhh
Q 011431 96 LVKIIEC-NKLYQTVIPVFYKVLPSDVRNQLGSFGEAFLEHEKSHDLRPKVGRWRDALREASDLAGWDSNVTRPESKLTD 174 (486)
Q Consensus 96 l~~i~~~-~~~~~~v~Pify~v~~s~vr~q~g~f~~~f~~~~~~~~~~e~i~~Wr~AL~eva~~~G~~~~~~~~E~~~I~ 174 (486)
|++|++| ++.++.|+||||+|+|++||+|+|.||++|.+++.+.. .+++++|++||++||+++||++..+++|+++|+
T Consensus 87 l~~i~~~~~~~~~~v~pvfy~v~p~~v~~~~g~f~~~f~~~~~~~~-~~~~~~w~~al~~~~~~~g~~~~~~~~E~~~i~ 165 (1153)
T PLN03210 87 LLEIVRCKEELGQLVIPVFYGLDPSHVRKQTGDFGEAFEKTCQNKT-EDEKIQWKQALTDVANILGYHSQNWPNEAKMIE 165 (1153)
T ss_pred HHHHHHhhhhcCceEEEEEecccHHHHhhccchHHHHHHHHhcccc-hhHHHHHHHHHHHHhCcCceecCCCCCHHHHHH
Confidence 9999999 88999999999999999999999999999999987755 688999999999999999999999899999999
Q ss_pred hHHHhHHhhhhhhhhhhHHHHHHHhhhhhhccchhhhhhHHHHHHHhh-cCCCceeeeeeeccCccchhHHHHHHHhhhc
Q 011431 175 EIVNGVVENLKSFAELMEKELVVLFNRARDKLDNHASSLLDEVLSLLR-NAEGYRSYRCWLLCPLFSELRVLTNDVHQLM 253 (486)
Q Consensus 175 ~IV~~V~~~L~~~~~~~~~~lVgi~~~~~~~~~~~~~~~l~~v~~ll~-~~~~~~vi~I~GmGgGvGKTTLa~~vy~~~~ 253 (486)
+||++|..+|........+++||+.. .++++..++. ..+++++||||||| |+||||||+.+|+++.
T Consensus 166 ~Iv~~v~~~l~~~~~~~~~~~vG~~~------------~l~~l~~lL~l~~~~~~vvgI~G~g-GiGKTTLA~~l~~~l~ 232 (1153)
T PLN03210 166 EIANDVLGKLNLTPSNDFEDFVGIED------------HIAKMSSLLHLESEEVRMVGIWGSS-GIGKTTIARALFSRLS 232 (1153)
T ss_pred HHHHHHHHhhccccCcccccccchHH------------HHHHHHHHHccccCceEEEEEEcCC-CCchHHHHHHHHHHHh
Confidence 99999999998766665677888733 2345555553 35679999999999 9999999999999999
Q ss_pred cccccceEEE---Eeeec-----------c-HHHHHHHHhhhhcccccccccccccccccccccccccCcceeeceeccc
Q 011431 254 DNYENSDVTL---AKFEG-----------E-VKKLDQRLLRFLESVDKHVASYDRYGSASFEQPRPQTTSAAHPYVEDVI 318 (486)
Q Consensus 254 ~~F~~~~~~~---v~~~~-----------~-l~~lqk~ll~~L~~~d~~~~~~~~~g~~s~l~~~L~~tKr~LlVLDDVw 318 (486)
.+|++.++.. +.... . ...++++++..+...... .. .....++++|.+ +|+||||||||
T Consensus 233 ~~F~g~vfv~~~~v~~~~~~~~~~~~~~~~~~~~l~~~~l~~il~~~~~-~~----~~~~~~~~~L~~-krvLLVLDdv~ 306 (1153)
T PLN03210 233 RQFQSSVFIDRAFISKSMEIYSSANPDDYNMKLHLQRAFLSEILDKKDI-KI----YHLGAMEERLKH-RKVLIFIDDLD 306 (1153)
T ss_pred hcCCeEEEeeccccccchhhcccccccccchhHHHHHHHHHHHhCCCCc-cc----CCHHHHHHHHhC-CeEEEEEeCCC
Confidence 9998765532 11110 0 123566666555432111 00 011346778888 99999999999
Q ss_pred CHHHHHHHhcCCCCCCCCCEEEeeCCccccccccccCCCceEecCCCCCchhhhhhcccCCCc
Q 011431 319 DDAYMEDITDDSSPSLNLSRINSTSRFEQLWPETISATDTCTEDVTVDNSPSLNLSSCNSSST 381 (486)
Q Consensus 319 ~~~~~~~l~~~~~~~~~GSrIIiTTR~~~V~~~~~~~~~~~y~v~~L~~~es~~LF~~~a~~k 381 (486)
+..+|+.+.....++++|||||||||+++++. .++.+.+|+|+.|+++|||+||+++||..
T Consensus 307 ~~~~l~~L~~~~~~~~~GsrIIiTTrd~~vl~--~~~~~~~~~v~~l~~~ea~~LF~~~Af~~ 367 (1153)
T PLN03210 307 DQDVLDALAGQTQWFGSGSRIIVITKDKHFLR--AHGIDHIYEVCLPSNELALEMFCRSAFKK 367 (1153)
T ss_pred CHHHHHHHHhhCccCCCCcEEEEEeCcHHHHH--hcCCCeEEEecCCCHHHHHHHHHHHhcCC
Confidence 99999998854334789999999999999984 34467899999999999999999999974
|
syringae 6; Provisional |
| >PLN03194 putative disease resistance protein; Provisional | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF01582 TIR: TIR domain; InterPro: IPR000157 In Drosophila melanogaster the Toll protein is involved in establishment of dorso-ventral polarity in the embryo | Back alignment and domain information |
|---|
| >PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] | Back alignment and domain information |
|---|
| >smart00255 TIR Toll - interleukin 1 - resistance | Back alignment and domain information |
|---|
| >PF13676 TIR_2: TIR domain; PDB: 3H16_B 3UB4_A 2Y92_A 3UB3_A 3UB2_A | Back alignment and domain information |
|---|
| >KOG1603 consensus Copper chaperone [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF00403 HMA: Heavy-metal-associated domain; InterPro: IPR006121 Proteins that transport heavy metals in micro-organisms and mammals share similarities in their sequences and structures | Back alignment and domain information |
|---|
| >KOG3678 consensus SARM protein (with sterile alpha and armadillo motifs) [Extracellular structures] | Back alignment and domain information |
|---|
| >PF05729 NACHT: NACHT domain | Back alignment and domain information |
|---|
| >PF08937 DUF1863: MTH538 TIR-like domain (DUF1863); InterPro: IPR015032 This protein adopts the flavodoxin fold, that is, five parallel beta-strands and four helical segments | Back alignment and domain information |
|---|
| >PRK06893 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >KOG4656 consensus Copper chaperone for superoxide dismutase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF13173 AAA_14: AAA domain | Back alignment and domain information |
|---|
| >COG2608 CopZ Copper chaperone [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >PRK00411 cdc6 cell division control protein 6; Reviewed | Back alignment and domain information |
|---|
| >cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase | Back alignment and domain information |
|---|
| >cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >PRK13342 recombination factor protein RarA; Reviewed | Back alignment and domain information |
|---|
| >COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK09376 rho transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit | Back alignment and domain information |
|---|
| >PLN02957 copper, zinc superoxide dismutase | Back alignment and domain information |
|---|
| >PF08357 SEFIR: SEFIR domain; InterPro: IPR013568 This domain is found in IL17 receptors (IL17Rs, e | Back alignment and domain information |
|---|
| >TIGR02903 spore_lon_C ATP-dependent protease, Lon family | Back alignment and domain information |
|---|
| >PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed | Back alignment and domain information |
|---|
| >TIGR01242 26Sp45 26S proteasome subunit P45 family | Back alignment and domain information |
|---|
| >PRK09087 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed | Back alignment and domain information |
|---|
| >TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda | Back alignment and domain information |
|---|
| >PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP | Back alignment and domain information |
|---|
| >PRK08727 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK05564 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK08116 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK04841 transcriptional regulator MalT; Provisional | Back alignment and domain information |
|---|
| >PF10137 TIR-like: Predicted nucleotide-binding protein containing TIR-like domain; InterPro: IPR019302 This entry represents a TIR-like domain found in a family of prokaryotic predicted nucleotide-binding proteins | Back alignment and domain information |
|---|
| >PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B | Back alignment and domain information |
|---|
| >PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication | Back alignment and domain information |
|---|
| >TIGR02928 orc1/cdc6 family replication initiation protein | Back alignment and domain information |
|---|
| >PRK05642 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >PLN03025 replication factor C subunit; Provisional | Back alignment and domain information |
|---|
| >PRK08084 DNA replication initiation factor; Provisional | Back alignment and domain information |
|---|
| >PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function | Back alignment and domain information |
|---|
| >PRK06620 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR00362 DnaA chromosomal replication initiator protein DnaA | Back alignment and domain information |
|---|
| >TIGR00767 rho transcription termination factor Rho | Back alignment and domain information |
|---|
| >PRK14963 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK07003 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PHA02544 44 clamp loader, small subunit; Provisional | Back alignment and domain information |
|---|
| >PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A | Back alignment and domain information |
|---|
| >PRK08118 topology modulation protein; Reviewed | Back alignment and domain information |
|---|
| >PRK14088 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK12402 replication factor C small subunit 2; Reviewed | Back alignment and domain information |
|---|
| >PRK12422 chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK14961 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK00149 dnaA chromosomal replication initiation protein; Reviewed | Back alignment and domain information |
|---|
| >PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed | Back alignment and domain information |
|---|
| >PRK07667 uridine kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14086 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK14087 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK04195 replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >PRK07261 topology modulation protein; Provisional | Back alignment and domain information |
|---|
| >PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C | Back alignment and domain information |
|---|
| >TIGR02881 spore_V_K stage V sporulation protein K | Back alignment and domain information |
|---|
| >PRK06696 uridine kinase; Validated | Back alignment and domain information |
|---|
| >PRK05480 uridine/cytidine kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR00678 holB DNA polymerase III, delta' subunit | Back alignment and domain information |
|---|
| >PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 | Back alignment and domain information |
|---|
| >PRK12377 putative replication protein; Provisional | Back alignment and domain information |
|---|
| >PRK06645 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK10671 copA copper exporting ATPase; Provisional | Back alignment and domain information |
|---|
| >PRK03992 proteasome-activating nucleotidase; Provisional | Back alignment and domain information |
|---|
| >TIGR01425 SRP54_euk signal recognition particle protein SRP54 | Back alignment and domain information |
|---|
| >PRK14949 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >COG1373 Predicted ATPase (AAA+ superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14951 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK08233 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03689 pup_AAA proteasome ATPase | Back alignment and domain information |
|---|
| >PRK12323 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK06921 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK00440 rfc replication factor C small subunit; Reviewed | Back alignment and domain information |
|---|
| >TIGR00235 udk uridine kinase | Back alignment and domain information |
|---|
| >COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd01858 NGP_1 NGP-1 | Back alignment and domain information |
|---|
| >PRK14957 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14962 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A | Back alignment and domain information |
|---|
| >PTZ00301 uridine kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR00064 ftsY signal recognition particle-docking protein FtsY | Back alignment and domain information |
|---|
| >PRK10416 signal recognition particle-docking protein FtsY; Provisional | Back alignment and domain information |
|---|
| >PRK06835 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK06762 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK14970 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX | Back alignment and domain information |
|---|
| >PF13271 DUF4062: Domain of unknown function (DUF4062) | Back alignment and domain information |
|---|
| >PTZ00112 origin recognition complex 1 protein; Provisional | Back alignment and domain information |
|---|
| >PRK05541 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 | Back alignment and domain information |
|---|
| >PRK03839 putative kinase; Provisional | Back alignment and domain information |
|---|
| >cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) | Back alignment and domain information |
|---|
| >cd01857 HSR1_MMR1 HSR1/MMR1 | Back alignment and domain information |
|---|
| >PRK06547 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK04040 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14960 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein | Back alignment and domain information |
|---|
| >PRK07994 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A | Back alignment and domain information |
|---|
| >cd02042 ParA ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation | Back alignment and domain information |
|---|
| >cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway | Back alignment and domain information |
|---|
| >CHL00181 cbbX CbbX; Provisional | Back alignment and domain information |
|---|
| >PRK07940 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >COG1428 Deoxynucleoside kinases [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair | Back alignment and domain information |
|---|
| >PRK07764 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK00771 signal recognition particle protein Srp54; Provisional | Back alignment and domain information |
|---|
| >PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A | Back alignment and domain information |
|---|
| >PRK00131 aroK shikimate kinase; Reviewed | Back alignment and domain information |
|---|
| >PRK12608 transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF | Back alignment and domain information |
|---|
| >PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional | Back alignment and domain information |
|---|
| >COG1763 MobB Molybdopterin-guanine dinucleotide biosynthesis protein [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 | Back alignment and domain information |
|---|
| >cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars | Back alignment and domain information |
|---|
| >PRK08691 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK05439 pantothenate kinase; Provisional | Back alignment and domain information |
|---|
| >COG4916 Uncharacterized protein containing a TIR (Toll-Interleukin 1-resistance) domain [Function unknown] | Back alignment and domain information |
|---|
| >PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B | Back alignment and domain information |
|---|
| >PRK14964 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR03156 GTP_HflX GTP-binding protein HflX | Back alignment and domain information |
|---|
| >TIGR00554 panK_bact pantothenate kinase, bacterial type | Back alignment and domain information |
|---|
| >PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily | Back alignment and domain information |
|---|
| >COG4240 Predicted kinase [General function prediction only] | Back alignment and domain information |
|---|
| >PF13614 AAA_31: AAA domain; PDB: 2VED_B 2PH1_A 3EA0_B 3FKQ_A 3KB1_B 1ION_A 3LA6_H 3BFV_B 3CIO_D | Back alignment and domain information |
|---|
| >COG1100 GTPase SAR1 and related small G proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PRK00889 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK06217 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >CHL00176 ftsH cell division protein; Validated | Back alignment and domain information |
|---|
| >smart00382 AAA ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >PF06564 YhjQ: YhjQ protein; InterPro: IPR017746 The YhjQ protein is encoded immediately upstream of bacterial cellulose synthase (bcs) genes in a broad range of bacteria, including both copies of the bcs locus in Klebsiella pneumoniae, and in several species is clearly part of the bcs operon | Back alignment and domain information |
|---|
| >TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB | Back alignment and domain information |
|---|
| >PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases | Back alignment and domain information |
|---|
| >cd01133 F1-ATPase_beta F1 ATP synthase beta subunit, nucleotide-binding domain | Back alignment and domain information |
|---|
| >PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional | Back alignment and domain information |
|---|
| >PRK10867 signal recognition particle protein; Provisional | Back alignment and domain information |
|---|
| >PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse | Back alignment and domain information |
|---|
| >PF01656 CbiA: CobQ/CobB/MinD/ParA nucleotide binding domain; InterPro: IPR002586 This entry consists of various cobyrinic acid a,c-diamide synthases | Back alignment and domain information |
|---|
| >COG2019 AdkA Archaeal adenylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14493 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MoaE; Provisional | Back alignment and domain information |
|---|
| >PRK09563 rbgA GTPase YlqF; Reviewed | Back alignment and domain information |
|---|
| >TIGR00073 hypB hydrogenase accessory protein HypB | Back alignment and domain information |
|---|
| >cd04139 RalA_RalB RalA/RalB subfamily | Back alignment and domain information |
|---|
| >cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain | Back alignment and domain information |
|---|
| >PF02680 DUF211: Uncharacterized ArCR, COG1888; InterPro: IPR003831 This entry describes proteins of unknown function | Back alignment and domain information |
|---|
| >PRK14956 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport | Back alignment and domain information |
|---|
| >smart00763 AAA_PrkA PrkA AAA domain | Back alignment and domain information |
|---|
| >PRK03846 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) | Back alignment and domain information |
|---|
| >TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN | Back alignment and domain information |
|---|
| >cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) | Back alignment and domain information |
|---|
| >PRK08903 DnaA regulatory inactivator Hda; Validated | Back alignment and domain information |
|---|
| >PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model | Back alignment and domain information |
|---|
| >PHA00729 NTP-binding motif containing protein | Back alignment and domain information |
|---|
| >PRK13975 thymidylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK13947 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau | Back alignment and domain information |
|---|
| >PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases | Back alignment and domain information |
|---|
| >TIGR03263 guanyl_kin guanylate kinase | Back alignment and domain information |
|---|
| >PRK00625 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PLN02348 phosphoribulokinase | Back alignment and domain information |
|---|
| >COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK07471 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK00300 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK13695 putative NTPase; Provisional | Back alignment and domain information |
|---|
| >PHA02518 ParA-like protein; Provisional | Back alignment and domain information |
|---|
| >cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor | Back alignment and domain information |
|---|
| >PRK13768 GTPase; Provisional | Back alignment and domain information |
|---|
| >cd04155 Arl3 Arl3 subfamily | Back alignment and domain information |
|---|
| >cd00879 Sar1 Sar1 subfamily | Back alignment and domain information |
|---|
| >TIGR00959 ffh signal recognition particle protein | Back alignment and domain information |
|---|
| >TIGR01287 nifH nitrogenase iron protein | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 486 | ||||
| 3ozi_A | 204 | Crystal Structure Of The Tir Domain From The Flax D | 2e-27 | ||
| 3jrn_A | 176 | Crystal Structure Of Tir Domain From Arabidopsis Th | 2e-25 |
| >pdb|3OZI|A Chain A, Crystal Structure Of The Tir Domain From The Flax Disease Resistance Protein L6 Length = 204 | Back alignment and structure |
|
| >pdb|3JRN|A Chain A, Crystal Structure Of Tir Domain From Arabidopsis Thaliana Length = 176 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 486 | |||
| 3ozi_A | 204 | L6TR; plant TIR domain, plant protein; 2.30A {Linu | 9e-80 | |
| 3jrn_A | 176 | AT1G72930 protein; TIR domain arabidopsis thaliana | 4e-76 | |
| 3h16_A | 154 | TIR protein; bacteria TIR domain, signaling protei | 1e-57 | |
| 3ub2_A | 146 | TOLL/interleukin-1 receptor domain-containing ADA | 1e-10 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-05 | |
| 2j67_A | 178 | TOLL like receptor 10; TIR, IL-1, TLR10, membrane, | 9e-05 | |
| 1t3g_A | 159 | X-linked interleukin-1 receptor accessory protein- | 2e-04 | |
| 2js7_A | 160 | Myeloid differentiation primary response protein M | 6e-04 |
| >3ozi_A L6TR; plant TIR domain, plant protein; 2.30A {Linum usitatissimum} Length = 204 | Back alignment and structure |
|---|
Score = 246 bits (629), Expect = 9e-80
Identities = 63/187 (33%), Positives = 107/187 (57%), Gaps = 10/187 (5%)
Query: 1 MASSSLSSSSSRRLRDQWRYKHDVFVTFSGEDIRENFGSYLFAALFRESVKTFRD-EQIR 59
++ S+ S S +++VF++F G D RE F +L+ +L R + TFRD +++
Sbjct: 21 ISDSTNPSGSFPS------VEYEVFLSFRGPDTREQFTDFLYQSLRRYKIHTFRDDDELL 74
Query: 60 RGDEIMPALLQAIEESKISLVIFSKRFAFSRWCLEELVKIIECNKLY--QTVIPVFYKVL 117
+G EI P LL+AI++SKI + I S +A S+WCL EL +I+ + + ++P+FY V
Sbjct: 75 KGKEIGPNLLRAIDQSKIYVPIISSGYADSKWCLMELAEIVRRQEEDPRRIILPIFYMVD 134
Query: 118 PSDVRNQLGSFGEAFLEHEKSHDLRPKVGRWRDALREASDLAGWDSNVTRPESKLTDEIV 177
PSDVR+Q G + +AF +H D + W+DAL++ DL GW + + D++
Sbjct: 135 PSDVRHQTGCYKKAFRKHANKFD-GQTIQNWKDALKKVGDLKGWHIGKNDKQGAIADKVS 193
Query: 178 NGVVENL 184
+ ++
Sbjct: 194 ADIWSHI 200
|
| >3jrn_A AT1G72930 protein; TIR domain arabidopsis thaliana, plant protein; 2.00A {Arabidopsis thaliana} Length = 176 | Back alignment and structure |
|---|
| >3h16_A TIR protein; bacteria TIR domain, signaling protein; 2.50A {Paracoccus denitrificans PD1222} Length = 154 | Back alignment and structure |
|---|
| >3ub2_A TOLL/interleukin-1 receptor domain-containing ADA protein; TIR domain, TLRS adaptor, immune system; 2.40A {Homo sapiens} PDB: 3ub3_A 3ub4_A 2y92_A Length = 146 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2j67_A TOLL like receptor 10; TIR, IL-1, TLR10, membrane, innate immunity, immune response, leucine-rich repeat, glycoprotein, transmembrane; 2.20A {Homo sapiens} PDB: 1fyv_A Length = 178 | Back alignment and structure |
|---|
| >1t3g_A X-linked interleukin-1 receptor accessory protein-like 1; TIR, IL-1RAPL, IL-1R, TLR, membrane protein; 2.30A {Homo sapiens} Length = 159 | Back alignment and structure |
|---|
| >2js7_A Myeloid differentiation primary response protein MYD88; MYD88_human, TIR domain, TOLL like receptor adaptor domain, innate immune signaling; NMR {Homo sapiens} PDB: 2z5v_A Length = 160 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 486 | |||
| 3ozi_A | 204 | L6TR; plant TIR domain, plant protein; 2.30A {Linu | 100.0 | |
| 3jrn_A | 176 | AT1G72930 protein; TIR domain arabidopsis thaliana | 100.0 | |
| 3h16_A | 154 | TIR protein; bacteria TIR domain, signaling protei | 99.96 | |
| 3ub2_A | 146 | TOLL/interleukin-1 receptor domain-containing ADA | 99.88 | |
| 2a5y_B | 549 | CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis | 99.87 | |
| 1fyx_A | 149 | TOLL-like receptor 2; beta-alpha-beta fold, signal | 99.83 | |
| 2j67_A | 178 | TOLL like receptor 10; TIR, IL-1, TLR10, membrane, | 99.82 | |
| 1t3g_A | 159 | X-linked interleukin-1 receptor accessory protein- | 99.82 | |
| 2js7_A | 160 | Myeloid differentiation primary response protein M | 99.82 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 99.73 | |
| 3sfz_A | 1249 | APAF-1, apoptotic peptidase activating factor 1; a | 99.69 | |
| 1z6t_A | 591 | APAF-1, apoptotic protease activating factor 1; ca | 99.52 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 99.49 | |
| 3iwl_A | 68 | Copper transport protein ATOX1; beta-alpha-beta-BE | 98.63 | |
| 1cc8_A | 73 | Protein (metallochaperone ATX1); copper transport, | 98.46 | |
| 2crl_A | 98 | Copper chaperone for superoxide dismutase; SOD1, f | 98.35 | |
| 1w5s_A | 412 | Origin recognition complex subunit 2 ORC2; replica | 98.13 | |
| 4a4j_A | 69 | Pacszia, cation-transporting ATPase PACS; hydrolas | 98.1 | |
| 1njg_A | 250 | DNA polymerase III subunit gamma; rossman-like fol | 98.06 | |
| 2qby_B | 384 | CDC6 homolog 3, cell division control protein 6 ho | 98.05 | |
| 3dxs_X | 74 | Copper-transporting ATPase RAN1; CXXC motif, ferre | 97.95 | |
| 3fry_A | 73 | Probable copper-exporting P-type ATPase A; transpo | 97.93 | |
| 1qup_A | 222 | Superoxide dismutase 1 copper chaperone; two domai | 97.72 | |
| 2roe_A | 66 | Heavy metal binding protein; NMR {Thermus thermoph | 97.65 | |
| 2xmm_A | 64 | SSR2857 protein, ATX1; metal transport, copper hom | 97.63 | |
| 2chg_A | 226 | Replication factor C small subunit; DNA-binding pr | 97.6 | |
| 1jk9_B | 249 | CCS, copper chaperone for superoxide dismutase; pr | 97.56 | |
| 2qby_A | 386 | CDC6 homolog 1, cell division control protein 6 ho | 97.56 | |
| 2k2p_A | 85 | Uncharacterized protein ATU1203; putative metal-bi | 97.5 | |
| 2qen_A | 350 | Walker-type ATPase; unknown function; HET: ADP; 2. | 97.48 | |
| 2l3m_A | 71 | Copper-ION-binding protein; structural genomics, c | 97.38 | |
| 2xmw_A | 71 | PACS-N, cation-transporting ATPase PACS; hydrolase | 97.37 | |
| 1osd_A | 72 | MERP, hypothetical protein MERP; mercury resistanc | 97.36 | |
| 1q8l_A | 84 | Copper-transporting ATPase 1; metal binding protei | 97.35 | |
| 1fvq_A | 72 | Copper-transporting ATPase; APO-CCC2A, hydrolase; | 97.29 | |
| 2v1u_A | 387 | Cell division control protein 6 homolog; DNA repli | 97.16 | |
| 1yg0_A | 66 | COP associated protein; open-faced beta-sandwich, | 97.15 | |
| 3cjk_B | 75 | Copper-transporting ATPase 1; HAH1, ATP7B, menkes | 97.15 | |
| 1aw0_A | 72 | Menkes copper-transporting ATPase; copper-binding | 97.15 | |
| 1y3j_A | 77 | Copper-transporting ATPase 1; ferrodoxin-like fold | 97.13 | |
| 1mwy_A | 73 | ZNTA; open-faced beta-sandwich fold, beta-alpha-be | 97.07 | |
| 1cpz_A | 68 | Protein (COPZ); copper chaperone, metal transport, | 97.06 | |
| 2fna_A | 357 | Conserved hypothetical protein; structural genomic | 97.05 | |
| 2g9o_A | 90 | Copper-transporting ATPase 1; menkes disease, solu | 97.05 | |
| 2qif_A | 69 | Copper chaperone COPZ; tetranuclear Cu(I) cluster; | 96.99 | |
| 1sxj_B | 323 | Activator 1 37 kDa subunit; clamp loader, processi | 96.98 | |
| 1kvi_A | 79 | Copper-transporting ATPase 1; menkes, Cu-protein, | 96.91 | |
| 1yjr_A | 75 | Copper-transporting ATPase 1; metallochaperone, pr | 96.84 | |
| 1opz_A | 76 | Potential copper-transporting ATPase; mutation, fo | 96.81 | |
| 2kt2_A | 69 | Mercuric reductase; nmera, MERA, HMA domain, mercu | 96.79 | |
| 2ofg_X | 111 | Zinc-transporting ATPase; ferredoxin-like fold, be | 96.77 | |
| 2ldi_A | 71 | Zinc-transporting ATPase; metal homeostasis, metal | 96.74 | |
| 2kkh_A | 95 | Putative heavy metal transporter; zinc transport, | 96.74 | |
| 2z4s_A | 440 | Chromosomal replication initiator protein DNAA; AA | 96.65 | |
| 2kyz_A | 67 | Heavy metal binding protein; structural genomics, | 96.64 | |
| 1p6t_A | 151 | Potential copper-transporting ATPase; COPA, P-type | 96.63 | |
| 1eiw_A | 111 | Hypothetical protein MTH538; CHEY-like fold, flavo | 96.61 | |
| 2aj0_A | 71 | Probable cadmium-transporting ATPase; ferrodoxin-l | 96.6 | |
| 1iqp_A | 327 | RFCS; clamp loader, extended AAA-ATPase domain, co | 96.54 | |
| 1fnn_A | 389 | CDC6P, cell division control protein 6; ORC1, AAA | 96.5 | |
| 1jww_A | 80 | Potential copper-transporting ATPase; beta-alpha-b | 96.42 | |
| 2ew9_A | 149 | Copper-transporting ATPase 2; copper trafficking, | 96.09 | |
| 2rop_A | 202 | Copper-transporting ATPase 2; wilson protein, mobi | 95.97 | |
| 3hyn_A | 189 | Putative signal transduction protein; DUF1863 fami | 95.94 | |
| 2ew9_A | 149 | Copper-transporting ATPase 2; copper trafficking, | 95.14 | |
| 3h4m_A | 285 | Proteasome-activating nucleotidase; ATPase, PAN, A | 95.07 | |
| 1jr3_A | 373 | DNA polymerase III subunit gamma; processivity, pr | 94.72 | |
| 2rop_A | 202 | Copper-transporting ATPase 2; wilson protein, mobi | 94.53 | |
| 1l8q_A | 324 | Chromosomal replication initiator protein DNAA; AA | 94.49 | |
| 2chq_A | 319 | Replication factor C small subunit; DNA-binding pr | 94.27 | |
| 1d2n_A | 272 | N-ethylmaleimide-sensitive fusion protein; hexamer | 94.01 | |
| 1p6t_A | 151 | Potential copper-transporting ATPase; COPA, P-type | 93.87 | |
| 3syl_A | 309 | Protein CBBX; photosynthesis, rubisco activase, AA | 93.73 | |
| 2qz4_A | 262 | Paraplegin; AAA+, SPG7, protease, ADP, structural | 93.33 | |
| 3cf0_A | 301 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 92.27 | |
| 3u61_B | 324 | DNA polymerase accessory protein 44; AAA+, ATP hyd | 91.66 | |
| 3pvs_A | 447 | Replication-associated recombination protein A; ma | 91.4 | |
| 3j09_A | 723 | COPA, copper-exporting P-type ATPase A; copper tra | 91.26 | |
| 1a5t_A | 334 | Delta prime, HOLB; zinc finger, DNA replication; 2 | 90.65 | |
| 3eie_A | 322 | Vacuolar protein sorting-associated protein 4; AAA | 90.5 | |
| 3lw7_A | 179 | Adenylate kinase related protein (ADKA-like); AMP, | 89.91 | |
| 1zu4_A | 320 | FTSY; GTPase, signal recognition particle, SRP, re | 89.71 | |
| 1sxj_A | 516 | Activator 1 95 kDa subunit; clamp loader, processi | 89.64 | |
| 3te6_A | 318 | Regulatory protein SIR3; heterochromatin, gene sil | 89.22 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 89.08 | |
| 1odf_A | 290 | YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser | 88.75 | |
| 1jbk_A | 195 | CLPB protein; beta barrel, chaperone; 1.80A {Esche | 88.37 | |
| 3kb2_A | 173 | SPBC2 prophage-derived uncharacterized protein YOR | 88.16 | |
| 2w58_A | 202 | DNAI, primosome component (helicase loader); ATP-b | 88.05 | |
| 3c8u_A | 208 | Fructokinase; YP_612366.1, putative fructose trans | 87.71 | |
| 2zan_A | 444 | Vacuolar protein sorting-associating protein 4B; S | 87.5 | |
| 1qhx_A | 178 | CPT, protein (chloramphenicol phosphotransferase); | 87.2 | |
| 3vfd_A | 389 | Spastin; ATPase, microtubule severing, hydrolase; | 86.91 | |
| 3vaa_A | 199 | Shikimate kinase, SK; structural genomics, center | 86.76 | |
| 1zp6_A | 191 | Hypothetical protein ATU3015; alpha-beta protein., | 86.63 | |
| 1rz3_A | 201 | Hypothetical protein rbstp0775; MCSG, structural g | 86.58 | |
| 2jaq_A | 205 | Deoxyguanosine kinase; transferase, deoxyribonucle | 85.98 | |
| 1kag_A | 173 | SKI, shikimate kinase I; transferase, structural g | 85.89 | |
| 1xjc_A | 169 | MOBB protein homolog; structural genomics, midwest | 85.64 | |
| 2p65_A | 187 | Hypothetical protein PF08_0063; CLPB, malaria, str | 85.53 | |
| 3iij_A | 180 | Coilin-interacting nuclear ATPase protein; alpha a | 85.38 | |
| 3bpd_A | 100 | Uncharacterized protein; heptamer, Mg+2 ION, PSI-2 | 85.36 | |
| 3trf_A | 185 | Shikimate kinase, SK; amino acid biosynthesis, tra | 85.33 | |
| 2kjq_A | 149 | DNAA-related protein; solution structure, NESG, st | 85.0 | |
| 3t61_A | 202 | Gluconokinase; PSI-biology, structural genomics, p | 84.98 | |
| 1kgd_A | 180 | CASK, peripheral plasma membrane CASK; maguk, guan | 84.81 | |
| 1nks_A | 194 | Adenylate kinase; thermophilic, transferase; HET: | 84.62 | |
| 2og2_A | 359 | Putative signal recognition particle receptor; nuc | 84.53 | |
| 2ga8_A | 359 | Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn | 84.48 | |
| 3b9q_A | 302 | Chloroplast SRP receptor homolog, alpha subunit CP | 84.4 | |
| 3ea0_A | 245 | ATPase, para family; alpha-beta-alpha sandwich, st | 84.32 | |
| 2hf9_A | 226 | Probable hydrogenase nickel incorporation protein | 84.27 | |
| 1ly1_A | 181 | Polynucleotide kinase; PNK, phosphatase, transfera | 84.21 | |
| 3bos_A | 242 | Putative DNA replication factor; P-loop containing | 84.13 | |
| 1zuh_A | 168 | Shikimate kinase; alpha-beta protein, transferase; | 84.12 | |
| 1knq_A | 175 | Gluconate kinase; ALFA/beta structure, transferase | 84.07 | |
| 2if2_A | 204 | Dephospho-COA kinase; alpha-beta protein, structur | 83.85 | |
| 2yvu_A | 186 | Probable adenylyl-sulfate kinase; transferase, str | 83.83 | |
| 4dzz_A | 206 | Plasmid partitioning protein PARF; deviant walker | 83.69 | |
| 1kht_A | 192 | Adenylate kinase; phosphotransferase, signaling pr | 83.42 | |
| 3cwq_A | 209 | Para family chromosome partitioning protein; alpha | 83.34 | |
| 2bdt_A | 189 | BH3686; alpha-beta protein, structural genomics, P | 83.33 | |
| 2qor_A | 204 | Guanylate kinase; phosphotransferase, purine metab | 83.24 | |
| 2qt1_A | 207 | Nicotinamide riboside kinase 1; non-protein kinase | 83.19 | |
| 3a00_A | 186 | Guanylate kinase, GMP kinase; domain movement, dim | 83.17 | |
| 4eun_A | 200 | Thermoresistant glucokinase; putative sugar kinase | 83.15 | |
| 3fwy_A | 314 | Light-independent protochlorophyllide reductase I | 83.01 | |
| 2x3d_A | 96 | SSO6206; unknown function; 2.70A {Sulfolobus solfa | 83.0 | |
| 1gtv_A | 214 | TMK, thymidylate kinase; transferase, transferase | 82.91 | |
| 2wsm_A | 221 | Hydrogenase expression/formation protein (HYPB); m | 82.84 | |
| 2j41_A | 207 | Guanylate kinase; GMP, GMK, transferase, ATP-bindi | 82.81 | |
| 1uf9_A | 203 | TT1252 protein; P-loop, nucleotide binding domain, | 82.8 | |
| 2iyv_A | 184 | Shikimate kinase, SK; transferase, aromatic amino | 82.63 | |
| 2yhs_A | 503 | FTSY, cell division protein FTSY; cell cycle, prot | 82.57 | |
| 3uie_A | 200 | Adenylyl-sulfate kinase 1, chloroplastic; rossmann | 82.44 | |
| 1ukz_A | 203 | Uridylate kinase; transferase; HET: ADP AMP; 1.90A | 82.35 | |
| 1via_A | 175 | Shikimate kinase; structural genomics, transferase | 82.3 | |
| 3tr0_A | 205 | Guanylate kinase, GMP kinase; purines, pyrimidines | 82.13 | |
| 1ye8_A | 178 | Protein THEP1, hypothetical UPF0334 kinase-like pr | 82.11 | |
| 2rhm_A | 193 | Putative kinase; P-loop containing nucleoside trip | 82.03 | |
| 3asz_A | 211 | Uridine kinase; cytidine phosphorylation, transfer | 81.84 | |
| 3k9g_A | 267 | PF-32 protein; ssgcid, SBRI, decode biostructures, | 81.84 | |
| 3q9l_A | 260 | Septum site-determining protein MIND; ATPase, bact | 81.58 | |
| 2pt5_A | 168 | Shikimate kinase, SK; aromatic amino acid biosynth | 81.58 | |
| 2raq_A | 97 | Conserved protein MTH889; alpha-beta protein, stru | 81.43 | |
| 3t15_A | 293 | Ribulose bisphosphate carboxylase/oxygenase activ | 81.42 | |
| 1e6c_A | 173 | Shikimate kinase; phosphoryl transfer, ADP, shikim | 81.42 | |
| 2c95_A | 196 | Adenylate kinase 1; transferase, AP4A, nucleotide | 81.37 | |
| 2pbr_A | 195 | DTMP kinase, thymidylate kinase; transferase, nucl | 81.22 | |
| 2bwj_A | 199 | Adenylate kinase 5; phosphoryl transfer reaction, | 81.22 | |
| 1tev_A | 196 | UMP-CMP kinase; ploop, NMP binding region, LID reg | 81.17 | |
| 2vli_A | 183 | Antibiotic resistance protein; transferase, tunica | 81.08 | |
| 2px0_A | 296 | Flagellar biosynthesis protein FLHF; SRP GTPase, f | 81.01 | |
| 1cke_A | 227 | CK, MSSA, protein (cytidine monophosphate kinase); | 81.0 | |
| 3p32_A | 355 | Probable GTPase RV1496/MT1543; structural genomics | 80.99 | |
| 2p5t_B | 253 | PEZT; postsegregational killing system, phosphoryl | 80.88 | |
| 1jjv_A | 206 | Dephospho-COA kinase; P-loop nucleotide-binding fo | 80.86 | |
| 1g3q_A | 237 | MIND ATPase, cell division inhibitor; alpha-beta-a | 80.63 | |
| 2ged_A | 193 | SR-beta, signal recognition particle receptor beta | 80.55 | |
| 1tue_A | 212 | Replication protein E1; helicase, replication, E1E | 80.44 | |
| 2gno_A | 305 | DNA polymerase III, gamma subunit-related protein; | 80.38 | |
| 3tau_A | 208 | Guanylate kinase, GMP kinase; structural genomics, | 80.35 | |
| 2xxa_A | 433 | Signal recognition particle protein; protein trans | 80.31 | |
| 4gp7_A | 171 | Metallophosphoesterase; polynucleotide kinase phos | 80.25 | |
| 1lvg_A | 198 | Guanylate kinase, GMP kinase; transferase; HET: AD | 80.22 | |
| 3cm0_A | 186 | Adenylate kinase; ATP-binding, cytoplasm, nucleoti | 80.18 | |
| 1qf9_A | 194 | UMP/CMP kinase, protein (uridylmonophosphate/cytid | 80.15 | |
| 1uj2_A | 252 | Uridine-cytidine kinase 2; alpha/beta mononucleoti | 80.03 |
| >3ozi_A L6TR; plant TIR domain, plant protein; 2.30A {Linum usitatissimum} | Back alignment and structure |
|---|
Probab=100.00 E-value=2.4e-52 Score=383.74 Aligned_cols=176 Identities=35% Similarity=0.693 Sum_probs=159.9
Q ss_pred CCCCCCCCCCceecCceEEecccCccCcChHHHHHHHHhcCCCeEEEeC-CcCCCCCchHHHHHHHhhccceEEEeeccc
Q 011431 8 SSSSRRLRDQWRYKHDVFVTFSGEDIRENFGSYLFAALFRESVKTFRDE-QIRRGDEIMPALLQAIEESKISLVIFSKRF 86 (486)
Q Consensus 8 ~~~~~~~~~~~~y~~dVFis~~~~D~~~~f~~~L~~~L~~~gi~~~~d~-~~~~g~~i~~~i~~~I~~s~~~ivv~S~~y 86 (486)
|+++|+++++++| ||||||||+|+|++|++||+++|+++||++|+|+ ++.+|+.|.++|.+||++|+++|+|||+||
T Consensus 24 s~~~s~~~~~~~y--DVFISfrg~D~r~~Fv~~L~~aL~~~GI~~f~D~~el~~G~~I~~~l~~aIe~Sri~IvV~S~nY 101 (204)
T 3ozi_A 24 STNPSGSFPSVEY--EVFLSFRGPDTREQFTDFLYQSLRRYKIHTFRDDDELLKGKEIGPNLLRAIDQSKIYVPIISSGY 101 (204)
T ss_dssp ----------CCC--CEEEEECHHHHTTTHHHHHHHHHHHTTCCEEEEETTTCCGGGTTTTHHHHHHHCSEEEEEECTTG
T ss_pred CCCCcCCCCCcCC--eEEEeccccCCCHHHHHHHHHHHHHCCCcEEEeCCccCCCCchHHHHHHHHHhCcEeeEEEEccc
Confidence 4555667778989 9999999999999999999999999999999998 999999999999999999999999999999
Q ss_pred ccChhhHHHHHHHHHH-hc-CCCEEEEEEeeecCCccccccCchHHHHHHhHhhCCCchhhccHHHHHHHhhhccCCCCC
Q 011431 87 AFSRWCLEELVKIIEC-NK-LYQTVIPVFYKVLPSDVRNQLGSFGEAFLEHEKSHDLRPKVGRWRDALREASDLAGWDSN 164 (486)
Q Consensus 87 ~~S~wcl~El~~i~~~-~~-~~~~v~Pify~v~~s~vr~q~g~f~~~f~~~~~~~~~~e~i~~Wr~AL~eva~~~G~~~~ 164 (486)
++|.||++||++|++| ++ .+++||||||+|+|++||+|+|.||++|.+|+.++. .+++++|+.||++||+++||++.
T Consensus 102 a~S~WCl~EL~~I~e~~~~~~~~~ViPIFY~VdPs~Vr~q~g~fg~af~~~~~~~~-~~~v~~Wr~AL~~va~lsG~~~~ 180 (204)
T 3ozi_A 102 ADSKWCLMELAEIVRRQEEDPRRIILPIFYMVDPSDVRHQTGCYKKAFRKHANKFD-GQTIQNWKDALKKVGDLKGWHIG 180 (204)
T ss_dssp GGCHHHHHHHHHHHHHHHHCTTSEECCEEESSCHHHHHHTCTTHHHHHHHHTTTSC-HHHHHHHHHHHHHHHTSCBEEEC
T ss_pred ccCcHHHHHHHHHHHHHHhcCCeeeEEEEeecCHHHHHhccccHHHHHHHHHHhhC-HHHHHHHHHHHHHHhccCceecC
Confidence 9999999999999999 54 689999999999999999999999999999999886 68999999999999999999999
Q ss_pred CCCCcchhhhhHHHhHHhhhhh
Q 011431 165 VTRPESKLTDEIVNGVVENLKS 186 (486)
Q Consensus 165 ~~~~E~~~I~~IV~~V~~~L~~ 186 (486)
...+|+++|++||++|..+|+.
T Consensus 181 ~~~~e~~~i~~Iv~di~~kl~~ 202 (204)
T 3ozi_A 181 KNDKQGAIADKVSADIWSHISK 202 (204)
T ss_dssp TTSCHHHHHHHHHHHHHHHHHH
T ss_pred CCCCHHHHHHHHHHHHHHHhcc
Confidence 9988999999999999999863
|
| >3jrn_A AT1G72930 protein; TIR domain arabidopsis thaliana, plant protein; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3h16_A TIR protein; bacteria TIR domain, signaling protein; 2.50A {Paracoccus denitrificans PD1222} | Back alignment and structure |
|---|
| >3ub2_A TOLL/interleukin-1 receptor domain-containing ADA protein; TIR domain, TLRS adaptor, immune system; 2.40A {Homo sapiens} PDB: 3ub3_A 3ub4_A 2y92_A | Back alignment and structure |
|---|
| >2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* | Back alignment and structure |
|---|
| >1fyx_A TOLL-like receptor 2; beta-alpha-beta fold, signaling protein; 2.80A {Homo sapiens} SCOP: c.23.2.1 PDB: 1fyw_A 1o77_A | Back alignment and structure |
|---|
| >2j67_A TOLL like receptor 10; TIR, IL-1, TLR10, membrane, innate immunity, immune response, leucine-rich repeat, glycoprotein, transmembrane; 2.20A {Homo sapiens} PDB: 1fyv_A | Back alignment and structure |
|---|
| >1t3g_A X-linked interleukin-1 receptor accessory protein-like 1; TIR, IL-1RAPL, IL-1R, TLR, membrane protein; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2js7_A Myeloid differentiation primary response protein MYD88; MYD88_human, TIR domain, TOLL like receptor adaptor domain, innate immune signaling; NMR {Homo sapiens} PDB: 2z5v_A | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* | Back alignment and structure |
|---|
| >3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* | Back alignment and structure |
|---|
| >1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3iwl_A Copper transport protein ATOX1; beta-alpha-beta-BETA-alpha-beta, cisplatin, platinum, chaperone, ION transport, metal-binding, metal transport; HET: TCE; 1.60A {Homo sapiens} SCOP: d.58.17.1 PDB: 1fe4_A* 1fee_A* 1tl4_A 1tl5_A 2k1r_B 1fe0_A* 3iwx_A 3cjk_A | Back alignment and structure |
|---|
| >1cc8_A Protein (metallochaperone ATX1); copper transport, mercury coordination, metal transport; 1.02A {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1cc7_A 1fd8_A 1fes_A 2ggp_A 3k7r_A | Back alignment and structure |
|---|
| >2crl_A Copper chaperone for superoxide dismutase; SOD1, familial ALS, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* | Back alignment and structure |
|---|
| >4a4j_A Pacszia, cation-transporting ATPase PACS; hydrolase, copper homeostasis, zinc homeostasis, ATX1, metal-transporting atpases; 1.25A {Synechocystis} PDB: 4a48_A 2gcf_A 2xmw_A | Back alignment and structure |
|---|
| >1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* | Back alignment and structure |
|---|
| >2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3dxs_X Copper-transporting ATPase RAN1; CXXC motif, ferredoxin-like fold, ATP- binding, ethylene signaling pathway, hydrolase, ION transport; 1.70A {Arabidopsis thaliana} SCOP: d.58.17.0 | Back alignment and structure |
|---|
| >3fry_A Probable copper-exporting P-type ATPase A; transport protein, metal binding domain, domain SWAP, ATP-BI cell membrane, copper transport; HET: CIT; 2.00A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1qup_A Superoxide dismutase 1 copper chaperone; two domains, beta-alpha-beta-BETA-alpha-beta and beta barrel; 1.80A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 | Back alignment and structure |
|---|
| >2roe_A Heavy metal binding protein; NMR {Thermus thermophilus} PDB: 2rog_A | Back alignment and structure |
|---|
| >2xmm_A SSR2857 protein, ATX1; metal transport, copper homeostasis, chaperone, P-type atpas; 1.65A {Synechocystis SP} PDB: 2xmv_A 1sb6_A 2xmj_A 2xmk_A 2xmt_A 2xmu_A | Back alignment and structure |
|---|
| >2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1jk9_B CCS, copper chaperone for superoxide dismutase; protein-protein complex, heterodimer, metallochaperone, amyotrophic lateral sclerosis; 2.90A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 | Back alignment and structure |
|---|
| >2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2k2p_A Uncharacterized protein ATU1203; putative metal-binding domain ATU1203, ontario centre for ST proteomics, structural genomics; NMR {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} | Back alignment and structure |
|---|
| >2l3m_A Copper-ION-binding protein; structural genomics, center for structural genomics of infec diseases, csgid, metal binding protein; NMR {Bacillus anthracis} | Back alignment and structure |
|---|
| >2xmw_A PACS-N, cation-transporting ATPase PACS; hydrolase, Cu(I)-binding, trafficking; 1.80A {Synechocystis SP} PDB: 2gcf_A | Back alignment and structure |
|---|
| >1osd_A MERP, hypothetical protein MERP; mercury resistance, metal binding protein, perisplasm, structural genomics; 2.00A {Cupriavidus metallidurans} SCOP: d.58.17.1 PDB: 1afi_A 1afj_A 2hqi_A | Back alignment and structure |
|---|
| >1q8l_A Copper-transporting ATPase 1; metal binding protein; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1s6o_A 1s6u_A | Back alignment and structure |
|---|
| >1fvq_A Copper-transporting ATPase; APO-CCC2A, hydrolase; NMR {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1fvs_A 2ggp_B | Back alignment and structure |
|---|
| >2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1yg0_A COP associated protein; open-faced beta-sandwich, missing C-terminal beta-sheet, Met transport; NMR {Helicobacter pylori} | Back alignment and structure |
|---|
| >3cjk_B Copper-transporting ATPase 1; HAH1, ATP7B, menkes disease, metal homeostasis, chaperone, ION transport, metal- binding, alternative splicing; 1.80A {Homo sapiens} PDB: 2k1r_A | Back alignment and structure |
|---|
| >1aw0_A Menkes copper-transporting ATPase; copper-binding domain, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 2aw0_A | Back alignment and structure |
|---|
| >1y3j_A Copper-transporting ATPase 1; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta structure, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1y3k_A | Back alignment and structure |
|---|
| >1mwy_A ZNTA; open-faced beta-sandwich fold, beta-alpha-beta-BETA-alpha- beta, hydrolase; NMR {Escherichia coli} SCOP: d.58.17.1 PDB: 1mwz_A | Back alignment and structure |
|---|
| >1cpz_A Protein (COPZ); copper chaperone, metal transport, gene regulation; NMR {Enterococcus hirae} SCOP: d.58.17.1 | Back alignment and structure |
|---|
| >2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >2g9o_A Copper-transporting ATPase 1; menkes disease, solution structure, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} PDB: 2ga7_A | Back alignment and structure |
|---|
| >2qif_A Copper chaperone COPZ; tetranuclear Cu(I) cluster; 1.50A {Bacillus subtilis} SCOP: d.58.17.1 PDB: 3i9z_A 1k0v_A 1p8g_A | Back alignment and structure |
|---|
| >1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1kvi_A Copper-transporting ATPase 1; menkes, Cu-protein, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1kvj_A | Back alignment and structure |
|---|
| >1yjr_A Copper-transporting ATPase 1; metallochaperone, protein-protein interaction, copper(I), metal homeostasis, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1yjt_A 1yju_A 1yjv_A | Back alignment and structure |
|---|
| >1opz_A Potential copper-transporting ATPase; mutation, folding, abbab fold, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 1oq3_A 1oq6_A | Back alignment and structure |
|---|
| >2kt2_A Mercuric reductase; nmera, MERA, HMA domain, mercuric resist metal-binding, oxidoreductase; NMR {Pseudomonas aeruginosa} PDB: 2kt3_A | Back alignment and structure |
|---|
| >2ldi_A Zinc-transporting ATPase; metal homeostasis, metallochaperones, hydrolase; NMR {Synechocystis SP} | Back alignment and structure |
|---|
| >2kkh_A Putative heavy metal transporter; zinc transport, metal binding, metal selectivity, ferredoxin fold, ATP-binding, hydrolase; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* | Back alignment and structure |
|---|
| >2kyz_A Heavy metal binding protein; structural genomics, PSI-biology, protein structure initiative, joint for structural genomics, JCSG; NMR {Thermotoga maritima} | Back alignment and structure |
|---|
| >1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A | Back alignment and structure |
|---|
| >1eiw_A Hypothetical protein MTH538; CHEY-like fold, flavodoxin-like fold, (A/B)5 doubly wound fold, parallel beta sheet; NMR {Methanothermobacterthermautotrophicus} SCOP: c.23.3.1 | Back alignment and structure |
|---|
| >2aj0_A Probable cadmium-transporting ATPase; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta, metal binding protein, hydrolase; NMR {Listeria monocytogenes} PDB: 2aj1_A | Back alignment and structure |
|---|
| >1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >1jww_A Potential copper-transporting ATPase; beta-alpha-beta-BETA-alpha-beta, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 2voy_A 1kqk_A | Back alignment and structure |
|---|
| >2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3hyn_A Putative signal transduction protein; DUF1863 family protein, nucleotide-binding protein, structur genomics; HET: MSE; 1.20A {Eubacterium rectale atcc 33656} | Back alignment and structure |
|---|
| >2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* | Back alignment and structure |
|---|
| >2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* | Back alignment and structure |
|---|
| >2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A | Back alignment and structure |
|---|
| >1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* | Back alignment and structure |
|---|
| >1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A | Back alignment and structure |
|---|
| >3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* | Back alignment and structure |
|---|
| >2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} | Back alignment and structure |
|---|
| >3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* | Back alignment and structure |
|---|
| >3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} | Back alignment and structure |
|---|
| >3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* | Back alignment and structure |
|---|
| >3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C | Back alignment and structure |
|---|
| >3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A | Back alignment and structure |
|---|
| >1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A | Back alignment and structure |
|---|
| >1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* | Back alignment and structure |
|---|
| >2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} | Back alignment and structure |
|---|
| >2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A | Back alignment and structure |
|---|
| >1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* | Back alignment and structure |
|---|
| >3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* | Back alignment and structure |
|---|
| >1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A | Back alignment and structure |
|---|
| >3bpd_A Uncharacterized protein; heptamer, Mg+2 ION, PSI-2, NYSGXRC, structural genom protein structure initiative; 2.80A {Archaeoglobus fulgidus dsm 4304} SCOP: d.58.61.1 | Back alignment and structure |
|---|
| >3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* | Back alignment and structure |
|---|
| >3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3ea0_A ATPase, para family; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: ATP; 2.20A {Chlorobium tepidum} | Back alignment and structure |
|---|
| >2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* | Back alignment and structure |
|---|
| >1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A | Back alignment and structure |
|---|
| >1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* | Back alignment and structure |
|---|
| >1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* | Back alignment and structure |
|---|
| >2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A* | Back alignment and structure |
|---|
| >1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A | Back alignment and structure |
|---|
| >3cwq_A Para family chromosome partitioning protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: ADP; 2.47A {Synechocystis SP} | Back alignment and structure |
|---|
| >2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} | Back alignment and structure |
|---|
| >2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* | Back alignment and structure |
|---|
| >4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} | Back alignment and structure |
|---|
| >3fwy_A Light-independent protochlorophyllide reductase I ATP-binding protein; BCHL, electron donor, DPOR, Fe protein, nitrogenase; HET: ADP; 1.63A {Rhodobacter sphaeroides 2} | Back alignment and structure |
|---|
| >2x3d_A SSO6206; unknown function; 2.70A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* | Back alignment and structure |
|---|
| >2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* | Back alignment and structure |
|---|
| >2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A | Back alignment and structure |
|---|
| >3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* | Back alignment and structure |
|---|
| >1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* | Back alignment and structure |
|---|
| >1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} | Back alignment and structure |
|---|
| >3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* | Back alignment and structure |
|---|
| >3k9g_A PF-32 protein; ssgcid, SBRI, decode biostructures, UW, NIH, niaid, borellia burgdorferi, plasmid partition protein, iodide; 2.25A {Borrelia burgdorferi} PDB: 3k9h_A | Back alignment and structure |
|---|
| >3q9l_A Septum site-determining protein MIND; ATPase, bacterial cell division inhibitor, MINC, MINE, cell hydrolase; HET: ATP; 2.34A {Escherichia coli} PDB: 3r9i_A* 3r9j_A* | Back alignment and structure |
|---|
| >2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2raq_A Conserved protein MTH889; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 3.11A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: d.58.61.1 | Back alignment and structure |
|---|
| >3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A | Back alignment and structure |
|---|
| >1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* | Back alignment and structure |
|---|
| >2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A | Back alignment and structure |
|---|
| >2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} | Back alignment and structure |
|---|
| >1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* | Back alignment and structure |
|---|
| >1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* | Back alignment and structure |
|---|
| >3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* | Back alignment and structure |
|---|
| >2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1g3q_A MIND ATPase, cell division inhibitor; alpha-beta-alpha layered, protein-ADP complex, cell cycle, hydrolase; HET: ADP; 2.00A {Pyrococcus furiosus} SCOP: c.37.1.10 PDB: 1g3r_A* 1ion_A* | Back alignment and structure |
|---|
| >2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 | Back alignment and structure |
|---|
| >4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* | Back alignment and structure |
|---|
| >1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* | Back alignment and structure |
|---|
| >1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 486 | ||||
| d1fyva_ | 161 | c.23.2.1 (A:) Toll-like receptor 1, TLR1 {Human (H | 2e-12 | |
| d1fyxa_ | 149 | c.23.2.1 (A:) Toll-like receptor 2, TLR2 {Human (H | 8e-11 | |
| d1jjcb4 | 104 | d.58.13.1 (B:682-785) Phenylalanyl-tRNA synthetase | 0.001 |
| >d1fyva_ c.23.2.1 (A:) Toll-like receptor 1, TLR1 {Human (Homo sapiens) [TaxId: 9606]} Length = 161 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Flavodoxin-like superfamily: Toll/Interleukin receptor TIR domain family: Toll/Interleukin receptor TIR domain domain: Toll-like receptor 1, TLR1 species: Human (Homo sapiens) [TaxId: 9606]
Score = 62.8 bits (152), Expect = 2e-12
Identities = 23/119 (19%), Positives = 48/119 (40%), Gaps = 4/119 (3%)
Query: 20 YKHDVFVTFSGEDIRENFGSYLFAALFRESVKTFRDEQ-IRRGDEIMPALLQAIEESKIS 78
+ F+++SG D + L L +E ++ E+ G I+ ++ IE+S S
Sbjct: 11 LQFHAFISYSGHD-SFWVKNELLPNLEKEGMQICLHERNFVPGKSIVENIITCIEKSYKS 69
Query: 79 LVIFSKRFAFSRWCLEELVKIIEC--NKLYQTVIPVFYKVLPSDVRNQLGSFGEAFLEH 135
+ + S F S WC EL ++ ++I + + +P ++ +
Sbjct: 70 IFVLSPNFVQSEWCHYELYFAHHNLFHEGSNSLILILLEPIPQYSIPSSYHKLKSLMAR 128
|
| >d1fyxa_ c.23.2.1 (A:) Toll-like receptor 2, TLR2 {Human (Homo sapiens) [TaxId: 9606]} Length = 149 | Back information, alignment and structure |
|---|
| >d1jjcb4 d.58.13.1 (B:682-785) Phenylalanyl-tRNA synthetase {Thermus thermophilus [TaxId: 274]} Length = 104 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 486 | |||
| d2a5yb3 | 277 | CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI | 99.91 | |
| d1fyva_ | 161 | Toll-like receptor 1, TLR1 {Human (Homo sapiens) [ | 99.74 | |
| d1fyxa_ | 149 | Toll-like receptor 2, TLR2 {Human (Homo sapiens) [ | 99.67 | |
| d1qupa2 | 72 | Copper chaperone for superoxide dismutase, N-termi | 99.01 | |
| d1fe0a_ | 66 | ATX1 metallochaperone protein (ATOX1) {Human (Homo | 98.96 | |
| d1cc8a_ | 72 | ATX1 metallochaperone protein (ATOX1) {Baker's yea | 98.96 | |
| d2ggpb1 | 72 | Copper transporter domain ccc2a {Baker's yeast (Sa | 98.55 | |
| d1sb6a_ | 64 | Copper chaperone {Synechocystis sp. pcc 6803, Scat | 98.45 | |
| d1osda_ | 72 | Mercuric ion binding protein MerP {Ralstonia metal | 98.41 | |
| d2aw0a_ | 72 | Menkes copper-transporting ATPase {Human (Homo sap | 98.27 | |
| d2qifa1 | 69 | Copper chaperone {Bacillus subtilis, CopZ [TaxId: | 98.23 | |
| d1q8la_ | 84 | Menkes copper-transporting ATPase {Human (Homo sap | 98.23 | |
| d1p6ta2 | 79 | Potential copper-translocating P-type ATPase CopA | 98.21 | |
| d1p6ta1 | 72 | Potential copper-translocating P-type ATPase CopA | 98.2 | |
| d1cpza_ | 68 | Copper chaperone {Enterococcus hirae [TaxId: 1354] | 98.18 | |
| d1kvja_ | 79 | Menkes copper-transporting ATPase {Human (Homo sap | 98.15 | |
| d1mwza_ | 73 | Metal ion-transporting ATPase ZntA, N-terminal dom | 98.08 | |
| d1sxjb2 | 224 | Replication factor C4 {Baker's yeast (Saccharomyce | 95.5 | |
| d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 95.36 | |
| d1sxje2 | 252 | Replication factor C5 {Baker's yeast (Saccharomyce | 95.3 | |
| d1njfa_ | 239 | delta prime subunit of DNA polymerase III, N-domai | 94.4 | |
| d1a5ta2 | 207 | delta prime subunit of DNA polymerase III, N-domai | 93.87 | |
| d1lw7a2 | 192 | Transcriptional regulator NadR, ribosylnicotinamid | 93.77 | |
| d1rz3a_ | 198 | Hypothetical protein rbstp0775 {Bacillus stearothe | 93.47 | |
| d1np6a_ | 170 | Molybdopterin-guanine dinucleotide biosynthesis pr | 93.38 | |
| d1sxjd2 | 237 | Replication factor C2 {Baker's yeast (Saccharomyce | 93.06 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 92.99 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 92.95 | |
| d1xjca_ | 165 | Molybdopterin-guanine dinucleotide biosynthesis pr | 92.55 | |
| d1m8pa3 | 183 | ATP sulfurylase C-terminal domain {Fungus (Penicil | 92.53 | |
| d1kaga_ | 169 | Shikimate kinase (AroK) {Escherichia coli [TaxId: | 92.36 | |
| d2i3ba1 | 189 | Cancer-related NTPase, C1orf57 {Human (Homo sapien | 91.61 | |
| d2bdta1 | 176 | Hypothetical protein BH3686 {Bacillus halodurans [ | 91.55 | |
| d1ly1a_ | 152 | Polynucleotide kinase, kinase domain {Bacteriophag | 91.44 | |
| d1rkba_ | 173 | Adenylate kinase {Human (Homo sapiens), isoenzyme | 91.23 | |
| d2iyva1 | 165 | Shikimate kinase (AroK) {Mycobacterium tuberculosi | 90.97 | |
| d1qhxa_ | 178 | Chloramphenicol phosphotransferase {Streptomyces v | 90.69 | |
| d1khta_ | 190 | Adenylate kinase {Archaeon Methanococcus voltae [T | 90.6 | |
| d1sq5a_ | 308 | Pantothenate kinase PanK {Escherichia coli [TaxId: | 90.1 | |
| d1bifa1 | 213 | 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata | 90.03 | |
| d1viaa_ | 161 | Shikimate kinase (AroK) {Campylobacter jejuni [Tax | 90.0 | |
| d1y63a_ | 174 | Probable kinase LmjF30.1890 {Leishmania major [Tax | 89.33 | |
| d1knqa_ | 171 | Gluconate kinase {Escherichia coli [TaxId: 562]} | 89.18 | |
| d1x6va3 | 195 | Adenosine-5'phosphosulfate kinase (APS kinase) {Hu | 89.01 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 88.99 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 88.72 | |
| d1e32a2 | 258 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 88.4 | |
| d1zp6a1 | 176 | Hypothetical protein Atu3015 {Agrobacterium tumefa | 88.27 | |
| d1e6ca_ | 170 | Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax | 88.24 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 88.21 | |
| d1odfa_ | 286 | Hypothetical protein Ygr205W {Baker's yeast (Sacch | 87.8 | |
| d1g3qa_ | 237 | Cell division regulator MinD {Archaeon Pyrococcus | 87.68 | |
| d1uj2a_ | 213 | Uridine-cytidine kinase 2 {Human (Homo sapiens) [T | 87.42 | |
| d2fnaa2 | 283 | Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ | 87.0 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 86.84 | |
| d1cp2a_ | 269 | Nitrogenase iron protein {Clostridium pasteurianum | 86.78 | |
| d1nksa_ | 194 | Adenylate kinase {Archaeon Sulfolobus acidocaldari | 86.45 | |
| d1uf9a_ | 191 | Dephospho-CoA kinase {Thermus thermophilus [TaxId: | 85.97 | |
| d1ye8a1 | 178 | Hypothetical kinase-like protein Aq_1292 {Aquifex | 85.48 | |
| d1ak2a1 | 190 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 85.36 | |
| d1f6ba_ | 186 | SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: | 84.89 | |
| d1ukza_ | 196 | Uridylate kinase {Baker's yeast (Saccharomyces cer | 84.61 | |
| d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 84.28 | |
| d1hyqa_ | 232 | Cell division regulator MinD {Archaeon Archaeoglob | 84.22 | |
| d1puja_ | 273 | Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 | 83.55 | |
| d1yj5a2 | 172 | 5' polynucleotide kinase-3' phosphatase, C-termina | 82.92 | |
| d1qf9a_ | 194 | UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 | 82.5 | |
| d1svia_ | 195 | Probable GTPase EngB {Bacillus subtilis [TaxId: 14 | 82.3 | |
| d1r7ra3 | 265 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 82.02 | |
| d1m7ga_ | 208 | Adenosine-5'phosphosulfate kinase (APS kinase) {Fu | 81.75 | |
| d2vp4a1 | 197 | Deoxyribonucleoside kinase {Fruit fly (Drosophila | 81.52 | |
| d1wu7a1 | 97 | Histidyl-tRNA synthetase (HisRS), C-terminal domai | 81.43 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 81.17 | |
| d2afhe1 | 289 | Nitrogenase iron protein {Azotobacter vinelandii [ | 81.0 | |
| d3bpda1 | 91 | Uncharacterized protein AF1549 {Archaeoglobus fulg | 80.86 | |
| d1ihua2 | 279 | Arsenite-translocating ATPase ArsA {Escherichia co | 80.62 | |
| d2raqa1 | 93 | Uncharacterized protein MTH889 {Methanobacterium t | 80.42 | |
| d1upta_ | 169 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 80.29 |
| >d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Extended AAA-ATPase domain domain: CED-4, NB-ARC domain species: Caenorhabditis elegans [TaxId: 6239]
Probab=99.91 E-value=8.3e-25 Score=212.44 Aligned_cols=177 Identities=11% Similarity=-0.033 Sum_probs=113.5
Q ss_pred HHHHHHHhh--cCCCceeeeeeeccCccchhHHHHHHHhhhc----cccccceEEEEeeec--cHHHH---HHHHhhhhc
Q 011431 214 LDEVLSLLR--NAEGYRSYRCWLLCPLFSELRVLTNDVHQLM----DNYENSDVTLAKFEG--EVKKL---DQRLLRFLE 282 (486)
Q Consensus 214 l~~v~~ll~--~~~~~~vi~I~GmGgGvGKTTLa~~vy~~~~----~~F~~~~~~~v~~~~--~l~~l---qk~ll~~L~ 282 (486)
++++.+.|. .+++.++|+|+||| |+||||||+++||+.. ..|++ +.|+.+++ ....+ ...++..++
T Consensus 29 ~~~i~~~L~~~~~~~~~~v~I~Gmg-GiGKTtLA~~v~~~~~~~~~~~f~~--~~Wv~vs~~~~~~~l~~~~~~~~~~~~ 105 (277)
T d2a5yb3 29 VDRVIKKLDEMCDLDSFFLFLHGRA-GSGKSVIASQALSKSDQLIGINYDS--IVWLKDSGTAPKSTFDLFTDILLMLKS 105 (277)
T ss_dssp HHHHHHHHHHHTTSSSEEEEEECST-TSSHHHHHHHHHHHCSSTBTTTBSE--EEEEECCCCSTTHHHHHHHHHHHHHTT
T ss_pred HHHHHHHHHhccCCCceEEEEECCC-CCCHHHHHHHHHHhhhhhhhhcCce--EEEEEecCCCCHHHHHHHHHHHHHHhc
Confidence 455555542 35578899999999 9999999999998633 33444 45555543 22222 223333333
Q ss_pred ccccc-----cccccccccccccccccccCcceeeceecccCHHHHHHHhcCCCCCCCCCEEEeeCCccccccccccCCC
Q 011431 283 SVDKH-----VASYDRYGSASFEQPRPQTTSAAHPYVEDVIDDAYMEDITDDSSPSLNLSRINSTSRFEQLWPETISATD 357 (486)
Q Consensus 283 ~~d~~-----~~~~~~~g~~s~l~~~L~~tKr~LlVLDDVw~~~~~~~l~~~~~~~~~GSrIIiTTR~~~V~~~~~~~~~ 357 (486)
..... ............++..|.. +++|+||||||+..+|..+.. .|||||||||+++|+..+. ...
T Consensus 106 ~~~~~~~~~~~~~~~~~~~~~~~~~~L~~-kr~LlVLDDv~~~~~~~~~~~------~~srilvTTR~~~v~~~~~-~~~ 177 (277)
T d2a5yb3 106 EDDLLNFPSVEHVTSVVLKRMICNALIDR-PNTLFVFDDVVQEETIRWAQE------LRLRCLVTTRDVEISNAAS-QTC 177 (277)
T ss_dssp TSCCTTCCCCTTCCHHHHHHHHHHHHTTS-TTEEEEEEEECCHHHHHHHHH------TTCEEEEEESBGGGGGGCC-SCE
T ss_pred chhhcCCccchhhhhHHHHHHHHHHHhcc-CCeeEecchhhHHhhhhhhcc------cCceEEEEeehHHHHHhcC-CCC
Confidence 22111 0000000011235566777 899999999999999987643 4899999999999984332 123
Q ss_pred ceEecCCCCCchhhhhhcccCCCcceeeeeeccccccchhhHHHHHHHhhcCCCe
Q 011431 358 TCTEDVTVDNSPSLNLSSCNSSSTFKEAIFKLEIHHDNLEAWRAAFSIVSEFIGI 412 (486)
Q Consensus 358 ~~y~v~~L~~~es~~LF~~~a~~k~~~~v~kv~~~~~~~~~~~~a~k~~~~~~Gv 412 (486)
.+|+|++|+.+|||+||+++||.... .+... ..+.+++..|.|.
T Consensus 178 ~~~~l~~L~~~ea~~Lf~~~~~~~~~---------~~~~~--~~~~~iv~~c~Gl 221 (277)
T d2a5yb3 178 EFIEVTSLEIDECYDFLEAYGMPMPV---------GEKEE--DVLNKTIELSSGN 221 (277)
T ss_dssp EEEECCCCCHHHHHHHHHHTSCCCC-----------CHHH--HHHHHHHHHHTTC
T ss_pred ceEECCCCCHHHHHHHHHHHhCCccC---------chhhH--HHHHHHHHHhCCC
Confidence 68999999999999999999996321 22222 4455666666653
|
| >d1fyva_ c.23.2.1 (A:) Toll-like receptor 1, TLR1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fyxa_ c.23.2.1 (A:) Toll-like receptor 2, TLR2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qupa2 d.58.17.1 (A:2-73) Copper chaperone for superoxide dismutase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1fe0a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cc8a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ggpb1 d.58.17.1 (B:1-72) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sb6a_ d.58.17.1 (A:) Copper chaperone {Synechocystis sp. pcc 6803, Scatx1 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d1osda_ d.58.17.1 (A:) Mercuric ion binding protein MerP {Ralstonia metallidurans CH34 [TaxId: 266264]} | Back information, alignment and structure |
|---|
| >d2aw0a_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2qifa1 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subtilis, CopZ [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1q8la_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p6ta2 d.58.17.1 (A:73-151) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1p6ta1 d.58.17.1 (A:1-72) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1cpza_ d.58.17.1 (A:) Copper chaperone {Enterococcus hirae [TaxId: 1354]} | Back information, alignment and structure |
|---|
| >d1kvja_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mwza_ d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} | Back information, alignment and structure |
|---|
| >d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} | Back information, alignment and structure |
|---|
| >d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1wu7a1 c.51.1.1 (A:330-426) Histidyl-tRNA synthetase (HisRS), C-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d3bpda1 d.58.61.1 (A:1-91) Uncharacterized protein AF1549 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2raqa1 d.58.61.1 (A:3-95) Uncharacterized protein MTH889 {Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} | Back information, alignment and structure |
|---|