Citrus Sinensis ID: 011446


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-----
MNNSRGRYPPGIGSGRGGVNASNPSFQSSRPQQQYVQRNFLQNHYHNQQFQQQQQQQQQQQWLRRNNFPGADSSIVDEVEKTVQSEAAVDPSSQDWKARLKIPPADTRYRTEDVTATKGNEFEDYFLKRELLMGIFEKGFERPSPIQEESIPIALTGSDILARAKNGTGKTAAFCIPALEKIDQDNNVIQVVILVPTRELALQTSQVCKELGKHLNIQVMVTTGGTSLKDDIMRLYQPVHLLVGTPGRILDLSKKGVCILKDCSMLVMDEADKLLSPEFQPSVEQLIRFLPANRQILMFSATFPVTVKDFKDKYLQKPYVINLMDELTLKGITQYYAFVEERQKVHCLNTLFSKLQINQSIIFCNSVNRVELLAKKITELGYSCFYIHAKMLQDHRNRVFHDFRNGACRNLVCTDLFTRGIDIQAVNVVINFDFPKNSETYLHRVCWIQLSFSLSLPNLQFMCSMLMYICFTDRLVDLEGLDTLD
cccccccccccccccccccccccccccccccHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHccccccccccHHHHHHcccccccccccccccccccccccccccccHHHHHHHHHcccccccHHHHHHHHHHHccccEEEEccccccHHHHHHHHHHHcccccccccEEEEEcccHHHHHHHHHHHHHHHcccccEEEEEEccccHHHHHHHHcccccEEEcccHHHHHHHcccccccccccEEEEEccccccccccHHHHHHHHHHcccccEEEEEEccccHHHHHHHHHHcccccEEEEccccccccEEEEEEEcccccHHHHHHHHHHHcccccEEEEEccHHHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHHHcccccEEEEccccccccccccccEEEEcccccccccccccccccccccccccccHHHHHHHHHHHHccccccccccccccc
ccccccccccccccccccccccccccccccccccccccccccccccccccccccHHcccccccccccccccccccccccHcccccccccccccccHHHHccccccccccccccccccccccHHHccccHHHHHHHHHcccccccccHHHHHHHHHccccEEEEccccHHHHHHHHHHHHHHcccccccccEEEEcccHHHHHHHHHHHHHHcccccccEEEEcccccHHHHHHHHccccEEEEEcccHHHHHHHcccccccccEEEEEcHHHHHHccccHHHHHHHHHHccHHHcEEEEEccccHHHHHHHHHHccccEEEEEcccccccccEEEEEEEcHHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHHHHHccccEHHHcccccHHHHHHHHHHHHcccccEEEEHHHHHcccccccccEEEEEcccccHcHEEEEEcccccccEEEEccHHHHHHHHHHHHHHHcccccccccccc
mnnsrgryppgigsgrggvnasnpsfqssrpqqQYVQRNFLQNHYHNQQFQQQQQQQQQQQWLrrnnfpgadssivDEVEKTVqseaavdpssqdwkarlkippadtryrtedvtatkgnefedYFLKRELLMGIFEkgferpspiqeesipialtgsDILArakngtgktaafcipalekidqdnnvIQVVILVPTRELALQTSQVCKELGKHLNIQVMVTtggtslkddIMRLYQpvhllvgtpgrildlskkgvcilkdcsmlvmdeadkllspefqpSVEQLIRFLPANRQilmfsatfpvtvkdfkdkylqkpyviNLMDELTLKGITQYYAFVEERQKVHCLNTLFSKLQINQSIIFCNSVNRVELLAKKITELGYSCFYIHAKMLQDHrnrvfhdfrngacrnlvctdlftrgidiqaVNVVInfdfpknsetyLHRVCWIQLsfslslpnLQFMCSMLMYICFTDrlvdlegldtld
mnnsrgryppgigsgrggVNASNPSFQSSRPQQQYVQRNFLQNHYHNQQFQQQQQQQQQQQWLRRNNFPGADSSIVDEVEKTVQseaavdpssqdwkarlkippadtryrtedvtatkgnefedyFLKRELLMGIFEKGFERPSPIQEESIPIALTGSDILARAKNGTGKTAAFCIPAlekidqdnNVIQVVILVPTRELALQTSQVCKELGKHLNIQVMVTTGGTSLKDDIMRLYQPVHLLVGtpgrildlsKKGVCILKDCSMLVMDEADKLLSPEFQPSVEQLIRFLPANRQILMFSATFPVTVKDFKDKYLQKPYVINLMDELTLKGITQYYAFVEERQKVHCLNTLFSKLQINQSIIFCNSVNRVELLAKKITELGYSCFYIHAKMLQDHRNRVFHDFRNGACRNLVCTDLFTRGIDIQAVNVVINFDFPKNSETYLHRVCWIQLSFSLSLPNLQFMCSMLMYICFTDRLVDLEGLDTLD
MNNSRGRYPPGIGSGRGGVNASNPSFQSSRPQQQYVQRNFLQNHYHNqqfqqqqqqqqqqqWLRRNNFPGADSSIVDEVEKTVQSEAAVDPSSQDWKARLKIPPADTRYRTEDVTATKGNEFEDYFLKRELLMGIFEKGFERPSPIQEESIPIALTGSDILARAKNGTGKTAAFCIPALEKIDQDNNVIQVVILVPTRELALQTSQVCKELGKHLNIQVMVTTGGTSLKDDIMRLYQPVHLLVGTPGRILDLSKKGVCILKDCSMLVMDEADKLLSPEFQPSVEQLIRFLPANRQILMFSATFPVTVKDFKDKYLQKPYVINLMDELTLKGITQYYAFVEERQKVHCLNTLFSKLQINQSIIFCNSVNRVELLAKKITELGYSCFYIHAKMLQDHRNRVFHDFRNGACRNLVCTDLFTRGIDIQAVNVVINFDFPKNSETYLHRVCWIQLSFSLSLPNLQFMCSMLMYICFTDRLVDLEGLDTLD
*****************************************************************************************************************VTATKGNEFEDYFLKRELLMGIFEKGFER******ESIPIALTGSDILARAKNGTGKTAAFCIPALEKIDQDNNVIQVVILVPTRELALQTSQVCKELGKHLNIQVMVTTGGTSLKDDIMRLYQPVHLLVGTPGRILDLSKKGVCILKDCSMLVMDEADKLLSPEFQPSVEQLIRFLPANRQILMFSATFPVTVKDFKDKYLQKPYVINLMDELTLKGITQYYAFVEERQKVHCLNTLFSKLQINQSIIFCNSVNRVELLAKKITELGYSCFYIHAKMLQDHRNRVFHDFRNGACRNLVCTDLFTRGIDIQAVNVVINFDFPKNSETYLHRVCWIQLSFSLSLPNLQFMCSMLMYICFTDRLVDLEG*****
*******************************************************************************************************************ATKGNEFEDYFLKRELLMGIFEKGFERPSPIQEESIPIALTGSDILARAKNGTGKTAAFCIPALEKIDQDNNVIQVVILVPTRELALQTSQVCKELGKHLNIQVMVTTGGTSLKDDIMRLYQPVHLLVGTPGRILDLSKKGVCILKDCSMLVMDEADKLLSPEFQPSVEQLIRFLPANRQILMFSATFPVTVKDFKDKYLQKPYVINLMDELTLKGITQYYAFVEERQKVHCLNTLFSKLQINQSIIFCNSVNRVELLAKKITELGYSCFYIHAKMLQDHRNRVFHDFRNGACRNLVCTDLFTRGIDIQAVNVVINFDFPKNSETYLHRVCWIQLSFSLSLPNLQFMCSMLMYIC***************
MNNSRGRYPPGIGSGRGGVNAS**********QQYVQRNFLQNHYH*****************RRNNFPGADSSIVDEVEK**************WKARLKIPPADTRYRTEDVTATKGNEFEDYFLKRELLMGIFEKGFERPSPIQEESIPIALTGSDILARAKNGTGKTAAFCIPALEKIDQDNNVIQVVILVPTRELALQTSQVCKELGKHLNIQVMVTTGGTSLKDDIMRLYQPVHLLVGTPGRILDLSKKGVCILKDCSMLVMDEADKLLSPEFQPSVEQLIRFLPANRQILMFSATFPVTVKDFKDKYLQKPYVINLMDELTLKGITQYYAFVEERQKVHCLNTLFSKLQINQSIIFCNSVNRVELLAKKITELGYSCFYIHAKMLQDHRNRVFHDFRNGACRNLVCTDLFTRGIDIQAVNVVINFDFPKNSETYLHRVCWIQLSFSLSLPNLQFMCSMLMYICFTDRLVDLEGLDTLD
**************************************************************************************************************TEDVTATKGNEFEDYFLKRELLMGIFEKGFERPSPIQEESIPIALTGSDILARAKNGTGKTAAFCIPALEKIDQDNNVIQVVILVPTRELALQTSQVCKELGKHLNIQVMVTTGGTSLKDDIMRLYQPVHLLVGTPGRILDLSKKGVCILKDCSMLVMDEADKLLSPEFQPSVEQLIRFLPANRQILMFSATFPVTVKDFKDKYLQKPYVINLMDELTLKGITQYYAFVEERQKVHCLNTLFSKLQINQSIIFCNSVNRVELLAKKITELGYSCFYIHAKMLQDHRNRVFHDFRNGACRNLVCTDLFTRGIDIQAVNVVINFDFPKNSETYLHRVCWIQLSFSLSLPNLQFMCSMLMYICFTDRLVDLEG*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNNSRGRYPPGIGSGRGGVNASNPSFQSSRPQQQYVQRNFLQNHYHNQQFQQQQQQQQQQQWLRRNNFPGADSSIVDEVEKTVQSEAAVDPSSQDWKARLKIPPADTRYRTEDVTATKGNEFEDYFLKRELLMGIFEKGFERPSPIQEESIPIALTGSDILARAKNGTGKTAAFCIPALEKIDQDNNVIQVVILVPTRELALQTSQVCKELGKHLNIQVMVTTGGTSLKDDIMRLYQPVHLLVGTPGRILDLSKKGVCILKDCSMLVMDEADKLLSPEFQPSVEQLIRFLPANRQILMFSATFPVTVKDFKDKYLQKPYVINLMDELTLKGITQYYAFVEERQKVHCLNTLFSKLQINQSIIFCNSVNRVELLAKKITELGYSCFYIHAKMLQDHRNRVFHDFRNGACRNLVCTDLFTRGIDIQAVNVVINFDFPKNSETYLHRVCWIQLSFSLSLPNLQFMCSMLMYICFTDRLVDLEGLDTLD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query485 2.2.26 [Sep-21-2011]
Q8RXK6505 DEAD-box ATP-dependent RN yes no 0.909 0.873 0.844 0.0
Q7XMK8498 DEAD-box ATP-dependent RN no no 0.901 0.877 0.803 0.0
Q6H7S2508 DEAD-box ATP-dependent RN yes no 0.905 0.864 0.805 0.0
Q94BV4528 DEAD-box ATP-dependent RN no no 0.901 0.827 0.758 0.0
Q9M2E0498 DEAD-box ATP-dependent RN no no 0.913 0.889 0.793 0.0
Q109G2521 DEAD-box ATP-dependent RN no no 0.789 0.735 0.885 0.0
Q54E49423 Probable ATP-dependent RN yes no 0.723 0.829 0.786 1e-167
Q1E5R1512 ATP-dependent RNA helicas N/A no 0.721 0.683 0.774 1e-166
Q0U7S9 522 ATP-dependent RNA helicas N/A no 0.767 0.712 0.739 1e-165
Q2U5A2511 ATP-dependent RNA helicas yes no 0.760 0.722 0.733 1e-165
>sp|Q8RXK6|RH8_ARATH DEAD-box ATP-dependent RNA helicase 8 OS=Arabidopsis thaliana GN=RH8 PE=2 SV=1 Back     alignment and function desciption
 Score =  749 bits (1935), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/457 (84%), Positives = 409/457 (89%), Gaps = 16/457 (3%)

Query: 3   NSRGRYPPGIGSGRGGVNASNPSFQS-----SRPQQQYVQR-NFLQNHYH------NQQF 50
           N+RGRYPPGIG+GRG  N  NP++QS       P  QYVQR N+ QNH        +Q  
Sbjct: 2   NNRGRYPPGIGAGRGAFNP-NPNYQSRSGYQQHPPPQYVQRGNYAQNHQQQFQQAPSQPH 60

Query: 51  QQQQQQQQQQQWLRRNNFPGADSS--IVDEVEKTVQSEAAVDPSSQDWKARLKIPPADTR 108
           Q QQQQQQQQQWLRR   PG +S+   V EVEKTVQSE  +DP+S+DWKARLK+P  DTR
Sbjct: 61  QYQQQQQQQQQWLRRGQIPGGNSNGDAVVEVEKTVQSEV-IDPNSEDWKARLKLPAPDTR 119

Query: 109 YRTEDVTATKGNEFEDYFLKRELLMGIFEKGFERPSPIQEESIPIALTGSDILARAKNGT 168
           YRTEDVTATKGNEFEDYFLKRELLMGI+EKGFERPSPIQEESIPIALTG DILARAKNGT
Sbjct: 120 YRTEDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGRDILARAKNGT 179

Query: 169 GKTAAFCIPALEKIDQDNNVIQVVILVPTRELALQTSQVCKELGKHLNIQVMVTTGGTSL 228
           GKTAAFCIP LEKIDQDNNVIQ VI+VPTRELALQTSQVCKELGKHL IQVMVTTGGTSL
Sbjct: 180 GKTAAFCIPVLEKIDQDNNVIQAVIIVPTRELALQTSQVCKELGKHLKIQVMVTTGGTSL 239

Query: 229 KDDIMRLYQPVHLLVGTPGRILDLSKKGVCILKDCSMLVMDEADKLLSPEFQPSVEQLIR 288
           KDDIMRLYQPVHLLVGTPGRILDL+KKGVC+LKDCS+LVMDEADKLLS EFQPSVE LI 
Sbjct: 240 KDDIMRLYQPVHLLVGTPGRILDLTKKGVCVLKDCSVLVMDEADKLLSQEFQPSVEHLIS 299

Query: 289 FLPANRQILMFSATFPVTVKDFKDKYLQKPYVINLMDELTLKGITQYYAFVEERQKVHCL 348
           FLP +RQILMFSATFPVTVKDFKD++L  PYVINLMDELTLKGITQ+YAFVEERQK+HCL
Sbjct: 300 FLPESRQILMFSATFPVTVKDFKDRFLTNPYVINLMDELTLKGITQFYAFVEERQKIHCL 359

Query: 349 NTLFSKLQINQSIIFCNSVNRVELLAKKITELGYSCFYIHAKMLQDHRNRVFHDFRNGAC 408
           NTLFSKLQINQSIIFCNSVNRVELLAKKITELGYSCFYIHAKMLQDHRNRVFHDFRNGAC
Sbjct: 360 NTLFSKLQINQSIIFCNSVNRVELLAKKITELGYSCFYIHAKMLQDHRNRVFHDFRNGAC 419

Query: 409 RNLVCTDLFTRGIDIQAVNVVINFDFPKNSETYLHRV 445
           RNLVCTDLFTRGIDIQAVNVVINFDFPKN+ETYLHRV
Sbjct: 420 RNLVCTDLFTRGIDIQAVNVVINFDFPKNAETYLHRV 456




ATP-dependent RNA helicase involved in mRNA turnover, and more specifically in mRNA decapping.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 3
>sp|Q7XMK8|RH6_ORYSJ DEAD-box ATP-dependent RNA helicase 6 OS=Oryza sativa subsp. japonica GN=Os04g0533000 PE=2 SV=1 Back     alignment and function description
>sp|Q6H7S2|RH8_ORYSJ DEAD-box ATP-dependent RNA helicase 8 OS=Oryza sativa subsp. japonica GN=Os02g0641800 PE=2 SV=2 Back     alignment and function description
>sp|Q94BV4|RH6_ARATH DEAD-box ATP-dependent RNA helicase 6 OS=Arabidopsis thaliana GN=RH6 PE=2 SV=2 Back     alignment and function description
>sp|Q9M2E0|RH12_ARATH DEAD-box ATP-dependent RNA helicase 12 OS=Arabidopsis thaliana GN=RH12 PE=2 SV=1 Back     alignment and function description
>sp|Q109G2|RH12_ORYSJ DEAD-box ATP-dependent RNA helicase 12 OS=Oryza sativa subsp. japonica GN=Os10g0503700 PE=2 SV=2 Back     alignment and function description
>sp|Q54E49|DDX6_DICDI Probable ATP-dependent RNA helicase ddx6 OS=Dictyostelium discoideum GN=ddx6 PE=3 SV=1 Back     alignment and function description
>sp|Q1E5R1|DHH1_COCIM ATP-dependent RNA helicase DHH1 OS=Coccidioides immitis (strain RS) GN=DHH1 PE=3 SV=1 Back     alignment and function description
>sp|Q0U7S9|DHH1_PHANO ATP-dependent RNA helicase DHH1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DHH1 PE=3 SV=1 Back     alignment and function description
>sp|Q2U5A2|DHH1_ASPOR ATP-dependent RNA helicase dhh1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dhh1 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query485
255541534507 dead box ATP-dependent RNA helicase, put 0.905 0.865 0.893 0.0
224064015499 predicted protein [Populus trichocarpa] 0.911 0.885 0.9 0.0
449432163492 PREDICTED: DEAD-box ATP-dependent RNA he 0.907 0.894 0.901 0.0
225426363480 PREDICTED: DEAD-box ATP-dependent RNA he 0.880 0.889 0.874 0.0
225454138491 PREDICTED: DEAD-box ATP-dependent RNA he 0.892 0.881 0.884 0.0
297745244472 unnamed protein product [Vitis vinifera] 0.868 0.891 0.905 0.0
224127608485 predicted protein [Populus trichocarpa] 0.872 0.872 0.894 0.0
356520426500 PREDICTED: DEAD-box ATP-dependent RNA he 0.890 0.864 0.851 0.0
356520424503 PREDICTED: DEAD-box ATP-dependent RNA he 0.894 0.862 0.871 0.0
356504657502 PREDICTED: DEAD-box ATP-dependent RNA he 0.880 0.850 0.839 0.0
>gi|255541534|ref|XP_002511831.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis] gi|223549011|gb|EEF50500.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  796 bits (2055), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/450 (89%), Positives = 415/450 (92%), Gaps = 11/450 (2%)

Query: 5   RGRYPPGIGSGRGGVNASNPSFQSSRPQQQYVQRNFLQNHYHNQQFQQQQQQQQQQQ--- 61
           RGRYPPGIG+GRG    +NPSFQS  PQQQYVQRN +QNH+   Q QQ  Q   QQQ   
Sbjct: 11  RGRYPPGIGAGRGAGMNANPSFQSRVPQQQYVQRNMMQNHHQQFQHQQHHQHHLQQQQQQ 70

Query: 62  ------WLRRNNFPGADSSIVDEVEKTVQSEAAVDPSSQDWKARLKIPPADTRYRTEDVT 115
                 WLRR+  P ADSS VDEVEKTVQSEA VD +SQDWKARLKIPP DTRY+TEDVT
Sbjct: 71  QQQQQQWLRRSQLPPADSS-VDEVEKTVQSEA-VDSTSQDWKARLKIPPPDTRYKTEDVT 128

Query: 116 ATKGNEFEDYFLKRELLMGIFEKGFERPSPIQEESIPIALTGSDILARAKNGTGKTAAFC 175
           ATKGNEFEDYFLKRELLMGI+EKGFERPSPIQEESIPIALTGSDILARAKNGTGKTAAFC
Sbjct: 129 ATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKTAAFC 188

Query: 176 IPALEKIDQDNNVIQVVILVPTRELALQTSQVCKELGKHLNIQVMVTTGGTSLKDDIMRL 235
           IPALEKIDQDNNVIQVVILVPTRELALQTSQVCKELGKHL IQVMVTTGGTSLKDDIMRL
Sbjct: 189 IPALEKIDQDNNVIQVVILVPTRELALQTSQVCKELGKHLKIQVMVTTGGTSLKDDIMRL 248

Query: 236 YQPVHLLVGTPGRILDLSKKGVCILKDCSMLVMDEADKLLSPEFQPSVEQLIRFLPANRQ 295
           YQPVHLLVGTPGRILDL+KKGVC+LKDCSMLVMDEADKLLSPEFQPSVEQLIRFLP  RQ
Sbjct: 249 YQPVHLLVGTPGRILDLAKKGVCVLKDCSMLVMDEADKLLSPEFQPSVEQLIRFLPPTRQ 308

Query: 296 ILMFSATFPVTVKDFKDKYLQKPYVINLMDELTLKGITQYYAFVEERQKVHCLNTLFSKL 355
           ILMFSATFPVTVKDFKD++LQKPYVINLMDELTLKGITQ+YAFVEERQKVHCLNTLFSKL
Sbjct: 309 ILMFSATFPVTVKDFKDRFLQKPYVINLMDELTLKGITQFYAFVEERQKVHCLNTLFSKL 368

Query: 356 QINQSIIFCNSVNRVELLAKKITELGYSCFYIHAKMLQDHRNRVFHDFRNGACRNLVCTD 415
           QINQSIIFCNSVNRVELLAKKITELGYSCFYIHAKMLQDHRNRVFHDFRNGACRNLVCTD
Sbjct: 369 QINQSIIFCNSVNRVELLAKKITELGYSCFYIHAKMLQDHRNRVFHDFRNGACRNLVCTD 428

Query: 416 LFTRGIDIQAVNVVINFDFPKNSETYLHRV 445
           LFTRGIDIQAVNVVINFDFPKNSETYLHRV
Sbjct: 429 LFTRGIDIQAVNVVINFDFPKNSETYLHRV 458




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224064015|ref|XP_002301349.1| predicted protein [Populus trichocarpa] gi|222843075|gb|EEE80622.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449432163|ref|XP_004133869.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Cucumis sativus] gi|449480172|ref|XP_004155819.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|225426363|ref|XP_002271357.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225454138|ref|XP_002270379.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8 [Vitis vinifera] gi|147785187|emb|CAN75439.1| hypothetical protein VITISV_000835 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297745244|emb|CBI40324.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224127608|ref|XP_002320116.1| predicted protein [Populus trichocarpa] gi|222860889|gb|EEE98431.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356520426|ref|XP_003528863.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Glycine max] Back     alignment and taxonomy information
>gi|356520424|ref|XP_003528862.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Glycine max] Back     alignment and taxonomy information
>gi|356504657|ref|XP_003521112.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query485
TAIR|locus:2127043505 RH8 "RNAhelicase-like 8" [Arab 0.911 0.875 0.821 1.6e-196
TAIR|locus:2098886498 AT3G61240 [Arabidopsis thalian 0.913 0.889 0.778 1.9e-186
TAIR|locus:2050715528 AT2G45810 [Arabidopsis thalian 0.868 0.797 0.800 4.2e-182
DICTYBASE|DDB_G0291804423 ddx6 "DEAD/DEAH box helicase" 0.723 0.829 0.786 3.3e-150
POMBASE|SPBC776.09485 ste13 "ATP-dependent RNA helic 0.725 0.725 0.764 3.1e-147
ASPGD|ASPL0000036135498 AN10417 [Emericella nidulans ( 0.721 0.702 0.765 3.5e-146
UNIPROTKB|A4R715 535 DHH1 "ATP-dependent RNA helica 0.758 0.687 0.727 4e-145
GENEDB_PFALCIPARUM|PFC0915w433 PFC0915w "ATP-dependent RNA he 0.725 0.812 0.767 1.4e-144
ZFIN|ZDB-GENE-030131-6611483 wu:fk48d07 "wu:fk48d07" [Danio 0.777 0.780 0.698 1.1e-140
FB|FBgn0004419459 me31B "maternal expression at 0.721 0.762 0.728 2.4e-140
TAIR|locus:2127043 RH8 "RNAhelicase-like 8" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1903 (674.9 bits), Expect = 1.6e-196, P = 1.6e-196
 Identities = 377/459 (82%), Positives = 398/459 (86%)

Query:     1 MNNSRGRYPPGIGSGRGGVNASNPSFQS-----SRPQQQYVQR-NFLQNHYHNXXXXXXX 54
             MNN RGRYPPGIG+GRG  N  NP++QS       P  QYVQR N+ QNH          
Sbjct:     1 MNN-RGRYPPGIGAGRGAFNP-NPNYQSRSGYQQHPPPQYVQRGNYAQNHQQQFQQAPSQ 58

Query:    55 ------XXXXXXXWLRRNNFPGADSS--IVDEVEKTVQSEAAVDPSSQDWKARLKIPPAD 106
                          WLRR   PG +S+   V EVEKTVQSE  +DP+S+DWKARLK+P  D
Sbjct:    59 PHQYQQQQQQQQQWLRRGQIPGGNSNGDAVVEVEKTVQSEV-IDPNSEDWKARLKLPAPD 117

Query:   107 TRYRTEDVTATKGNEFEDYFLKRELLMGIFEKGFERPSPIQEESIPIALTGSDILARAKN 166
             TRYRTEDVTATKGNEFEDYFLKRELLMGI+EKGFERPSPIQEESIPIALTG DILARAKN
Sbjct:   118 TRYRTEDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGRDILARAKN 177

Query:   167 GTGKTAAFCIPALEKIDQDNNVIQVVILVPTRELALQTSQVCKELGKHLNIQVMVTTGGT 226
             GTGKTAAFCIP LEKIDQDNNVIQ VI+VPTRELALQTSQVCKELGKHL IQVMVTTGGT
Sbjct:   178 GTGKTAAFCIPVLEKIDQDNNVIQAVIIVPTRELALQTSQVCKELGKHLKIQVMVTTGGT 237

Query:   227 SLKDDIMRLYQPVHLLVGTPGRILDLSKKGVCILKDCSMLVMDEADKLLSPEFQPSVEQL 286
             SLKDDIMRLYQPVHLLVGTPGRILDL+KKGVC+LKDCS+LVMDEADKLLS EFQPSVE L
Sbjct:   238 SLKDDIMRLYQPVHLLVGTPGRILDLTKKGVCVLKDCSVLVMDEADKLLSQEFQPSVEHL 297

Query:   287 IRFLPANRQILMFSATFPVTVKDFKDKYLQKPYVINLMDELTLKGITQYYAFVEERQKVH 346
             I FLP +RQILMFSATFPVTVKDFKD++L  PYVINLMDELTLKGITQ+YAFVEERQK+H
Sbjct:   298 ISFLPESRQILMFSATFPVTVKDFKDRFLTNPYVINLMDELTLKGITQFYAFVEERQKIH 357

Query:   347 CLNTLFSKLQINQSIIFCNSVNRVELLAKKITELGYSCFYIHAKMLQDHRNRVFHDFRNG 406
             CLNTLFSKLQINQSIIFCNSVNRVELLAKKITELGYSCFYIHAKMLQDHRNRVFHDFRNG
Sbjct:   358 CLNTLFSKLQINQSIIFCNSVNRVELLAKKITELGYSCFYIHAKMLQDHRNRVFHDFRNG 417

Query:   407 ACRNLVCTDLFTRGIDIQAVNVVINFDFPKNSETYLHRV 445
             ACRNLVCTDLFTRGIDIQAVNVVINFDFPKN+ETYLHRV
Sbjct:   418 ACRNLVCTDLFTRGIDIQAVNVVINFDFPKNAETYLHRV 456




GO:0003676 "nucleic acid binding" evidence=IEA
GO:0004386 "helicase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005737 "cytoplasm" evidence=ISM
GO:0008026 "ATP-dependent helicase activity" evidence=IEA;ISS
GO:0016032 "viral reproduction" evidence=IMP
GO:0019048 "virus-host interaction" evidence=IPI
TAIR|locus:2098886 AT3G61240 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2050715 AT2G45810 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0291804 ddx6 "DEAD/DEAH box helicase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
POMBASE|SPBC776.09 ste13 "ATP-dependent RNA helicase Ste13" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
ASPGD|ASPL0000036135 AN10417 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
UNIPROTKB|A4R715 DHH1 "ATP-dependent RNA helicase DHH1" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
GENEDB_PFALCIPARUM|PFC0915w PFC0915w "ATP-dependent RNA helicase, putative" [Plasmodium falciparum (taxid:5833)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-6611 wu:fk48d07 "wu:fk48d07" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
FB|FBgn0004419 me31B "maternal expression at 31B" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q0CBE1DHH1_ASPTN3, ., 6, ., 4, ., 1, 30.76270.72980.6954N/Ano
Q1E5R1DHH1_COCIM3, ., 6, ., 4, ., 1, 30.77420.72160.6835N/Ano
A3LWX3DHH1_PICST3, ., 6, ., 4, ., 1, 30.73440.72980.6954yesno
P54824DDX6_XENLA3, ., 6, ., 4, ., 1, 30.71870.72370.7297N/Ano
Q75BS4DHH1_ASHGO3, ., 6, ., 4, ., 1, 30.72800.72780.7293yesno
Q54E49DDX6_DICDI3, ., 6, ., 4, ., 1, 30.78630.72370.8297yesno
P23128DDX6_DROME3, ., 6, ., 4, ., 1, 30.72850.72160.7625yesno
Q4WWD3DHH1_ASPFU3, ., 6, ., 4, ., 1, 30.76850.72160.6903yesno
Q0U7S9DHH1_PHANO3, ., 6, ., 4, ., 1, 30.73990.76700.7126N/Ano
Q6FQU5DHH1_CANGA3, ., 6, ., 4, ., 1, 30.71420.72160.6903yesno
Q94BV4RH6_ARATH3, ., 6, ., 4, ., 1, 30.75840.90100.8276nono
Q0IHV9DDX6_XENTR3, ., 6, ., 4, ., 1, 30.71870.72370.7297yesno
Q2U5A2DHH1_ASPOR3, ., 6, ., 4, ., 1, 30.73380.76080.7221yesno
Q6C0X2DHH1_YARLI3, ., 6, ., 4, ., 1, 30.75780.72370.6724yesno
Q95YF3CGH1_CAEEL3, ., 6, ., 4, ., 1, 30.69770.72980.8232yesno
Q9WTM2DDX6_CAVPO3, ., 6, ., 4, ., 1, 30.68180.76900.7902yesno
A4R715DHH1_MAGO73, ., 6, ., 4, ., 1, 30.72770.75870.6878N/Ano
Q8RXK6RH8_ARATH3, ., 6, ., 4, ., 1, 30.84460.90920.8732yesno
Q6H7S2RH8_ORYSJ3, ., 6, ., 4, ., 1, 30.80510.90510.8641yesno
Q6BJX6DHH1_DEBHA3, ., 6, ., 4, ., 1, 30.70900.72980.6860yesno
A1CJ18DHH1_ASPCL3, ., 6, ., 4, ., 1, 30.73380.76080.7335N/Ano
A5DIP0DHH1_PICGU3, ., 6, ., 4, ., 1, 30.71950.72780.6453N/Ano
Q5RFQ5DDX6_PONAB3, ., 6, ., 4, ., 1, 30.68180.76900.7722yesno
P26196DDX6_HUMAN3, ., 6, ., 4, ., 1, 30.68440.76900.7722yesno
Q5AAW3DHH1_CANAL3, ., 6, ., 4, ., 1, 30.71750.72980.6448N/Ano
Q6CSZ7DHH1_KLULA3, ., 6, ., 4, ., 1, 30.70330.72980.6887yesno
Q7S5D9DHH1_NEUCR3, ., 6, ., 4, ., 1, 30.73810.74020.7108N/Ano
Q5ZKB9DDX6_CHICK3, ., 6, ., 4, ., 1, 30.68440.76900.7722yesno
Q4HW67DHH1_GIBZE3, ., 6, ., 4, ., 1, 30.75920.72780.7263yesno
P54823DDX6_MOUSE3, ., 6, ., 4, ., 1, 30.69250.76900.7722yesno
Q9M2E0RH12_ARATH3, ., 6, ., 4, ., 1, 30.79370.91340.8895nono
P0CQ80DHH1_CRYNJ3, ., 6, ., 4, ., 1, 30.73010.72370.5616yesno
Q09181DHH1_SCHPO3, ., 6, ., 4, ., 1, 30.76420.72570.7257yesno
A7TGU7DHH1_VANPO3, ., 6, ., 4, ., 1, 30.71870.72570.7272N/Ano
P39517DHH1_YEAST3, ., 6, ., 4, ., 1, 30.71590.72570.6956yesno
A6RY31DHH1_BOTFB3, ., 6, ., 4, ., 1, 30.74190.76490.6895N/Ano
A1D8G1DHH1_NEOFI3, ., 6, ., 4, ., 1, 30.73110.76080.7278N/Ano
A2QY39DHH1_ASPNC3, ., 6, ., 4, ., 1, 30.72840.76080.7306yesno
Q7XMK8RH6_ORYSJ3, ., 6, ., 4, ., 1, 30.80390.90100.8775nono
A6ZXG9DHH1_YEAS73, ., 6, ., 4, ., 1, 30.71590.72570.6956N/Ano
Q2GQ93DHH1_CHAGB3, ., 6, ., 4, ., 1, 30.78070.68650.6503N/Ano

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.4.130.979
3rd Layer3.6.40.983

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
fgenesh4_pg.C_LG_II001453
hypothetical protein (499 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query485
COG0513 513 COG0513, SrmB, Superfamily II DNA and RNA helicase 1e-125
cd00268203 cd00268, DEADc, DEAD-box helicases 6e-95
PTZ00424401 PTZ00424, PTZ00424, helicase 45; Provisional 1e-94
PRK11776460 PRK11776, PRK11776, ATP-dependent RNA helicase Dbp 6e-80
PRK10590456 PRK10590, PRK10590, ATP-dependent RNA helicase Rhl 5e-67
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 5e-64
PTZ00110545 PTZ00110, PTZ00110, helicase; Provisional 9e-63
pfam00270169 pfam00270, DEAD, DEAD/DEAH box helicase 7e-62
PRK11634 629 PRK11634, PRK11634, ATP-dependent RNA helicase Dea 5e-60
PRK01297475 PRK01297, PRK01297, ATP-dependent RNA helicase Rhl 9e-55
smart00487201 smart00487, DEXDc, DEAD-like helicases superfamily 1e-51
PLN00206518 PLN00206, PLN00206, DEAD-box ATP-dependent RNA hel 9e-48
PRK04537 572 PRK04537, PRK04537, ATP-dependent RNA helicase Rhl 4e-46
PRK04837423 PRK04837, PRK04837, ATP-dependent RNA helicase Rhl 9e-41
cd00046144 cd00046, DEXDc, DEAD-like helicases superfamily 5e-40
cd00079131 cd00079, HELICc, Helicase superfamily c-terminal d 1e-32
pfam0027178 pfam00271, Helicase_C, Helicase conserved C-termin 1e-23
smart0049082 smart00490, HELICc, helicase superfamily c-termina 2e-22
COG1201 814 COG1201, Lhr, Lhr-like helicases [General function 6e-16
COG0514 590 COG0514, RecQ, Superfamily II DNA helicase [DNA re 4e-12
COG1061442 COG1061, SSL2, DNA or RNA helicases of superfamily 2e-11
TIGR01389 591 TIGR01389, recQ, ATP-dependent DNA helicase RecQ 3e-11
COG1204 766 COG1204, COG1204, Superfamily II helicase [General 5e-11
TIGR00614 470 TIGR00614, recQ_fam, ATP-dependent DNA helicase, R 4e-10
COG1202 830 COG1202, COG1202, Superfamily II helicase, archaea 5e-10
PRK11057 607 PRK11057, PRK11057, ATP-dependent DNA helicase Rec 5e-09
TIGR00643630 TIGR00643, recG, ATP-dependent DNA helicase RecG 8e-07
PRK00254 720 PRK00254, PRK00254, ski2-like helicase; Provisiona 3e-06
cd09639353 cd09639, Cas3_I, CRISPR/Cas system-associated prot 4e-06
COG1205 851 COG1205, COG1205, Distinct helicase family with a 5e-06
COG1203 733 COG1203, COG1203, CRISPR-associated helicase Cas3 1e-05
TIGR01587358 TIGR01587, cas3_core, CRISPR-associated helicase C 2e-05
COG1111542 COG1111, MPH1, ERCC4-like helicases [DNA replicati 4e-05
PRK13767 876 PRK13767, PRK13767, ATP-dependent helicase; Provis 4e-04
TIGR00580 926 TIGR00580, mfd, transcription-repair coupling fact 0.002
COG1197 1139 COG1197, Mfd, Transcription-repair coupling factor 0.003
>gnl|CDD|223587 COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
 Score =  374 bits (963), Expect = e-125
 Identities = 132/342 (38%), Positives = 199/342 (58%), Gaps = 7/342 (2%)

Query: 111 TEDVTATKGNEFEDYFLKRELLMGIFEKGFERPSPIQEESIPIALTGSDILARAKNGTGK 170
                     EF    L  ELL  + + GFE P+PIQ  +IP+ L G D+L +A+ GTGK
Sbjct: 20  LSRGEEKTPPEFASLGLSPELLQALKDLGFEEPTPIQLAAIPLILAGRDVLGQAQTGTGK 79

Query: 171 TAAFCIPALEKIDQ--DNNVIQVVILVPTRELALQTSQVCKELGKHL-NIQVMVTTGGTS 227
           TAAF +P L+KI +  +   +  +IL PTRELA+Q ++  ++LGK+L  ++V V  GG S
Sbjct: 80  TAAFLLPLLQKILKSVERKYVSALILAPTRELAVQIAEELRKLGKNLGGLRVAVVYGGVS 139

Query: 228 LKDDIMRLYQPVHLLVGTPGRILDLSKKGVCILKDCSMLVMDEADKLLSPEFQPSVEQLI 287
           ++  I  L + V ++V TPGR+LDL K+G   L     LV+DEAD++L   F   +E+++
Sbjct: 140 IRKQIEALKRGVDIVVATPGRLLDLIKRGKLDLSGVETLVLDEADRMLDMGFIDDIEKIL 199

Query: 288 RFLPANRQILMFSATFPVTVKDFKDKYLQKPYVINL---MDELTLKGITQYYAFVE-ERQ 343
           + LP +RQ L+FSAT P  +++   +YL  P  I +     E TLK I Q+Y  VE E +
Sbjct: 200 KALPPDRQTLLFSATMPDDIRELARRYLNDPVEIEVSVEKLERTLKKIKQFYLEVESEEE 259

Query: 344 KVHCLNTLFSKLQINQSIIFCNSVNRVELLAKKITELGYSCFYIHAKMLQDHRNRVFHDF 403
           K+  L  L       + I+F  +   VE LA+ + + G+    +H  + Q+ R+R    F
Sbjct: 260 KLELLLKLLKDEDEGRVIVFVRTKRLVEELAESLRKRGFKVAALHGDLPQEERDRALEKF 319

Query: 404 RNGACRNLVCTDLFTRGIDIQAVNVVINFDFPKNSETYLHRV 445
           ++G  R LV TD+  RG+DI  V+ VIN+D P + E Y+HR+
Sbjct: 320 KDGELRVLVATDVAARGLDIPDVSHVINYDLPLDPEDYVHRI 361


Length = 513

>gnl|CDD|238167 cd00268, DEADc, DEAD-box helicases Back     alignment and domain information
>gnl|CDD|185609 PTZ00424, PTZ00424, helicase 45; Provisional Back     alignment and domain information
>gnl|CDD|236977 PRK11776, PRK11776, ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>gnl|CDD|236722 PRK10590, PRK10590, ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|240273 PTZ00110, PTZ00110, helicase; Provisional Back     alignment and domain information
>gnl|CDD|215832 pfam00270, DEAD, DEAD/DEAH box helicase Back     alignment and domain information
>gnl|CDD|236941 PRK11634, PRK11634, ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|215103 PLN00206, PLN00206, DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>gnl|CDD|235307 PRK04537, PRK04537, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|235314 PRK04837, PRK04837, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|238005 cd00046, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|238034 cd00079, HELICc, Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>gnl|CDD|201125 pfam00271, Helicase_C, Helicase conserved C-terminal domain Back     alignment and domain information
>gnl|CDD|197757 smart00490, HELICc, helicase superfamily c-terminal domain Back     alignment and domain information
>gnl|CDD|224122 COG1201, Lhr, Lhr-like helicases [General function prediction only] Back     alignment and domain information
>gnl|CDD|223588 COG0514, RecQ, Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|223989 COG1061, SSL2, DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|130456 TIGR01389, recQ, ATP-dependent DNA helicase RecQ Back     alignment and domain information
>gnl|CDD|224125 COG1204, COG1204, Superfamily II helicase [General function prediction only] Back     alignment and domain information
>gnl|CDD|129701 TIGR00614, recQ_fam, ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>gnl|CDD|224123 COG1202, COG1202, Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>gnl|CDD|182933 PRK11057, PRK11057, ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>gnl|CDD|233069 TIGR00643, recG, ATP-dependent DNA helicase RecG Back     alignment and domain information
>gnl|CDD|234702 PRK00254, PRK00254, ski2-like helicase; Provisional Back     alignment and domain information
>gnl|CDD|187770 cd09639, Cas3_I, CRISPR/Cas system-associated protein Cas3 Back     alignment and domain information
>gnl|CDD|224126 COG1205, COG1205, Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>gnl|CDD|224124 COG1203, COG1203, CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|233483 TIGR01587, cas3_core, CRISPR-associated helicase Cas3 Back     alignment and domain information
>gnl|CDD|224036 COG1111, MPH1, ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|237497 PRK13767, PRK13767, ATP-dependent helicase; Provisional Back     alignment and domain information
>gnl|CDD|233032 TIGR00580, mfd, transcription-repair coupling factor (mfd) Back     alignment and domain information
>gnl|CDD|224118 COG1197, Mfd, Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 485
KOG0326459 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0331519 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0330476 consensus ATP-dependent RNA helicase [RNA processi 100.0
COG0513 513 SrmB Superfamily II DNA and RNA helicases [DNA rep 100.0
PTZ00110545 helicase; Provisional 100.0
KOG0328400 consensus Predicted ATP-dependent RNA helicase FAL 100.0
PRK11776460 ATP-dependent RNA helicase DbpA; Provisional 100.0
KOG0333673 consensus U5 snRNP-like RNA helicase subunit [RNA 100.0
PRK10590456 ATP-dependent RNA helicase RhlE; Provisional 100.0
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 100.0
KOG0338 691 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0342543 consensus ATP-dependent RNA helicase pitchoune [RN 100.0
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 100.0
KOG0345 567 consensus ATP-dependent RNA helicase [RNA processi 100.0
PRK04537 572 ATP-dependent RNA helicase RhlB; Provisional 100.0
KOG0343 758 consensus RNA Helicase [RNA processing and modific 100.0
PRK11192434 ATP-dependent RNA helicase SrmB; Provisional 100.0
PLN00206518 DEAD-box ATP-dependent RNA helicase; Provisional 100.0
KOG0340442 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0336629 consensus ATP-dependent RNA helicase [RNA processi 100.0
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 100.0
KOG0335482 consensus ATP-dependent RNA helicase [RNA processi 100.0
PTZ00424401 helicase 45; Provisional 100.0
KOG0341610 consensus DEAD-box protein abstrakt [RNA processin 100.0
KOG0347 731 consensus RNA helicase [RNA processing and modific 100.0
KOG0348 708 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0339 731 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0346 569 consensus RNA helicase [RNA processing and modific 100.0
KOG0332477 consensus ATP-dependent RNA helicase [RNA processi 100.0
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 100.0
KOG4284 980 consensus DEAD box protein [Transcription] 100.0
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 100.0
KOG0327397 consensus Translation initiation factor 4F, helica 100.0
KOG0334 997 consensus RNA helicase [RNA processing and modific 100.0
TIGR00614 470 recQ_fam ATP-dependent DNA helicase, RecQ family. 100.0
KOG0337 529 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0350620 consensus DEAD-box ATP-dependent RNA helicase [RNA 100.0
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 100.0
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 100.0
COG0514 590 RecQ Superfamily II DNA helicase [DNA replication, 100.0
PRK02362 737 ski2-like helicase; Provisional 100.0
PRK13767 876 ATP-dependent helicase; Provisional 100.0
PRK00254 720 ski2-like helicase; Provisional 100.0
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 100.0
KOG0329387 consensus ATP-dependent RNA helicase [RNA processi 100.0
COG1201 814 Lhr Lhr-like helicases [General function predictio 100.0
KOG0344593 consensus ATP-dependent RNA helicase [RNA processi 100.0
PRK01172 674 ski2-like helicase; Provisional 100.0
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 100.0
TIGR00580 926 mfd transcription-repair coupling factor (mfd). Al 100.0
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 100.0
PRK10689 1147 transcription-repair coupling factor; Provisional 100.0
PHA02653 675 RNA helicase NPH-II; Provisional 100.0
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 100.0
PRK10917681 ATP-dependent DNA helicase RecG; Provisional 100.0
TIGR00643630 recG ATP-dependent DNA helicase RecG. 100.0
KOG0353 695 consensus ATP-dependent DNA helicase [General func 100.0
KOG0351 941 consensus ATP-dependent DNA helicase [Replication, 100.0
PRK09401 1176 reverse gyrase; Reviewed 100.0
PRK14701 1638 reverse gyrase; Provisional 100.0
KOG0352 641 consensus ATP-dependent DNA helicase [Replication, 100.0
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 100.0
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 100.0
COG1111542 MPH1 ERCC4-like helicases [DNA replication, recomb 100.0
PRK12898656 secA preprotein translocase subunit SecA; Reviewed 100.0
PHA02558501 uvsW UvsW helicase; Provisional 100.0
COG1205 851 Distinct helicase family with a unique C-terminal 100.0
COG1202 830 Superfamily II helicase, archaea-specific [General 100.0
KOG0922 674 consensus DEAH-box RNA helicase [RNA processing an 100.0
KOG0923 902 consensus mRNA splicing factor ATP-dependent RNA h 100.0
COG1204 766 Superfamily II helicase [General function predicti 100.0
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. 100.0
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 100.0
KOG0349725 consensus Putative DEAD-box RNA helicase DDX1 [RNA 100.0
PRK09200 790 preprotein translocase subunit SecA; Reviewed 100.0
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombi 100.0
TIGR03714 762 secA2 accessory Sec system translocase SecA2. Memb 100.0
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 100.0
TIGR00963 745 secA preprotein translocase, SecA subunit. The pro 100.0
PRK13766 773 Hef nuclease; Provisional 100.0
KOG0924 1042 consensus mRNA splicing factor ATP-dependent RNA h 100.0
KOG0920 924 consensus ATP-dependent RNA helicase A [RNA proces 100.0
KOG0354 746 consensus DEAD-box like helicase [General function 100.0
TIGR00603 732 rad25 DNA repair helicase rad25. All proteins in t 100.0
KOG0952 1230 consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup 100.0
PRK09694 878 helicase Cas3; Provisional 100.0
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 100.0
PRK04914 956 ATP-dependent helicase HepA; Validated 99.98
PRK05580 679 primosome assembly protein PriA; Validated 99.97
KOG0947 1248 consensus Cytoplasmic exosomal RNA helicase SKI2, 99.97
KOG0926 1172 consensus DEAH-box RNA helicase [RNA processing an 99.97
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Trans 99.97
KOG0948 1041 consensus Nuclear exosomal RNA helicase MTR4, DEAD 99.97
PRK13104 896 secA preprotein translocase subunit SecA; Reviewed 99.97
COG4581 1041 Superfamily II RNA helicase [DNA replication, reco 99.97
COG1197 1139 Mfd Transcription-repair coupling factor (superfam 99.97
KOG0925 699 consensus mRNA splicing factor ATP-dependent RNA h 99.97
KOG0951 1674 consensus RNA helicase BRR2, DEAD-box superfamily 99.97
COG1200677 RecG RecG-like helicase [DNA replication, recombin 99.97
COG4098441 comFA Superfamily II DNA/RNA helicase required for 99.96
PRK12904 830 preprotein translocase subunit SecA; Reviewed 99.96
TIGR00595 505 priA primosomal protein N'. All proteins in this f 99.96
PRK12899 970 secA preprotein translocase subunit SecA; Reviewed 99.96
PRK12906 796 secA preprotein translocase subunit SecA; Reviewed 99.96
PRK11448 1123 hsdR type I restriction enzyme EcoKI subunit R; Pr 99.96
PLN03142 1033 Probable chromatin-remodeling complex ATPase chain 99.95
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 99.95
KOG0950 1008 consensus DNA polymerase theta/eta, DEAD-box super 99.94
PRK13107 908 preprotein translocase subunit SecA; Reviewed 99.94
COG1203 733 CRISPR-associated helicase Cas3 [Defense mechanism 99.93
KOG0385 971 consensus Chromatin remodeling complex WSTF-ISWI, 99.92
KOG0384 1373 consensus Chromodomain-helicase DNA-binding protei 99.9
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 99.89
PRK12326 764 preprotein translocase subunit SecA; Reviewed 99.88
PRK12900 1025 secA preprotein translocase subunit SecA; Reviewed 99.88
TIGR01407850 dinG_rel DnaQ family exonuclease/DinG family helic 99.88
TIGR00348667 hsdR type I site-specific deoxyribonuclease, HsdR 99.87
KOG0387 923 consensus Transcription-coupled repair protein CSB 99.87
COG4096 875 HsdR Type I site-specific restriction-modification 99.87
COG1198 730 PriA Primosomal protein N' (replication factor Y) 99.86
smart00487201 DEXDc DEAD-like helicases superfamily. 99.86
TIGR00631655 uvrb excinuclease ABC, B subunit. This family is b 99.86
KOG0949 1330 consensus Predicted helicase, DEAD-box superfamily 99.85
PRK13103 913 secA preprotein translocase subunit SecA; Reviewed 99.85
KOG1123 776 consensus RNA polymerase II transcription initiati 99.84
COG0556663 UvrB Helicase subunit of the DNA excision repair c 99.83
PRK12903 925 secA preprotein translocase subunit SecA; Reviewed 99.83
KOG0390776 consensus DNA repair protein, SNF2 family [Replica 99.82
KOG4150 1034 consensus Predicted ATP-dependent RNA helicase [RN 99.8
PRK07246820 bifunctional ATP-dependent DNA helicase/DNA polyme 99.8
PRK05298652 excinuclease ABC subunit B; Provisional 99.79
KOG0389941 consensus SNF2 family DNA-dependent ATPase [Chroma 99.79
KOG1000689 consensus Chromatin remodeling protein HARP/SMARCA 99.78
CHL00122 870 secA preprotein translocase subunit SecA; Validate 99.78
KOG03921549 consensus SNF2 family DNA-dependent ATPase domain- 99.77
KOG0953 700 consensus Mitochondrial RNA helicase SUV3, DEAD-bo 99.77
KOG0921 1282 consensus Dosage compensation complex, subunit MLE 99.77
PF0027178 Helicase_C: Helicase conserved C-terminal domain; 99.76
cd00079131 HELICc Helicase superfamily c-terminal domain; ass 99.75
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 99.75
COG4889 1518 Predicted helicase [General function prediction on 99.74
KOG0951 1674 consensus RNA helicase BRR2, DEAD-box superfamily 99.73
TIGR03117636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 99.72
TIGR02562 1110 cas3_yersinia CRISPR-associated helicase Cas3. The 99.69
PRK08074928 bifunctional ATP-dependent DNA helicase/DNA polyme 99.69
PRK12902 939 secA preprotein translocase subunit SecA; Reviewed 99.69
PF04851184 ResIII: Type III restriction enzyme, res subunit; 99.66
KOG0386 1157 consensus Chromatin remodeling complex SWI/SNF, co 99.65
smart0049082 HELICc helicase superfamily c-terminal domain. 99.63
PRK12901 1112 secA preprotein translocase subunit SecA; Reviewed 99.61
KOG0391 1958 consensus SNF2 family DNA-dependent ATPase [Genera 99.6
KOG1002791 consensus Nucleotide excision repair protein RAD16 99.57
KOG03881185 consensus SNF2 family DNA-dependent ATPase [Replic 99.55
PF02399 824 Herpes_ori_bp: Origin of replication binding prote 99.55
PRK11747697 dinG ATP-dependent DNA helicase DinG; Provisional 99.54
COG1199654 DinG Rad3-related DNA helicases [Transcription / D 99.53
TIGR00604 705 rad3 DNA repair helicase (rad3). All proteins in t 99.51
PRK14873 665 primosome assembly protein PriA; Provisional 99.5
KOG4439901 consensus RNA polymerase II transcription terminat 99.43
COG0553866 HepA Superfamily II DNA/RNA helicases, SNF2 family 99.42
KOG1015 1567 consensus Transcription regulator XNP/ATRX, DEAD-b 99.41
COG0653 822 SecA Preprotein translocase subunit SecA (ATPase, 99.38
PF06862442 DUF1253: Protein of unknown function (DUF1253); In 99.36
PF07652148 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR 99.31
PF00176299 SNF2_N: SNF2 family N-terminal domain; InterPro: I 99.28
COG0610 962 Type I site-specific restriction-modification syst 99.2
KOG2340698 consensus Uncharacterized conserved protein [Funct 99.12
smart00488289 DEXDc2 DEAD-like helicases superfamily. 99.07
smart00489289 DEXDc3 DEAD-like helicases superfamily. 99.07
PF07517266 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011 98.92
KOG09521230 consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup 98.89
KOG1016 1387 consensus Predicted DNA helicase, DEAD-box superfa 98.88
PRK15483 986 type III restriction-modification system StyLTI en 98.68
COG3587 985 Restriction endonuclease [Defense mechanisms] 98.65
TIGR00596 814 rad1 DNA repair protein (rad1). This family is bas 98.6
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 98.58
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 98.57
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 98.54
PF13872303 AAA_34: P-loop containing NTP hydrolase pore-1 98.39
PRK10536262 hypothetical protein; Provisional 98.35
KOG1001674 consensus Helicase-like transcription factor HLTF/ 98.32
TIGR01447 586 recD exodeoxyribonuclease V, alpha subunit. This f 98.24
PRK10875 615 recD exonuclease V subunit alpha; Provisional 98.19
TIGR01448720 recD_rel helicase, putative, RecD/TraA family. Thi 98.17
KOG1803 649 consensus DNA helicase [Replication, recombination 98.16
PF09848352 DUF2075: Uncharacterized conserved protein (DUF207 98.16
KOG1802 935 consensus RNA helicase nonsense mRNA reducing fact 98.07
PF13307167 Helicase_C_2: Helicase C-terminal domain; PDB: 4A1 98.05
PF12340229 DUF3638: Protein of unknown function (DUF3638); In 98.05
PF1324576 AAA_19: Part of AAA domain 97.99
KOG0383696 consensus Predicted helicase [General function pre 97.96
TIGR00376 637 DNA helicase, putative. The gene product may repre 97.91
COG1875436 NYN ribonuclease and ATPase of PhoH family domains 97.9
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 97.84
PRK13889 988 conjugal transfer relaxase TraA; Provisional 97.72
TIGR02768744 TraA_Ti Ti-type conjugative transfer relaxase TraA 97.7
KOG1132 945 consensus Helicase of the DEAD superfamily [Replic 97.69
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 97.69
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 97.6
PRK04296190 thymidine kinase; Provisional 97.56
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 97.5
PF00580315 UvrD-helicase: UvrD/REP helicase N-terminal domain 97.5
PRK13826 1102 Dtr system oriT relaxase; Provisional 97.5
KOG18051100 consensus DNA replication helicase [Replication, r 97.43
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 97.41
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 97.38
PRK14974336 cell division protein FtsY; Provisional 97.36
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 97.34
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 97.33
PRK06526254 transposase; Provisional 97.3
smart00382148 AAA ATPases associated with a variety of cellular 97.26
PRK08181269 transposase; Validated 97.21
TIGR02760 1960 TraI_TIGR conjugative transfer relaxase protein Tr 97.19
KOG1131 755 consensus RNA polymerase II transcription initiati 97.18
PF05970364 PIF1: PIF1-like helicase; InterPro: IPR010285 This 97.16
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 97.15
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 97.09
PF05127177 Helicase_RecD: Helicase; InterPro: IPR007807 This 97.08
PRK14956 484 DNA polymerase III subunits gamma and tau; Provisi 97.06
PF14617252 CMS1: U3-containing 90S pre-ribosomal complex subu 97.03
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 96.99
KOG0989346 consensus Replication factor C, subunit RFC4 [Repl 96.98
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 96.96
PRK00771437 signal recognition particle protein Srp54; Provisi 96.93
PRK08116268 hypothetical protein; Validated 96.81
PRK14087450 dnaA chromosomal replication initiation protein; P 96.79
PRK05642234 DNA replication initiation factor; Validated 96.78
PF13871 278 Helicase_C_4: Helicase_C-like 96.78
smart00492141 HELICc3 helicase superfamily c-terminal domain. 96.77
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 96.77
PRK06893229 DNA replication initiation factor; Validated 96.75
KOG0701 1606 consensus dsRNA-specific nuclease Dicer and relate 96.75
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 96.72
PRK11331459 5-methylcytosine-specific restriction enzyme subun 96.7
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 96.7
PRK14723 767 flhF flagellar biosynthesis regulator FlhF; Provis 96.7
COG1444 758 Predicted P-loop ATPase fused to an acetyltransfer 96.7
PRK14951 618 DNA polymerase III subunits gamma and tau; Provisi 96.68
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 96.68
PRK14964 491 DNA polymerase III subunits gamma and tau; Provisi 96.68
KOG0298 1394 consensus DEAD box-containing helicase-like transc 96.66
COG3421 812 Uncharacterized protein conserved in bacteria [Fun 96.65
PRK14958 509 DNA polymerase III subunits gamma and tau; Provisi 96.65
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 96.64
PRK08727233 hypothetical protein; Validated 96.64
PRK12377248 putative replication protein; Provisional 96.61
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 96.6
PRK07952244 DNA replication protein DnaC; Validated 96.6
PRK14712 1623 conjugal transfer nickase/helicase TraI; Provision 96.59
smart00491142 HELICc2 helicase superfamily c-terminal domain. 96.58
PRK00149450 dnaA chromosomal replication initiation protein; R 96.57
PRK08084235 DNA replication initiation factor; Provisional 96.57
PHA02533 534 17 large terminase protein; Provisional 96.56
PHA02544316 44 clamp loader, small subunit; Provisional 96.54
COG2805353 PilT Tfp pilus assembly protein, pilus retraction 96.53
PRK13709 1747 conjugal transfer nickase/helicase TraI; Provision 96.52
PRK14952 584 DNA polymerase III subunits gamma and tau; Provisi 96.45
TIGR01547396 phage_term_2 phage terminase, large subunit, PBSX 96.45
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 96.45
PRK06921266 hypothetical protein; Provisional 96.45
PF03354 477 Terminase_1: Phage Terminase ; InterPro: IPR005021 96.44
cd01124187 KaiC KaiC is a circadian clock protein primarily f 96.43
PRK00411394 cdc6 cell division control protein 6; Reviewed 96.42
PRK09111 598 DNA polymerase III subunits gamma and tau; Validat 96.42
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 96.4
PRK05707328 DNA polymerase III subunit delta'; Validated 96.4
PRK14965 576 DNA polymerase III subunits gamma and tau; Provisi 96.38
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Valida 96.37
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 96.37
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 96.36
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 96.35
PRK06835329 DNA replication protein DnaC; Validated 96.34
PRK06645 507 DNA polymerase III subunits gamma and tau; Validat 96.32
TIGR00362405 DnaA chromosomal replication initiator protein Dna 96.32
PTZ00293211 thymidine kinase; Provisional 96.3
PRK14721420 flhF flagellar biosynthesis regulator FlhF; Provis 96.29
TIGR00064272 ftsY signal recognition particle-docking protein F 96.28
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 96.27
PRK10919 672 ATP-dependent DNA helicase Rep; Provisional 96.25
COG2256436 MGS1 ATPase related to the helicase subunit of the 96.23
PRK11054 684 helD DNA helicase IV; Provisional 96.21
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 96.2
PRK08903227 DnaA regulatory inactivator Hda; Validated 96.18
PRK14959 624 DNA polymerase III subunits gamma and tau; Provisi 96.17
PF13173128 AAA_14: AAA domain 96.17
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 96.15
PLN03025319 replication factor C subunit; Provisional 96.14
PRK14969 527 DNA polymerase III subunits gamma and tau; Provisi 96.13
PRK10867433 signal recognition particle protein; Provisional 96.08
PRK05563 559 DNA polymerase III subunits gamma and tau; Validat 96.01
PRK12402337 replication factor C small subunit 2; Reviewed 95.99
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 95.99
PTZ001121164 origin recognition complex 1 protein; Provisional 95.98
KOG2028554 consensus ATPase related to the helicase subunit o 95.96
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 95.95
PRK14962 472 DNA polymerase III subunits gamma and tau; Provisi 95.94
PRK07471365 DNA polymerase III subunit delta'; Validated 95.94
cd03115173 SRP The signal recognition particle (SRP) mediates 95.93
PHA03333 752 putative ATPase subunit of terminase; Provisional 95.92
PF05876 557 Terminase_GpA: Phage terminase large subunit (GpA) 95.91
PRK14088440 dnaA chromosomal replication initiation protein; P 95.9
PRK08769319 DNA polymerase III subunit delta'; Validated 95.87
PRK13833323 conjugal transfer protein TrbB; Provisional 95.85
PRK14086617 dnaA chromosomal replication initiation protein; P 95.84
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 95.84
PRK04195 482 replication factor C large subunit; Provisional 95.8
TIGR02785 1232 addA_Gpos recombination helicase AddA, Firmicutes 95.79
TIGR01075 715 uvrD DNA helicase II. Designed to identify uvrD me 95.77
PRK14957 546 DNA polymerase III subunits gamma and tau; Provisi 95.75
PRK09183259 transposase/IS protein; Provisional 95.75
TIGR01074 664 rep ATP-dependent DNA helicase Rep. Designed to id 95.74
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 95.73
CHL00181287 cbbX CbbX; Provisional 95.73
PRK05896 605 DNA polymerase III subunits gamma and tau; Validat 95.72
COG3973 747 Superfamily I DNA and RNA helicases [General funct 95.7
cd00561159 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B 95.69
KOG0058716 consensus Peptide exporter, ABC superfamily [Intra 95.69
TIGR02525372 plasmid_TraJ plasmid transfer ATPase TraJ. Members 95.66
TIGR00959428 ffh signal recognition particle protein. This mode 95.66
PRK08451 535 DNA polymerase III subunits gamma and tau; Validat 95.66
TIGR02760 1960 TraI_TIGR conjugative transfer relaxase protein Tr 95.66
PRK11773 721 uvrD DNA-dependent helicase II; Provisional 95.66
KOG0991333 consensus Replication factor C, subunit RFC2 [Repl 95.64
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 95.63
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 95.63
PF00004132 AAA: ATPase family associated with various cellula 95.63
PRK14963 504 DNA polymerase III subunits gamma and tau; Provisi 95.63
COG1484254 DnaC DNA replication protein [DNA replication, rec 95.62
PRK12422445 chromosomal replication initiation protein; Provis 95.61
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 95.59
COG1435201 Tdk Thymidine kinase [Nucleotide transport and met 95.58
PRK08699325 DNA polymerase III subunit delta'; Validated 95.58
PRK14954 620 DNA polymerase III subunits gamma and tau; Provisi 95.57
COG0470325 HolB ATPase involved in DNA replication [DNA repli 95.54
COG2804500 PulE Type II secretory pathway, ATPase PulE/Tfp pi 95.53
PRK10917 681 ATP-dependent DNA helicase RecG; Provisional 95.45
PHA03368 738 DNA packaging terminase subunit 1; Provisional 95.45
PRK13341 725 recombination factor protein RarA/unknown domain f 95.44
PRK05986191 cob(I)alamin adenolsyltransferase/cobinamide ATP-d 95.44
TIGR02928365 orc1/cdc6 family replication initiation protein. M 95.43
TIGR02782299 TrbB_P P-type conjugative transfer ATPase TrbB. Th 95.41
PRK13894319 conjugal transfer ATPase TrbB; Provisional 95.41
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 95.38
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 95.37
TIGR02524358 dot_icm_DotB Dot/Icm secretion system ATPase DotB. 95.37
PRK10416318 signal recognition particle-docking protein FtsY; 95.34
PF01443234 Viral_helicase1: Viral (Superfamily 1) RNA helicas 95.31
COG4962355 CpaF Flp pilus assembly protein, ATPase CpaF [Intr 95.24
PRK08533230 flagellar accessory protein FlaH; Reviewed 95.24
PRK14950 585 DNA polymerase III subunits gamma and tau; Provisi 95.24
PRK13342413 recombination factor protein RarA; Reviewed 95.23
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 95.2
PRK00440319 rfc replication factor C small subunit; Reviewed 95.2
COG0593408 DnaA ATPase involved in DNA replication initiation 95.15
COG2109198 BtuR ATP:corrinoid adenosyltransferase [Coenzyme m 95.14
PRK04841 903 transcriptional regulator MalT; Provisional 95.09
PRK11823446 DNA repair protein RadA; Provisional 95.09
PRK09112351 DNA polymerase III subunit delta'; Validated 95.06
PF05729166 NACHT: NACHT domain 95.02
TIGR00708173 cobA cob(I)alamin adenosyltransferase. Alternate n 94.98
PRK05580 679 primosome assembly protein PriA; Validated 94.92
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 94.91
PHA00729226 NTP-binding motif containing protein 94.88
COG4626 546 Phage terminase-like protein, large subunit [Gener 94.84
PRK14948 620 DNA polymerase III subunits gamma and tau; Provisi 94.83
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 94.75
PRK06647 563 DNA polymerase III subunits gamma and tau; Validat 94.72
COG3972 660 Superfamily I DNA and RNA helicases [General funct 94.72
TIGR00643 630 recG ATP-dependent DNA helicase RecG. 94.71
KOG1513 1300 consensus Nuclear helicase MOP-3/SNO (DEAD-box sup 94.71
PRK07940394 DNA polymerase III subunit delta'; Validated 94.7
PRK06620214 hypothetical protein; Validated 94.63
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexame 94.62
TIGR03881229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 94.59
COG0552340 FtsY Signal recognition particle GTPase [Intracell 94.53
TIGR00595 505 priA primosomal protein N'. All proteins in this f 94.53
PRK14971 614 DNA polymerase III subunits gamma and tau; Provisi 94.52
PRK06305451 DNA polymerase III subunits gamma and tau; Validat 94.52
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 94.48
PRK06871325 DNA polymerase III subunit delta'; Validated 94.46
PRK06964342 DNA polymerase III subunit delta'; Validated 94.4
TIGR01073 726 pcrA ATP-dependent DNA helicase PcrA. Designed to 94.4
COG1132567 MdlB ABC-type multidrug transport system, ATPase a 94.35
PRK08939306 primosomal protein DnaI; Reviewed 94.28
PRK14953 486 DNA polymerase III subunits gamma and tau; Provisi 94.16
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 94.12
COG1618179 Predicted nucleotide kinase [Nucleotide transport 94.11
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 94.1
PRK13851344 type IV secretion system protein VirB11; Provision 94.07
PF03266168 NTPase_1: NTPase; InterPro: IPR004948 This entry r 93.99
TIGR00767415 rho transcription termination factor Rho. Members 93.97
PHA00350399 putative assembly protein 93.93
PRK13900332 type IV secretion system ATPase VirB11; Provisiona 93.92
PF00265176 TK: Thymidine kinase; InterPro: IPR001267 Thymidin 93.92
PRK10436462 hypothetical protein; Provisional 93.91
PRK06090319 DNA polymerase III subunit delta'; Validated 93.9
PF03969362 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 93.86
PF02572172 CobA_CobO_BtuR: ATP:corrinoid adenosyltransferase 93.85
TIGR00580 926 mfd transcription-repair coupling factor (mfd). Al 93.84
COG5008375 PilU Tfp pilus assembly protein, ATPase PilU [Cell 93.81
KOG0738491 consensus AAA+-type ATPase [Posttranslational modi 93.77
TIGR02639 731 ClpA ATP-dependent Clp protease ATP-binding subuni 93.69
TIGR01420343 pilT_fam pilus retraction protein PilT. This model 93.69
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 93.67
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 93.65
PRK06067234 flagellar accessory protein FlaH; Validated 93.64
KOG0742630 consensus AAA+-type ATPase [Posttranslational modi 93.52
PRK07993334 DNA polymerase III subunit delta'; Validated 93.46
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 93.44
PRK14873 665 primosome assembly protein PriA; Provisional 93.38
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subuni 93.28
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 93.28
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [P 93.17
KOG1133821 consensus Helicase of the DEAD superfamily [Replic 93.15
COG2255332 RuvB Holliday junction resolvasome, helicase subun 93.15
TIGR02237209 recomb_radB DNA repair and recombination protein R 93.1
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 93.06
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 93.01
TIGR02533486 type_II_gspE general secretory pathway protein E. 93.01
PF03237384 Terminase_6: Terminase-like family; InterPro: IPR0 92.97
PRK10689 1147 transcription-repair coupling factor; Provisional 92.92
PRK07414178 cob(I)yrinic acid a,c-diamide adenosyltransferase; 92.92
PF00437270 T2SE: Type II/IV secretion system protein; InterPr 92.88
KOG1133 821 consensus Helicase of the DEAD superfamily [Replic 92.86
PRK07413382 hypothetical protein; Validated 92.82
PRK09087226 hypothetical protein; Validated 92.8
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 92.77
KOG0739439 consensus AAA+-type ATPase [Posttranslational modi 92.72
TIGR02538564 type_IV_pilB type IV-A pilus assembly ATPase PilB. 92.72
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 92.72
TIGR00763775 lon ATP-dependent protease La. This protein is ind 92.64
PRK05973237 replicative DNA helicase; Provisional 92.62
cd01128249 rho_factor Transcription termination factor rho is 92.61
cd01126384 TraG_VirD4 The TraG/TraD/VirD4 family are bacteria 92.6
PRK14970367 DNA polymerase III subunits gamma and tau; Provisi 92.55
PRK09376416 rho transcription termination factor Rho; Provisio 92.5
KOG0741744 consensus AAA+-type ATPase [Posttranslational modi 92.5
COG0541451 Ffh Signal recognition particle GTPase [Intracellu 92.41
COG0513 513 SrmB Superfamily II DNA and RNA helicases [DNA rep 92.36
PRK13764602 ATPase; Provisional 92.3
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 92.29
PRK07399314 DNA polymerase III subunit delta'; Validated 92.1
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 92.03
PRK08058329 DNA polymerase III subunit delta'; Validated 92.0
PF02534 469 T4SS-DNA_transf: Type IV secretory system Conjugat 91.99
cd03239178 ABC_SMC_head The structural maintenance of chromos 91.74
PRK09354349 recA recombinase A; Provisional 91.74
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 91.66
PHA00012361 I assembly protein 91.64
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 91.57
COG1855604 ATPase (PilT family) [General function prediction 91.54
PRK10865 857 protein disaggregation chaperone; Provisional 91.53
TIGR00416454 sms DNA repair protein RadA. The gene protuct code 91.51
TIGR03878259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 91.46
PRK13897 606 type IV secretion system component VirD4; Provisio 91.44
TIGR02858270 spore_III_AA stage III sporulation protein AA. Mem 91.43
PHA03372 668 DNA packaging terminase subunit 1; Provisional 91.42
PF12846304 AAA_10: AAA-like domain 91.39
TIGR01243 733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 91.33
TIGR00602 637 rad24 checkpoint protein rad24. This family is bas 91.12
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 91.1
CHL00095 821 clpC Clp protease ATP binding subunit 91.05
PRK13695174 putative NTPase; Provisional 91.04
cd01393226 recA_like RecA is a bacterial enzyme which has rol 90.95
COG2812 515 DnaX DNA polymerase III, gamma/tau subunits [DNA r 90.92
PRK14701 1638 reverse gyrase; Provisional 90.9
TIGR02688449 conserved hypothetical protein TIGR02688. Members 90.87
PF02606326 LpxK: Tetraacyldisaccharide-1-P 4'-kinase; InterPr 90.87
COG2874235 FlaH Predicted ATPases involved in biogenesis of a 90.85
TIGR03600421 phage_DnaB phage replicative helicase, DnaB family 90.81
KOG0737386 consensus AAA+-type ATPase [Posttranslational modi 90.81
cd03276198 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC protein 90.78
PRK04328249 hypothetical protein; Provisional 90.78
PF03796259 DnaB_C: DnaB-like helicase C terminal domain; Inte 90.6
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 90.51
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 90.5
PRK13850 670 type IV secretion system protein VirD4; Provisiona 90.45
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 90.36
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 90.32
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 90.29
PF08423256 Rad51: Rad51; InterPro: IPR013632 This domain is f 90.23
KOG0780483 consensus Signal recognition particle, subunit Srp 90.19
KOG0744423 consensus AAA+-type ATPase [Posttranslational modi 90.16
PF1355562 AAA_29: P-loop containing region of AAA domain 90.11
cd01125239 repA Hexameric Replicative Helicase RepA. RepA is 89.95
CHL00176638 ftsH cell division protein; Validated 89.92
TIGR02788308 VirB11 P-type DNA transfer ATPase VirB11. The VirB 89.89
KOG2227529 consensus Pre-initiation complex, subunit CDC6, AA 89.84
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 89.79
PF06733174 DEAD_2: DEAD_2; InterPro: IPR010614 This represent 89.73
COG1200 677 RecG RecG-like helicase [DNA replication, recombin 89.72
KOG1513 1300 consensus Nuclear helicase MOP-3/SNO (DEAD-box sup 89.64
COG1198 730 PriA Primosomal protein N' (replication factor Y) 89.61
COG0630312 VirB11 Type IV secretory pathway, VirB11 component 89.59
PF12775272 AAA_7: P-loop containing dynein motor region D3; P 89.56
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 89.53
KOG0734 752 consensus AAA+-type ATPase containing the peptidas 89.49
PRK10787 784 DNA-binding ATP-dependent protease La; Provisional 89.45
TIGR03819340 heli_sec_ATPase helicase/secretion neighborhood AT 89.31
TIGR02203571 MsbA_lipidA lipid A export permease/ATP-binding pr 89.31
>KOG0326 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
Probab=100.00  E-value=5.2e-77  Score=530.22  Aligned_cols=389  Identities=77%  Similarity=1.166  Sum_probs=377.1

Q ss_pred             CCCCchhHhhhcCCCCCCCCccccccccCCCCcccccCCCHHHHHHHHHcCCCCCcHHHHHHHHHHhcCCCEEEEccCCC
Q 011446           89 VDPSSQDWKARLKIPPADTRYRTEDVTATKGNEFEDYFLKRELLMGIFEKGFERPSPIQEESIPIALTGSDILARAKNGT  168 (485)
Q Consensus        89 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~l~~~~~~~~~~~Q~~~i~~i~~~~~~ii~~~TGs  168 (485)
                      .+....+|+...+.|+.+.++.++++...+..+|+++.|.++++..++++||+.|.|+|.++||.++.|+|+++.|..|+
T Consensus        54 ~~~~~~dwk~~l~lpp~d~R~~t~DVt~TkG~efEd~~Lkr~LLmgIfe~G~ekPSPiQeesIPiaLtGrdiLaRaKNGT  133 (459)
T KOG0326|consen   54 EEANGKDWKATLKLPPKDTRYKTEDVTATKGNEFEDYCLKRELLMGIFEKGFEKPSPIQEESIPIALTGRDILARAKNGT  133 (459)
T ss_pred             ccccchhhHHhccCCCCCccccccccccccCccHHHhhhhHHHHHHHHHhccCCCCCccccccceeecchhhhhhccCCC
Confidence            33478899999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             chhHHhHHHHHhhhhccCCceEEEEEcCcHHHHHHHHHHHHHHhccCCceEEEEECCCChHHHHHHhcCCCeEEEEcchH
Q 011446          169 GKTAAFCIPALEKIDQDNNVIQVVILVPTRELALQTSQVCKELGKHLNIQVMVTTGGTSLKDDIMRLYQPVHLLVGTPGR  248 (485)
Q Consensus       169 GKT~~~~~~~l~~l~~~~~~~~~lil~P~~~la~q~~~~~~~~~~~~~~~v~~~~g~~~~~~~~~~~~~~~~Ili~Tp~~  248 (485)
                      |||.+|.+|+++.+....+..+++|++|+|+||.|+.+.++++.+.+++.++..+||++.++++.++.+..+++|+|||+
T Consensus       134 GKT~a~~IP~Lekid~~~~~IQ~~ilVPtrelALQtSqvc~~lskh~~i~vmvttGGT~lrDDI~Rl~~~VH~~vgTPGR  213 (459)
T KOG0326|consen  134 GKTAAYCIPVLEKIDPKKNVIQAIILVPTRELALQTSQVCKELSKHLGIKVMVTTGGTSLRDDIMRLNQTVHLVVGTPGR  213 (459)
T ss_pred             CCccceechhhhhcCccccceeEEEEeecchhhHHHHHHHHHHhcccCeEEEEecCCcccccceeeecCceEEEEcCChh
Confidence            99999999999999998888999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHhhhcCccccCCcceEEeeccccccCCCCHHHHHHHHHhCCCCCcEEEEecccchHHHHHHHHhcCCCeEEeeccccc
Q 011446          249 ILDLSKKGVCILKDCSMLVMDEADKLLSPEFQPSVEQLIRFLPANRQILMFSATFPVTVKDFKDKYLQKPYVINLMDELT  328 (485)
Q Consensus       249 l~~~~~~~~~~l~~~~~iViDEah~~~~~~~~~~~~~i~~~~~~~~~~i~~SATl~~~~~~~~~~~~~~~~~~~~~~~~~  328 (485)
                      ++++..++...++++.++|+||||.+++.+|.+.+..++..+|+++|++++|||+|..+..|..+++.+|+.+++.++..
T Consensus       214 IlDL~~KgVa~ls~c~~lV~DEADKlLs~~F~~~~e~li~~lP~~rQillySATFP~tVk~Fm~~~l~kPy~INLM~eLt  293 (459)
T KOG0326|consen  214 ILDLAKKGVADLSDCVILVMDEADKLLSVDFQPIVEKLISFLPKERQILLYSATFPLTVKGFMDRHLKKPYEINLMEELT  293 (459)
T ss_pred             HHHHHhcccccchhceEEEechhhhhhchhhhhHHHHHHHhCCccceeeEEecccchhHHHHHHHhccCcceeehhhhhh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cccceEEEEeehhhhhHHHHHHHHHhcCCCcEEEEecChhHHHHHHHHHHHcCCeEEEEcCCCCHHHHHHHHHHHhcCCc
Q 011446          329 LKGITQYYAFVEERQKVHCLNTLFSKLQINQSIIFCNSVNRVELLAKKITELGYSCFYIHAKMLQDHRNRVFHDFRNGAC  408 (485)
Q Consensus       329 ~~~~~~~~~~~~~~~~~~~l~~l~~~~~~~~~lVf~~~~~~~~~l~~~L~~~~~~~~~~h~~~~~~~r~~i~~~f~~g~~  408 (485)
                      ..++.+||.++.+..|..+|..++.+..-.+.|||||+...+|.+++.+.++|+.+.++|+.|.++.|.++|+.|++|.+
T Consensus       294 l~GvtQyYafV~e~qKvhCLntLfskLqINQsIIFCNS~~rVELLAkKITelGyscyyiHakM~Q~hRNrVFHdFr~G~c  373 (459)
T KOG0326|consen  294 LKGVTQYYAFVEERQKVHCLNTLFSKLQINQSIIFCNSTNRVELLAKKITELGYSCYYIHAKMAQEHRNRVFHDFRNGKC  373 (459)
T ss_pred             hcchhhheeeechhhhhhhHHHHHHHhcccceEEEeccchHhHHHHHHHHhccchhhHHHHHHHHhhhhhhhhhhhcccc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cEEEEccccccCCCCCCCCEEEEcCCCCChHHHHHHhhhccccCcccccc-------hHHHHHHHHHhhccccccC
Q 011446          409 RNLVCTDLFTRGIDIQAVNVVINFDFPKNSETYLHRVCWIQLSFSLSLPN-------LQFMCSMLMYICFTDRLVD  477 (485)
Q Consensus       409 ~vlvaT~~~~~Gidi~~v~~VI~~~~p~s~~~~~Qr~GRagR~g~~~~~~-------~~~~~~~~~~~~~~~~~~~  477 (485)
                      +.||||+.+.||||+++|++||+||+|++.++|.||+||+||.|++|.+-       ...+..++..+..+++.++
T Consensus       374 rnLVctDL~TRGIDiqavNvVINFDfpk~aEtYLHRIGRsGRFGhlGlAInLityedrf~L~~IE~eLGtEI~pip  449 (459)
T KOG0326|consen  374 RNLVCTDLFTRGIDIQAVNVVINFDFPKNAETYLHRIGRSGRFGHLGLAINLITYEDRFNLYRIEQELGTEIKPIP  449 (459)
T ss_pred             ceeeehhhhhcccccceeeEEEecCCCCCHHHHHHHccCCccCCCcceEEEEEehhhhhhHHHHHHHhccccccCC
Confidence            99999999999999999999999999999999999999999999999874       3356778888988888776



>KOG0331 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0330 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>KOG0328 consensus Predicted ATP-dependent RNA helicase FAL1, involved in rRNA maturation, DEAD-box superfamily [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>KOG0333 consensus U5 snRNP-like RNA helicase subunit [RNA processing and modification] Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0338 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0342 consensus ATP-dependent RNA helicase pitchoune [RNA processing and modification] Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>KOG0345 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0343 consensus RNA Helicase [RNA processing and modification] Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>KOG0340 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0336 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0335 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>KOG0341 consensus DEAD-box protein abstrakt [RNA processing and modification] Back     alignment and domain information
>KOG0347 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0348 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0339 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0346 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0332 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>KOG4284 consensus DEAD box protein [Transcription] Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>KOG0327 consensus Translation initiation factor 4F, helicase subunit (eIF-4A) and related helicases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0334 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>KOG0337 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0350 consensus DEAD-box ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>KOG0329 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>KOG0344 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>KOG0353 consensus ATP-dependent DNA helicase [General function prediction only] Back     alignment and domain information
>KOG0351 consensus ATP-dependent DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>KOG0352 consensus ATP-dependent DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>KOG0922 consensus DEAH-box RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0923 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>KOG0349 consensus Putative DEAD-box RNA helicase DDX1 [RNA processing and modification] Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>KOG0924 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0920 consensus ATP-dependent RNA helicase A [RNA processing and modification] Back     alignment and domain information
>KOG0354 consensus DEAD-box like helicase [General function prediction only] Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>KOG0947 consensus Cytoplasmic exosomal RNA helicase SKI2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0926 consensus DEAH-box RNA helicase [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0948 consensus Nuclear exosomal RNA helicase MTR4, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>KOG0925 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>KOG0950 consensus DNA polymerase theta/eta, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>KOG0385 consensus Chromatin remodeling complex WSTF-ISWI, small subunit [Transcription] Back     alignment and domain information
>KOG0384 consensus Chromodomain-helicase DNA-binding protein [Transcription] Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12326 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>KOG0387 consensus Transcription-coupled repair protein CSB/RAD26 (contains SNF2 family DNA-dependent ATPase domain) [Transcription; Replication, recombination and repair] Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>KOG0949 consensus Predicted helicase, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>PRK13103 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG1123 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 3'-5' helicase subunit SSL2 [Transcription; Replication, recombination and repair] Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12903 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0390 consensus DNA repair protein, SNF2 family [Replication, recombination and repair] Back     alignment and domain information
>KOG4150 consensus Predicted ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>KOG0389 consensus SNF2 family DNA-dependent ATPase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1000 consensus Chromatin remodeling protein HARP/SMARCAL1, DEAD-box superfamily [Chromatin structure and dynamics] Back     alignment and domain information
>CHL00122 secA preprotein translocase subunit SecA; Validated Back     alignment and domain information
>KOG0392 consensus SNF2 family DNA-dependent ATPase domain-containing protein [Transcription] Back     alignment and domain information
>KOG0953 consensus Mitochondrial RNA helicase SUV3, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0921 consensus Dosage compensation complex, subunit MLE [Transcription] Back     alignment and domain information
>PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins Back     alignment and domain information
>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>COG4889 Predicted helicase [General function prediction only] Back     alignment and domain information
>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3 Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK12902 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>KOG0386 consensus Chromatin remodeling complex SWI/SNF, component SWI2 and related ATPases (DNA/RNA helicase superfamily) [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>smart00490 HELICc helicase superfamily c-terminal domain Back     alignment and domain information
>PRK12901 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0391 consensus SNF2 family DNA-dependent ATPase [General function prediction only] Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>KOG0388 consensus SNF2 family DNA-dependent ATPase [Replication, recombination and repair] Back     alignment and domain information
>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>KOG4439 consensus RNA polymerase II transcription termination factor TTF2/lodestar, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1015 consensus Transcription regulator XNP/ATRX, DEAD-box superfamily [Transcription] Back     alignment and domain information
>COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion] Back     alignment and domain information
>PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ] Back     alignment and domain information
>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain Back     alignment and domain information
>PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e Back     alignment and domain information
>COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>KOG2340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00488 DEXDc2 DEAD-like helicases superfamily Back     alignment and domain information
>smart00489 DEXDc3 DEAD-like helicases superfamily Back     alignment and domain information
>PF07517 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011115 SecA protein binds to the plasma membrane where it interacts with proOmpA to support translocation of proOmpA through the membrane Back     alignment and domain information
>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>KOG1016 consensus Predicted DNA helicase, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>PRK15483 type III restriction-modification system StyLTI enzyme res; Provisional Back     alignment and domain information
>COG3587 Restriction endonuclease [Defense mechanisms] Back     alignment and domain information
>TIGR00596 rad1 DNA repair protein (rad1) Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>PF13872 AAA_34: P-loop containing NTP hydrolase pore-1 Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>KOG1803 consensus DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>KOG1802 consensus RNA helicase nonsense mRNA reducing factor (pNORF1) [RNA processing and modification] Back     alignment and domain information
>PF13307 Helicase_C_2: Helicase C-terminal domain; PDB: 4A15_A 2VSF_A 3CRV_A 3CRW_1 2VL7_A Back     alignment and domain information
>PF12340 DUF3638: Protein of unknown function (DUF3638); InterPro: IPR022099 This domain family is found in eukaryotes, and is approximately 230 amino acids in length Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>KOG0383 consensus Predicted helicase [General function prediction only] Back     alignment and domain information
>TIGR00376 DNA helicase, putative Back     alignment and domain information
>COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only] Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK13889 conjugal transfer relaxase TraA; Provisional Back     alignment and domain information
>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA Back     alignment and domain information
>KOG1132 consensus Helicase of the DEAD superfamily [Replication, recombination and repair] Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA Back     alignment and domain information
>PRK13826 Dtr system oriT relaxase; Provisional Back     alignment and domain information
>KOG1805 consensus DNA replication helicase [Replication, recombination and repair] Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI Back     alignment and domain information
>KOG1131 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 5'-3' helicase subunit RAD3 [Transcription; Replication, recombination and repair] Back     alignment and domain information
>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF05127 Helicase_RecD: Helicase; InterPro: IPR007807 This domain is about 350 amino acid residues long and appears to have a P-loop motif, suggesting this is an ATPase Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF14617 CMS1: U3-containing 90S pre-ribosomal complex subunit Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PF13871 Helicase_C_4: Helicase_C-like Back     alignment and domain information
>smart00492 HELICc3 helicase superfamily c-terminal domain Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>KOG0701 consensus dsRNA-specific nuclease Dicer and related ribonucleases [RNA processing and modification] Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG1444 Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only] Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] Back     alignment and domain information
>COG3421 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK14712 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>smart00491 HELICc2 helicase superfamily c-terminal domain Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PHA02533 17 large terminase protein; Provisional Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK13709 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR01547 phage_term_2 phage terminase, large subunit, PBSX family Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>PF03354 Terminase_1: Phage Terminase ; InterPro: IPR005021 This entry is represented by Lactococcus phage bIL285, Orf41 (terminase) Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PTZ00293 thymidine kinase; Provisional Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK10919 ATP-dependent DNA helicase Rep; Provisional Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK11054 helD DNA helicase IV; Provisional Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>PHA03333 putative ATPase subunit of terminase; Provisional Back     alignment and domain information
>PF05876 Terminase_GpA: Phage terminase large subunit (GpA); InterPro: IPR008866 This entry is represented by Bacteriophage lambda, GpA Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK13833 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>TIGR02785 addA_Gpos recombination helicase AddA, Firmicutes type Back     alignment and domain information
>TIGR01075 uvrD DNA helicase II Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>TIGR01074 rep ATP-dependent DNA helicase Rep Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG3973 Superfamily I DNA and RNA helicases [General function prediction only] Back     alignment and domain information
>cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP Back     alignment and domain information
>KOG0058 consensus Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI Back     alignment and domain information
>PRK11773 uvrD DNA-dependent helicase II; Provisional Back     alignment and domain information
>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>COG1435 Tdk Thymidine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>PHA03368 DNA packaging terminase subunit 1; Provisional Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PRK05986 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase; Validated Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>PRK13894 conjugal transfer ATPase TrbB; Provisional Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>PF01443 Viral_helicase1: Viral (Superfamily 1) RNA helicase; InterPro: IPR000606 This entry includes RNA and DNA helicases Back     alignment and domain information
>COG4962 CpaF Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>COG2109 BtuR ATP:corrinoid adenosyltransferase [Coenzyme metabolism] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>TIGR00708 cobA cob(I)alamin adenosyltransferase Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>COG4626 Phage terminase-like protein, large subunit [General function prediction only] Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG3972 Superfamily I DNA and RNA helicases [General function prediction only] Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>KOG1513 consensus Nuclear helicase MOP-3/SNO (DEAD-box superfamily) [Transcription; Signal transduction mechanisms] Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR01073 pcrA ATP-dependent DNA helicase PcrA Back     alignment and domain information
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK13851 type IV secretion system protein VirB11; Provisional Back     alignment and domain information
>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>PHA00350 putative assembly protein Back     alignment and domain information
>PRK13900 type IV secretion system ATPase VirB11; Provisional Back     alignment and domain information
>PF00265 TK: Thymidine kinase; InterPro: IPR001267 Thymidine kinase (TK) (2 Back     alignment and domain information
>PRK10436 hypothetical protein; Provisional Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF03969 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP Back     alignment and domain information
>PF02572 CobA_CobO_BtuR: ATP:corrinoid adenosyltransferase BtuR/CobO/CobP; InterPro: IPR003724 ATP:cob(I)alamin (or ATP:corrinoid) adenosyltransferases (2 Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>COG5008 PilU Tfp pilus assembly protein, ATPase PilU [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1133 consensus Helicase of the DEAD superfamily [Replication, recombination and repair] Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>TIGR02533 type_II_gspE general secretory pathway protein E Back     alignment and domain information
>PF03237 Terminase_6: Terminase-like family; InterPro: IPR004921 The terminase is a component of the molecular motor that translocates genomic DNA into empty capsids during DNA packaging [] Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>PRK07414 cob(I)yrinic acid a,c-diamide adenosyltransferase; Validated Back     alignment and domain information
>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] Back     alignment and domain information
>KOG1133 consensus Helicase of the DEAD superfamily [Replication, recombination and repair] Back     alignment and domain information
>PRK07413 hypothetical protein; Validated Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>cd01126 TraG_VirD4 The TraG/TraD/VirD4 family are bacterial conjugation proteins involved in type IV secretion Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK09376 rho transcription termination factor Rho; Provisional Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK13764 ATPase; Provisional Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF02534 T4SS-DNA_transf: Type IV secretory system Conjugative DNA transfer; InterPro: IPR003688 This entry represents TraG proteins and their homologues Back     alignment and domain information
>cd03239 ABC_SMC_head The structural maintenance of chromosomes (SMC) proteins are essential for successful chromosome transmission during replication and segregation of the genome in all organisms Back     alignment and domain information
>PRK09354 recA recombinase A; Provisional Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>PHA00012 I assembly protein Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>COG1855 ATPase (PilT family) [General function prediction only] Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>PRK13897 type IV secretion system component VirD4; Provisional Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA Back     alignment and domain information
>PHA03372 DNA packaging terminase subunit 1; Provisional Back     alignment and domain information
>PF12846 AAA_10: AAA-like domain Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>TIGR02688 conserved hypothetical protein TIGR02688 Back     alignment and domain information
>PF02606 LpxK: Tetraacyldisaccharide-1-P 4'-kinase; InterPro: IPR003758 Tetraacyldisaccharide 4'-kinase phosphorylates the 4'-position of a tetraacyldisaccharide 1-phosphate precursor (DS-1-P) of lipid A, but the enzyme has not yet been purified because of instability [] Back     alignment and domain information
>COG2874 FlaH Predicted ATPases involved in biogenesis of archaeal flagella [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily Back     alignment and domain information
>KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03276 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>PF03796 DnaB_C: DnaB-like helicase C terminal domain; InterPro: IPR007694 The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>PRK13850 type IV secretion system protein VirD4; Provisional Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>PF08423 Rad51: Rad51; InterPro: IPR013632 This domain is found at the C terminus of the DNA repair and recombination protein Rad51 Back     alignment and domain information
>KOG0780 consensus Signal recognition particle, subunit Srp54 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>cd01125 repA Hexameric Replicative Helicase RepA Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 Back     alignment and domain information
>KOG2227 consensus Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase [Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>PF06733 DEAD_2: DEAD_2; InterPro: IPR010614 This represents a conserved region within a number of RAD3-like DNA-binding helicases that are seemingly ubiquitous - members include proteins of eukaryotic, bacterial and archaeal origin Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>KOG1513 consensus Nuclear helicase MOP-3/SNO (DEAD-box superfamily) [Transcription; Signal transduction mechanisms] Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG0630 VirB11 Type IV secretory pathway, VirB11 components, and related ATPases involved in archaeal flagella biosynthesis [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>TIGR03819 heli_sec_ATPase helicase/secretion neighborhood ATPase Back     alignment and domain information
>TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query485
1s2m_A400 Crystal Structure Of The Dead Box Protein Dhh1p Len 1e-149
1vec_A206 Crystal Structure Of The N-Terminal Domain Of RckP5 2e-72
2xb2_A411 Crystal Structure Of The Core Mago-Y14-Eif4aiii-Bar 6e-68
2hyi_C413 Structure Of The Human Exon Junction Complex With A 6e-68
2j0q_A410 The Crystal Structure Of The Exon Junction Complex 6e-68
2hxy_A391 Crystal Structure Of Human Apo-Eif4aiii Length = 39 7e-68
2j0u_B374 The Crystal Structure Of Eif4aiii-Barentsz Complex 1e-67
2vso_A395 Crystal Structure Of A Translation Initiation Compl 2e-67
2j0u_A374 The Crystal Structure Of Eif4aiii-Barentsz Complex 2e-67
1fuu_A394 Yeast Initiation Factor 4a Length = 394 4e-65
3eiq_A414 Crystal Structure Of Pdcd4-eif4a Length = 414 7e-65
2wax_A193 Structure Of The Human Ddx6 C-Terminal Domain In Co 9e-65
2zu6_A388 Crystal Structure Of The Eif4a-Pdcd4 Complex Length 4e-64
1xtk_A390 Structure Of Decd To Dead Mutation Of Human Uap56 L 3e-61
1xtj_A386 Structure Of Human Uap56 In Complex With Adp Length 1e-60
1xti_A391 Structure Of Wildtype Human Uap56 Length = 391 2e-60
3fmp_B479 Crystal Structure Of The Nucleoporin Nup214 In Comp 3e-51
3g0h_A424 Human Dead-box Rna Helicase Ddx19, In Complex With 5e-51
3ews_A445 Human Dead-Box Rna-Helicase Ddx19 In Complex With A 6e-51
3fht_A412 Crystal Structure Of Human Dbp5 In Complex With Amp 6e-51
1hv8_A367 Crystal Structure Of A Dead Box Protein From The Hy 5e-49
3pew_A395 S. Cerevisiae Dbp5 L327v Bound To Rna And Adp Bef3 3e-46
3pey_A395 S. Cerevisiae Dbp5 Bound To Rna And Adp Bef3 Length 3e-46
2i4i_A417 Crystal Structure Of Human Dead-Box Rna Helicase Dd 5e-45
2db3_A434 Structural Basis For Rna Unwinding By The Dead-Box 5e-43
3fho_B508 Structure Of S. Pombe Dbp5 Length = 508 5e-43
2z0m_A337 Crystal Structure Of Hypothetical Atp-Dependent Rna 6e-38
1qde_A224 Crystal Structure Of The Atpase Domain Of Translati 5e-37
1qva_A223 Yeast Initiation Factor 4a N-Terminal Domain Length 2e-36
2gxq_A207 Hera N-Terminal Domain In Complex With Amp, Crystal 3e-36
3mwj_A207 Q28e Mutant Of Hera N-Terminal Reca-Like Domain, Ap 7e-36
2oxc_A230 Human Dead-Box Rna Helicase Ddx20, Dead Domain In C 1e-34
3bor_A237 Crystal Structure Of The Deadc Domain Of Human Tran 4e-34
1t6n_A220 Crystal Structure Of The N-Terminal Domain Of Human 6e-34
2g9n_A221 Structure Of The Dead Domain Of Human Eukaryotic In 8e-33
2pl3_A236 Human Dead-Box Rna Helicase Ddx10, Dead Domain In C 3e-30
3ber_A249 Human Dead-Box Rna-Helicase Ddx47, Conserved Domain 5e-29
1wrb_A253 Crystal Structure Of The N-Terminal Reca-Like Domai 3e-28
3ly5_A262 Ddx18 Dead-Domain Length = 262 4e-28
3fmo_B300 Crystal Structure Of The Nucleoporin Nup214 In Comp 1e-27
3fhc_B235 Crystal Structure Of Human Dbp5 In Complex With Nup 2e-27
3iuy_A228 Crystal Structure Of Ddx53 Dead-Box Domain Length = 3e-27
2kbe_A226 Solution Structure Of Amino-Terminal Domain Of Dbp5 8e-27
1q0u_A219 Crystal Structure Of The Bstdead N-Terminal Domain 2e-26
4a4d_A253 Crystal Structure Of The N-Terminal Domain Of The H 5e-26
3fe2_A242 Human Dead-Box Rna Helicase Ddx5 (P68), Conserved D 6e-26
1fuk_A165 Crystal Structure Of The Carboxy Terminal Domain Of 8e-23
3sqw_A 579 Structure Of Mss116p (Nte Deletion) Bound To Ssrna 8e-22
3i5x_A563 Structure Of Mss116p Bound To Ssrna And Amp-Pnp Len 1e-21
3sqx_A512 Structure Of Mss116p (Nte And C-Tail Double Deletio 2e-21
1t5i_A172 Crystal Structure Of The C-Terminal Domain Of Uap56 4e-19
3dkp_A245 Human Dead-Box Rna-Helicase Ddx52, Conserved Domain 7e-18
2hjv_A163 Structure Of The Second Domain (Residues 207-368) O 5e-17
2rb4_A175 Crystal Structure Of The Helicase Domain Of Human D 3e-15
2yjt_D170 Crystal Structure Of E. Coli Dead-Box Protein Srmb 4e-14
3i32_A 300 Dimeric Structure Of A Hera Helicase Fragment Inclu 2e-13
2kbf_A187 Solution Structure Of Carboxyl-Terminal Domain Of D 5e-13
3eaq_A212 Novel Dimerization Motif In The Dead Box Rna Helica 1e-12
3peu_A188 S. Cerevisiae Dbp5 L327v C-Terminal Domain Bound To 2e-12
3gfp_A189 Structure Of The C-Terminal Domain Of The Dead-Box 2e-12
2jgn_A185 Ddx3 Helicase Domain Length = 185 3e-12
2zj2_A 720 Archaeal Dna Helicase Hjm Apo State In Form 1 Lengt 6e-09
1oyy_A 523 Structure Of The Recq Catalytic Core Bound To Atp-G 6e-09
2p6n_A191 Human Dead-box Rna Helicase Ddx41, Helicase Domain 1e-08
1oyw_A 523 Structure Of The Recq Catalytic Core Length = 523 3e-08
2eyq_A 1151 Crystal Structure Of Escherichia Coli Transcription 6e-06
4db4_A256 Mss116p Dead-Box Helicase Domain 2 Bound To A Chima 3e-04
4db2_C257 Mss116p Dead-Box Helicase Domain 2 Bound To An Rna 3e-04
4db2_A257 Mss116p Dead-Box Helicase Domain 2 Bound To An Rna 3e-04
>pdb|1S2M|A Chain A, Crystal Structure Of The Dead Box Protein Dhh1p Length = 400 Back     alignment and structure

Iteration: 1

Score = 523 bits (1347), Expect = e-149, Method: Compositional matrix adjust. Identities = 246/340 (72%), Positives = 289/340 (85%) Query: 106 DTRYRTEDVTATKGNEFEDYFLKRELLMGIFEKGFERPSPIQEESIPIALTGSDILARAK 165 DTR +T+DV TKGN FED++LKRELLMGIFE GFE+PSPIQEE+IP+A+TG DILARAK Sbjct: 7 DTRPQTDDVLNTKGNTFEDFYLKRELLMGIFEAGFEKPSPIQEEAIPVAITGRDILARAK 66 Query: 166 NGTGKTAAFCIPALEKIDQDNNVIQVVILVPTRELALQTSQVCKELGKHLNIQVMVTTGG 225 NGTGKTAAF IP LEK+ N IQ +I+VPTRELALQTSQV + LGKH I MVTTGG Sbjct: 67 NGTGKTAAFVIPTLEKVKPKLNKIQALIMVPTRELALQTSQVVRTLGKHCGISCMVTTGG 126 Query: 226 TSLKDDIMRLYQPVHLLVGTPGRILDLSKKGVCILKDCSMLVMDEADKLLSPEFQPSVEQ 285 T+L+DDI+RL + VH+LVGTPGR+LDL+ + V L DCS+ +MDEADK+LS +F+ +EQ Sbjct: 127 TNLRDDILRLNETVHILVGTPGRVLDLASRKVADLSDCSLFIMDEADKMLSRDFKTIIEQ 186 Query: 286 LIRFLPANRQILMFSATFPVTVKDFKDKYLQKPYVINLMDELTLKGITQYYAFVEERQKV 345 ++ FLP Q L+FSATFP+TVK+F K+L KPY INLM+ELTLKGITQYYAFVEERQK+ Sbjct: 187 ILSFLPPTHQSLLFSATFPLTVKEFMVKHLHKPYEINLMEELTLKGITQYYAFVEERQKL 246 Query: 346 HCLNTLFSKLQINQSIIFCNSVNRVELLAKKITELGYSCFYIHAKMLQDHRNRVFHDFRN 405 HCLNTLFSKLQINQ+IIFCNS NRVELLAKKIT+LGYSC+Y HA+M Q RN+VFH+FR Sbjct: 247 HCLNTLFSKLQINQAIIFCNSTNRVELLAKKITDLGYSCYYSHARMKQQERNKVFHEFRQ 306 Query: 406 GACRNLVCTDLFTRGIDIQAVNVVINFDFPKNSETYLHRV 445 G R LVC+DL TRGIDIQAVNVVINFDFPK +ETYLHR+ Sbjct: 307 GKVRTLVCSDLLTRGIDIQAVNVVINFDFPKTAETYLHRI 346
>pdb|1VEC|A Chain A, Crystal Structure Of The N-Terminal Domain Of RckP54, A Human Dead-Box Protein Length = 206 Back     alignment and structure
>pdb|2XB2|A Chain A, Crystal Structure Of The Core Mago-Y14-Eif4aiii-Barentsz- Upf3b Assembly Shows How The Ejc Is Bridged To The Nmd Machinery Length = 411 Back     alignment and structure
>pdb|2HYI|C Chain C, Structure Of The Human Exon Junction Complex With A Trapped Dead-Box Helicase Bound To Rna Length = 413 Back     alignment and structure
>pdb|2J0Q|A Chain A, The Crystal Structure Of The Exon Junction Complex At 3.2 A Resolution Length = 410 Back     alignment and structure
>pdb|2HXY|A Chain A, Crystal Structure Of Human Apo-Eif4aiii Length = 391 Back     alignment and structure
>pdb|2J0U|B Chain B, The Crystal Structure Of Eif4aiii-Barentsz Complex At 3.0 A Resolution Length = 374 Back     alignment and structure
>pdb|2VSO|A Chain A, Crystal Structure Of A Translation Initiation Complex Length = 395 Back     alignment and structure
>pdb|2J0U|A Chain A, The Crystal Structure Of Eif4aiii-Barentsz Complex At 3.0 A Resolution Length = 374 Back     alignment and structure
>pdb|1FUU|A Chain A, Yeast Initiation Factor 4a Length = 394 Back     alignment and structure
>pdb|3EIQ|A Chain A, Crystal Structure Of Pdcd4-eif4a Length = 414 Back     alignment and structure
>pdb|2WAX|A Chain A, Structure Of The Human Ddx6 C-Terminal Domain In Complex With An Edc3-Fdf Peptide Length = 193 Back     alignment and structure
>pdb|2ZU6|A Chain A, Crystal Structure Of The Eif4a-Pdcd4 Complex Length = 388 Back     alignment and structure
>pdb|1XTK|A Chain A, Structure Of Decd To Dead Mutation Of Human Uap56 Length = 390 Back     alignment and structure
>pdb|1XTJ|A Chain A, Structure Of Human Uap56 In Complex With Adp Length = 386 Back     alignment and structure
>pdb|1XTI|A Chain A, Structure Of Wildtype Human Uap56 Length = 391 Back     alignment and structure
>pdb|3FMP|B Chain B, Crystal Structure Of The Nucleoporin Nup214 In Complex With The Dead- Box Helicase Ddx19 Length = 479 Back     alignment and structure
>pdb|3G0H|A Chain A, Human Dead-box Rna Helicase Ddx19, In Complex With An Atp-analogue And Rna Length = 424 Back     alignment and structure
>pdb|3EWS|A Chain A, Human Dead-Box Rna-Helicase Ddx19 In Complex With Adp Length = 445 Back     alignment and structure
>pdb|3FHT|A Chain A, Crystal Structure Of Human Dbp5 In Complex With Amppnp And Rna Length = 412 Back     alignment and structure
>pdb|1HV8|A Chain A, Crystal Structure Of A Dead Box Protein From The Hyperthermophile Methanococcus Jannaschii Length = 367 Back     alignment and structure
>pdb|3PEW|A Chain A, S. Cerevisiae Dbp5 L327v Bound To Rna And Adp Bef3 Length = 395 Back     alignment and structure
>pdb|3PEY|A Chain A, S. Cerevisiae Dbp5 Bound To Rna And Adp Bef3 Length = 395 Back     alignment and structure
>pdb|2I4I|A Chain A, Crystal Structure Of Human Dead-Box Rna Helicase Ddx3x Length = 417 Back     alignment and structure
>pdb|2DB3|A Chain A, Structural Basis For Rna Unwinding By The Dead-Box Protein Drosophila Vasa Length = 434 Back     alignment and structure
>pdb|2Z0M|A Chain A, Crystal Structure Of Hypothetical Atp-Dependent Rna Helicase From Sulfolobus Tokodaii Length = 337 Back     alignment and structure
>pdb|1QDE|A Chain A, Crystal Structure Of The Atpase Domain Of Translation Initiation Factor 4a From Saccharomyces Cerevisiae-The Prototype Of The Dead Box Protein Family Length = 224 Back     alignment and structure
>pdb|1QVA|A Chain A, Yeast Initiation Factor 4a N-Terminal Domain Length = 223 Back     alignment and structure
>pdb|2GXQ|A Chain A, Hera N-Terminal Domain In Complex With Amp, Crystal Form 1 Length = 207 Back     alignment and structure
>pdb|3MWJ|A Chain A, Q28e Mutant Of Hera N-Terminal Reca-Like Domain, Apo Form Length = 207 Back     alignment and structure
>pdb|2OXC|A Chain A, Human Dead-Box Rna Helicase Ddx20, Dead Domain In Complex With Adp Length = 230 Back     alignment and structure
>pdb|3BOR|A Chain A, Crystal Structure Of The Deadc Domain Of Human Translation Initiation Factor 4a-2 Length = 237 Back     alignment and structure
>pdb|1T6N|A Chain A, Crystal Structure Of The N-Terminal Domain Of Human Uap56 Length = 220 Back     alignment and structure
>pdb|2G9N|A Chain A, Structure Of The Dead Domain Of Human Eukaryotic Initiation Factor 4a, Eif4a Length = 221 Back     alignment and structure
>pdb|2PL3|A Chain A, Human Dead-Box Rna Helicase Ddx10, Dead Domain In Complex With Adp Length = 236 Back     alignment and structure
>pdb|3BER|A Chain A, Human Dead-Box Rna-Helicase Ddx47, Conserved Domain I In Complex With Amp Length = 249 Back     alignment and structure
>pdb|1WRB|A Chain A, Crystal Structure Of The N-Terminal Reca-Like Domain Of Djvlgb, A Pranarian Vasa-Like Rna Helicase Length = 253 Back     alignment and structure
>pdb|3LY5|A Chain A, Ddx18 Dead-Domain Length = 262 Back     alignment and structure
>pdb|3FMO|B Chain B, Crystal Structure Of The Nucleoporin Nup214 In Complex With The Dead- Box Helicase Ddx19 Length = 300 Back     alignment and structure
>pdb|3FHC|B Chain B, Crystal Structure Of Human Dbp5 In Complex With Nup214 Length = 235 Back     alignment and structure
>pdb|3IUY|A Chain A, Crystal Structure Of Ddx53 Dead-Box Domain Length = 228 Back     alignment and structure
>pdb|2KBE|A Chain A, Solution Structure Of Amino-Terminal Domain Of Dbp5p Length = 226 Back     alignment and structure
>pdb|1Q0U|A Chain A, Crystal Structure Of The Bstdead N-Terminal Domain Length = 219 Back     alignment and structure
>pdb|4A4D|A Chain A, Crystal Structure Of The N-Terminal Domain Of The Human Dead-Box Rna Helicase Ddx5 (P68) Length = 253 Back     alignment and structure
>pdb|3FE2|A Chain A, Human Dead-Box Rna Helicase Ddx5 (P68), Conserved Domain I In Complex With Adp Length = 242 Back     alignment and structure
>pdb|1FUK|A Chain A, Crystal Structure Of The Carboxy Terminal Domain Of Yeast Eif4a Length = 165 Back     alignment and structure
>pdb|3SQW|A Chain A, Structure Of Mss116p (Nte Deletion) Bound To Ssrna And Amp-Pnp Length = 579 Back     alignment and structure
>pdb|3I5X|A Chain A, Structure Of Mss116p Bound To Ssrna And Amp-Pnp Length = 563 Back     alignment and structure
>pdb|3SQX|A Chain A, Structure Of Mss116p (Nte And C-Tail Double Deletion) Bound To Ssrna And Amp-Pnp Length = 512 Back     alignment and structure
>pdb|1T5I|A Chain A, Crystal Structure Of The C-Terminal Domain Of Uap56 Length = 172 Back     alignment and structure
>pdb|3DKP|A Chain A, Human Dead-Box Rna-Helicase Ddx52, Conserved Domain I In Complex With Adp Length = 245 Back     alignment and structure
>pdb|2HJV|A Chain A, Structure Of The Second Domain (Residues 207-368) Of The Bacillus Subtilis Yxin Protein Length = 163 Back     alignment and structure
>pdb|2RB4|A Chain A, Crystal Structure Of The Helicase Domain Of Human Ddx25 Rna Helicase Length = 175 Back     alignment and structure
>pdb|2YJT|D Chain D, Crystal Structure Of E. Coli Dead-Box Protein Srmb Bound To Regulator Of Ribonuclease Activity A (Rraa) Length = 170 Back     alignment and structure
>pdb|3I32|A Chain A, Dimeric Structure Of A Hera Helicase Fragment Including The C-Terminal Reca Domain, The Dimerization Domain, And The Rna Binding Domain Length = 300 Back     alignment and structure
>pdb|2KBF|A Chain A, Solution Structure Of Carboxyl-Terminal Domain Of Dbp5p Length = 187 Back     alignment and structure
>pdb|3EAQ|A Chain A, Novel Dimerization Motif In The Dead Box Rna Helicase Hera Form 2, Complete Dimer, Symmetric Length = 212 Back     alignment and structure
>pdb|3PEU|A Chain A, S. Cerevisiae Dbp5 L327v C-Terminal Domain Bound To Gle1 H337r And Ip6 Length = 188 Back     alignment and structure
>pdb|3GFP|A Chain A, Structure Of The C-Terminal Domain Of The Dead-Box Protein Dbp5 Length = 189 Back     alignment and structure
>pdb|2JGN|A Chain A, Ddx3 Helicase Domain Length = 185 Back     alignment and structure
>pdb|2ZJ2|A Chain A, Archaeal Dna Helicase Hjm Apo State In Form 1 Length = 720 Back     alignment and structure
>pdb|1OYY|A Chain A, Structure Of The Recq Catalytic Core Bound To Atp-Gamma-S Length = 523 Back     alignment and structure
>pdb|2P6N|A Chain A, Human Dead-box Rna Helicase Ddx41, Helicase Domain Length = 191 Back     alignment and structure
>pdb|1OYW|A Chain A, Structure Of The Recq Catalytic Core Length = 523 Back     alignment and structure
>pdb|2EYQ|A Chain A, Crystal Structure Of Escherichia Coli Transcription-Repair Coupling Factor Length = 1151 Back     alignment and structure
>pdb|4DB4|A Chain A, Mss116p Dead-Box Helicase Domain 2 Bound To A Chimaeric Rna-Dna Duplex Length = 256 Back     alignment and structure
>pdb|4DB2|C Chain C, Mss116p Dead-Box Helicase Domain 2 Bound To An Rna Duplex Length = 257 Back     alignment and structure
>pdb|4DB2|A Chain A, Mss116p Dead-Box Helicase Domain 2 Bound To An Rna Duplex Length = 257 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query485
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 0.0
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 0.0
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 0.0
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 0.0
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 1e-177
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 1e-159
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 1e-155
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 1e-121
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 1e-118
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 1e-115
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 1e-115
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 1e-107
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 1e-105
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 1e-103
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 5e-99
3bor_A237 Human initiation factor 4A-II; translation initiat 3e-95
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 7e-93
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 9e-93
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 1e-92
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 3e-89
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 6e-79
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 5e-75
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 2e-74
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 3e-73
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 3e-72
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 2e-70
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 4e-69
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 2e-67
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 4e-62
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 4e-62
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 5e-62
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 1e-61
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 4e-60
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 6e-59
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 7e-40
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 5e-30
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 2e-28
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 3e-27
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 2e-26
3i32_A 300 Heat resistant RNA dependent ATPase; RNA helicase, 6e-25
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 3e-19
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 4e-19
1wp9_A 494 ATP-dependent RNA helicase, putative; ATPase, DNA 2e-15
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 1e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-07
3b6e_A216 Interferon-induced helicase C domain-containing P; 3e-12
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 4e-12
3o8b_A 666 HCV NS3 protease/helicase; ntpase, RNA, translocat 4e-12
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 8e-11
3tbk_A 555 RIG-I helicase domain; DECH helicase, ATP binding, 4e-10
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 1e-06
4a2q_A 797 RIG-I, retinoic acid inducible protein I; hydrolas 4e-10
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 9e-07
4a2p_A 556 RIG-I, retinoic acid inducible protein I; hydrolas 1e-09
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 6e-07
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 2e-09
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 5e-09
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 7e-09
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 7e-09
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 5e-07
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 4e-08
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 4e-08
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 2e-05
3h1t_A590 Type I site-specific restriction-modification syst 9e-05
2jlq_A 451 Serine protease subunit NS3; ribonucleoprotein, nu 9e-05
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 2e-04
1yks_A 440 Genome polyprotein [contains: flavivirin protease 6e-04
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Length = 400 Back     alignment and structure
 Score =  593 bits (1530), Expect = 0.0
 Identities = 246/344 (71%), Positives = 290/344 (84%)

Query: 102 IPPADTRYRTEDVTATKGNEFEDYFLKRELLMGIFEKGFERPSPIQEESIPIALTGSDIL 161
           +   DTR +T+DV  TKGN FED++LKRELLMGIFE GFE+PSPIQEE+IP+A+TG DIL
Sbjct: 3   LGSKDTRPQTDDVLNTKGNTFEDFYLKRELLMGIFEAGFEKPSPIQEEAIPVAITGRDIL 62

Query: 162 ARAKNGTGKTAAFCIPALEKIDQDNNVIQVVILVPTRELALQTSQVCKELGKHLNIQVMV 221
           ARAKNGTGKTAAF IP LEK+    N IQ +I+VPTRELALQTSQV + LGKH  I  MV
Sbjct: 63  ARAKNGTGKTAAFVIPTLEKVKPKLNKIQALIMVPTRELALQTSQVVRTLGKHCGISCMV 122

Query: 222 TTGGTSLKDDIMRLYQPVHLLVGTPGRILDLSKKGVCILKDCSMLVMDEADKLLSPEFQP 281
           TTGGT+L+DDI+RL + VH+LVGTPGR+LDL+ + V  L DCS+ +MDEADK+LS +F+ 
Sbjct: 123 TTGGTNLRDDILRLNETVHILVGTPGRVLDLASRKVADLSDCSLFIMDEADKMLSRDFKT 182

Query: 282 SVEQLIRFLPANRQILMFSATFPVTVKDFKDKYLQKPYVINLMDELTLKGITQYYAFVEE 341
            +EQ++ FLP   Q L+FSATFP+TVK+F  K+L KPY INLM+ELTLKGITQYYAFVEE
Sbjct: 183 IIEQILSFLPPTHQSLLFSATFPLTVKEFMVKHLHKPYEINLMEELTLKGITQYYAFVEE 242

Query: 342 RQKVHCLNTLFSKLQINQSIIFCNSVNRVELLAKKITELGYSCFYIHAKMLQDHRNRVFH 401
           RQK+HCLNTLFSKLQINQ+IIFCNS NRVELLAKKIT+LGYSC+Y HA+M Q  RN+VFH
Sbjct: 243 RQKLHCLNTLFSKLQINQAIIFCNSTNRVELLAKKITDLGYSCYYSHARMKQQERNKVFH 302

Query: 402 DFRNGACRNLVCTDLFTRGIDIQAVNVVINFDFPKNSETYLHRV 445
           +FR G  R LVC+DL TRGIDIQAVNVVINFDFPK +ETYLHR+
Sbjct: 303 EFRQGKVRTLVCSDLLTRGIDIQAVNVVINFDFPKTAETYLHRI 346


>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Length = 414 Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Length = 410 Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Length = 394 Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Length = 391 Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Length = 479 Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Length = 412 Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Length = 395 Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Length = 230 Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Length = 206 Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* Length = 563 Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Length = 579 Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Length = 367 Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Length = 337 Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Length = 237 Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Length = 300 Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Length = 224 Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Length = 434 Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Length = 417 Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Length = 414 Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Length = 220 Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Length = 249 Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Length = 219 Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Length = 236 Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Length = 262 Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Length = 207 Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Length = 172 Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Length = 245 Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Length = 165 Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} Length = 242 Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Length = 228 Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Length = 175 Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Length = 253 Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Length = 163 Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Length = 170 Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Length = 191 Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Length = 185 Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Length = 212 Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Length = 300 Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Length = 702 Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Length = 720 Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Length = 494 Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Length = 494 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Length = 216 Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Length = 472 Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4a92_A* 1cu1_A 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A 8ohm_A 2f55_A 1jr6_A 1onb_A Length = 666 Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Length = 715 Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Length = 555 Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Length = 555 Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Length = 797 Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Length = 797 Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Length = 556 Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Length = 556 Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Length = 968 Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Length = 591 Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Length = 523 Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Length = 936 Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Length = 936 Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Length = 696 Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Length = 696 Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Length = 1010 Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Length = 590 Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Length = 451 Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Length = 1108 Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Length = 440 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query485
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 100.0
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 100.0
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 100.0
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 100.0
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 100.0
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 100.0
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 100.0
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 100.0
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 100.0
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 100.0
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 100.0
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 100.0
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 100.0
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 100.0
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 100.0
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 100.0
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 100.0
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 100.0
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 100.0
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 100.0
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 100.0
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 100.0
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 100.0
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 100.0
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 100.0
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 100.0
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 100.0
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 100.0
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 100.0
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 100.0
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 100.0
4gl2_A 699 Interferon-induced helicase C domain-containing P; 100.0
1tf5_A 844 Preprotein translocase SECA subunit; ATPase, helic 100.0
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 100.0
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 100.0
2fsf_A 853 Preprotein translocase SECA subunit; ATPase, DNA-R 100.0
1gm5_A780 RECG; helicase, replication restart; HET: DNA ADP; 100.0
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 100.0
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 100.0
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 100.0
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 100.0
1nkt_A 922 Preprotein translocase SECA 1 subunit; preprotein 100.0
2jlq_A 451 Serine protease subunit NS3; ribonucleoprotein, nu 100.0
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 100.0
2whx_A 618 Serine protease/ntpase/helicase NS3; transcription 100.0
3o8b_A 666 HCV NS3 protease/helicase; ntpase, RNA, translocat 100.0
1yks_A 440 Genome polyprotein [contains: flavivirin protease 100.0
2wv9_A 673 Flavivirin protease NS2B regulatory subunit, FLAV 100.0
2z83_A 459 Helicase/nucleoside triphosphatase; hydrolase, mem 100.0
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 100.0
2v6i_A 431 RNA helicase; membrane, hydrolase, transmembrane, 100.0
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 100.0
3rc3_A 677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 100.0
3h1t_A590 Type I site-specific restriction-modification syst 100.0
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 100.0
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 100.0
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 100.0
3bor_A237 Human initiation factor 4A-II; translation initiat 100.0
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 100.0
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 100.0
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 100.0
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 100.0
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 100.0
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 100.0
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 100.0
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 100.0
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 100.0
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 100.0
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 100.0
3jux_A 822 Protein translocase subunit SECA; protein transloc 100.0
1z3i_X644 Similar to RAD54-like; recombination ATPase helica 99.98
2w00_A 1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 99.98
3mwy_W800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 99.98
2ipc_A 997 Preprotein translocase SECA subunit; nucleotide bi 99.96
1c4o_A664 DNA nucleotide excision repair enzyme UVRB; uvrabc 99.95
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 99.93
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 99.93
2d7d_A661 Uvrabc system protein B; helicase, protein-DNA-ADP 99.93
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 99.93
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 99.92
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 99.92
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 99.92
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 99.91
3b6e_A216 Interferon-induced helicase C domain-containing P; 99.91
3i32_A 300 Heat resistant RNA dependent ATPase; RNA helicase, 99.91
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 99.89
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 99.81
2vl7_A540 XPD; helicase, unknown function; 2.25A {Sulfolobus 99.87
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 99.87
3crv_A 551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 99.83
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 99.8
4a15_A 620 XPD helicase, ATP-dependent DNA helicase TA0057; h 99.74
1z5z_A271 Helicase of the SNF2/RAD54 family; hydrolase, reco 99.74
1w36_D 608 RECD, exodeoxyribonuclease V alpha chain; recombin 98.91
3upu_A 459 ATP-dependent DNA helicase DDA; RECA-like domain, 98.55
4b3f_X 646 DNA-binding protein smubp-2; hydrolase, helicase; 98.33
3e1s_A574 Exodeoxyribonuclease V, subunit RECD; alpha and be 98.32
2gk6_A 624 Regulator of nonsense transcripts 1; UPF1, helicas 98.23
2xzl_A 802 ATP-dependent helicase NAM7; hydrolase-RNA complex 98.16
3lfu_A 647 DNA helicase II; SF1 helicase, ATP-binding, DNA da 98.09
2wjy_A 800 Regulator of nonsense transcripts 1; nonsense medi 98.08
3hgt_A328 HDA1 complex subunit 3; RECA-like domain, SWI2/SNF 97.51
2o0j_A385 Terminase, DNA packaging protein GP17; nucleotide- 97.51
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 97.38
3vkw_A446 Replicase large subunit; alpha/beta domain, helica 97.25
3cpe_A592 Terminase, DNA packaging protein GP17; large termi 97.2
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 97.19
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 97.15
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 97.15
2j9r_A214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 97.03
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 96.91
2orv_A234 Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 96.78
2kjq_A149 DNAA-related protein; solution structure, NESG, st 96.7
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 96.65
2chg_A226 Replication factor C small subunit; DNA-binding pr 96.64
3e2i_A219 Thymidine kinase; Zn-binding, ATP-binding, DNA syn 96.59
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 96.58
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 96.48
1uaa_A 673 REP helicase, protein (ATP-dependent DNA helicase 96.46
3bos_A242 Putative DNA replication factor; P-loop containing 96.46
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 96.45
2zpa_A 671 Uncharacterized protein YPFI; RNA modification enz 96.42
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 96.33
2v1u_A387 Cell division control protein 6 homolog; DNA repli 96.28
1w4r_A195 Thymidine kinase; type II, human, cytosolic, phosp 96.28
3co5_A143 Putative two-component system transcriptional RES 96.23
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 96.21
3u4q_A 1232 ATP-dependent helicase/nuclease subunit A; helicas 96.11
1pjr_A 724 PCRA; DNA repair, DNA replication, SOS response, h 96.1
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 96.04
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 95.94
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 95.84
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 95.84
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 95.78
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 95.72
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 95.62
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 95.58
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 95.54
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 95.48
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 95.46
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 95.45
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 95.42
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 95.37
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 95.29
2gno_A305 DNA polymerase III, gamma subunit-related protein; 95.19
2qgz_A308 Helicase loader, putative primosome component; str 95.17
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 95.16
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 95.1
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 94.99
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 94.62
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 94.51
1gm5_A 780 RECG; helicase, replication restart; HET: DNA ADP; 94.37
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 94.34
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 94.26
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 94.03
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 93.99
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 93.95
3k1j_A 604 LON protease, ATP-dependent protease LON; ATP-bind 93.91
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 93.91
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 93.78
2chq_A319 Replication factor C small subunit; DNA-binding pr 93.69
3pvs_A447 Replication-associated recombination protein A; ma 93.45
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 93.42
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 93.37
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 93.16
3oiy_A 414 Reverse gyrase helicase domain; topoisomerase, DNA 92.92
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 92.78
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 92.72
1vma_A306 Cell division protein FTSY; TM0570, structural gen 92.62
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 91.94
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 91.78
2r6a_A454 DNAB helicase, replicative helicase; replication, 91.61
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 91.47
2fna_A357 Conserved hypothetical protein; structural genomic 91.34
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 90.96
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 90.96
2v3c_C432 SRP54, signal recognition 54 kDa protein; nucleoti 90.79
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 90.44
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 90.43
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 90.17
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 89.79
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 89.7
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 89.68
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 89.34
2ffh_A425 Protein (FFH); SRP54, signal recognition particle, 89.31
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 89.26
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 88.95
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 88.72
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 88.48
2l8b_A189 Protein TRAI, DNA helicase I; RECD, hydrolase; NMR 88.08
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 88.05
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 88.04
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 88.03
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 87.99
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 87.93
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 87.93
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 87.45
4a1f_A338 DNAB helicase, replicative DNA helicase; hydrolase 87.41
1p9r_A418 General secretion pathway protein E; bacterial typ 87.37
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 87.13
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 86.97
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 86.85
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 86.53
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 86.47
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 86.25
2oap_1511 GSPE-2, type II secretion system protein; hexameri 86.19
2j37_W504 Signal recognition particle 54 kDa protein (SRP54) 86.1
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 85.97
3bor_A237 Human initiation factor 4A-II; translation initiat 85.0
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 84.96
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 84.77
3hjh_A483 Transcription-repair-coupling factor; MFD, mutatio 84.33
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 84.14
1xti_A 391 Probable ATP-dependent RNA helicase P47; alpha-bet 84.07
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 83.78
1e9r_A437 Conjugal transfer protein TRWB; coupling protein, 83.76
2ewv_A372 Twitching motility protein PILT; pilus retraction 83.7
2eyu_A261 Twitching motility protein PILT; pilus retraction 83.63
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 83.54
3vaa_A199 Shikimate kinase, SK; structural genomics, center 83.49
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 83.49
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 83.46
4f4c_A1321 Multidrug resistance protein PGP-1; ABC transporte 83.43
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 83.15
3a8t_A339 Adenylate isopentenyltransferase; rossmann fold pr 83.03
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 82.8
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 82.69
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 82.55
2xxa_A433 Signal recognition particle protein; protein trans 82.24
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 82.11
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 82.08
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 81.98
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 81.89
2qmh_A205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 81.79
3exa_A322 TRNA delta(2)-isopentenylpyrophosphate transferase 81.72
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 81.64
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 81.53
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 81.53
3foz_A316 TRNA delta(2)-isopentenylpyrophosphate transferas; 81.23
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 81.22
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 80.9
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 80.85
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 80.77
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 80.76
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 80.75
2ius_A512 DNA translocase FTSK; nucleotide-binding, chromoso 80.73
3hws_A363 ATP-dependent CLP protease ATP-binding subunit CL; 80.68
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 80.68
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 80.6
3sqw_A579 ATP-dependent RNA helicase MSS116, mitochondrial; 80.58
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 80.45
3nbx_X 500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 80.42
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 80.28
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 80.25
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 80.25
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 80.17
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 80.13
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 80.13
1kag_A173 SKI, shikimate kinase I; transferase, structural g 80.04
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
Probab=100.00  E-value=2.7e-59  Score=472.38  Aligned_cols=360  Identities=28%  Similarity=0.460  Sum_probs=319.2

Q ss_pred             CCCCcccccCCCHHHHHHHHHcCCCCCcHHHHHHHHHHhcCCCEEEEccCCCchhHHhHHHHHhhhhccC-----CceEE
Q 011446          117 TKGNEFEDYFLKRELLMGIFEKGFERPSPIQEESIPIALTGSDILARAKNGTGKTAAFCIPALEKIDQDN-----NVIQV  191 (485)
Q Consensus       117 ~~~~~~~~~~l~~~l~~~l~~~~~~~~~~~Q~~~i~~i~~~~~~ii~~~TGsGKT~~~~~~~l~~l~~~~-----~~~~~  191 (485)
                      .+...|+++++++.+++++.+.||..|+|+|.++|+.+++++|+++++|||||||++|++|++..+....     .++++
T Consensus        53 ~~~~~f~~~~l~~~l~~~l~~~g~~~pt~iQ~~ai~~i~~g~d~i~~a~TGsGKT~a~~lpil~~l~~~~~~~~~~~~~~  132 (434)
T 2db3_A           53 QPIQHFTSADLRDIIIDNVNKSGYKIPTPIQKCSIPVISSGRDLMACAQTGSGKTAAFLLPILSKLLEDPHELELGRPQV  132 (434)
T ss_dssp             CCCCCGGGSCCCHHHHHHHHHTTCCSCCHHHHHHHHHHHTTCCEEEECCTTSSHHHHHHHHHHHHHHHSCCCCCTTCCSE
T ss_pred             CCcCChhhcCCCHHHHHHHHHcCCCCCCHHHHHHHHHHhcCCCEEEECCCCCCchHHHHHHHHHHHHhcccccccCCccE
Confidence            3456799999999999999999999999999999999999999999999999999999999999886533     35689


Q ss_pred             EEEcCcHHHHHHHHHHHHHHhccCCceEEEEECCCChHHHHHHhcCCCeEEEEcchHHHHhhhcCccccCCcceEEeecc
Q 011446          192 VILVPTRELALQTSQVCKELGKHLNIQVMVTTGGTSLKDDIMRLYQPVHLLVGTPGRILDLSKKGVCILKDCSMLVMDEA  271 (485)
Q Consensus       192 lil~P~~~la~q~~~~~~~~~~~~~~~v~~~~g~~~~~~~~~~~~~~~~Ili~Tp~~l~~~~~~~~~~l~~~~~iViDEa  271 (485)
                      ||++||++|+.|+++.+++++...++++..++|+.....+...+..+++|+|+||++|.+++.+....+.++++||+|||
T Consensus       133 lil~PtreLa~Q~~~~~~~~~~~~~~~~~~~~gg~~~~~~~~~l~~~~~Ivv~Tp~~l~~~l~~~~~~l~~~~~lVlDEa  212 (434)
T 2db3_A          133 VIVSPTRELAIQIFNEARKFAFESYLKIGIVYGGTSFRHQNECITRGCHVVIATPGRLLDFVDRTFITFEDTRFVVLDEA  212 (434)
T ss_dssp             EEECSSHHHHHHHHHHHHHHTTTSSCCCCEECTTSCHHHHHHHHTTCCSEEEECHHHHHHHHHTTSCCCTTCCEEEEETH
T ss_pred             EEEecCHHHHHHHHHHHHHHhccCCcEEEEEECCCCHHHHHHHhhcCCCEEEEChHHHHHHHHhCCcccccCCeEEEccH
Confidence            99999999999999999999988889999999999988888888889999999999999999888778999999999999


Q ss_pred             ccccCCCCHHHHHHHHHhC--CCCCcEEEEecccchHHHHHHHHhcCCCeEEeecc-ccccccceEEEEeehhhhhHHHH
Q 011446          272 DKLLSPEFQPSVEQLIRFL--PANRQILMFSATFPVTVKDFKDKYLQKPYVINLMD-ELTLKGITQYYAFVEERQKVHCL  348 (485)
Q Consensus       272 h~~~~~~~~~~~~~i~~~~--~~~~~~i~~SATl~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~l  348 (485)
                      |++++.+|...+..++..+  +++.|++++|||+|..+..+...++.++..+.+.. .....++.+.+..+....+...+
T Consensus       213 h~~~~~gf~~~~~~i~~~~~~~~~~q~l~~SAT~~~~~~~~~~~~l~~~~~i~~~~~~~~~~~i~~~~~~~~~~~k~~~l  292 (434)
T 2db3_A          213 DRMLDMGFSEDMRRIMTHVTMRPEHQTLMFSATFPEEIQRMAGEFLKNYVFVAIGIVGGACSDVKQTIYEVNKYAKRSKL  292 (434)
T ss_dssp             HHHTSTTTHHHHHHHHHCTTSCSSCEEEEEESCCCHHHHHHHHTTCSSCEEEEESSTTCCCTTEEEEEEECCGGGHHHHH
T ss_pred             hhhhccCcHHHHHHHHHhcCCCCCceEEEEeccCCHHHHHHHHHhccCCEEEEeccccccccccceEEEEeCcHHHHHHH
Confidence            9999999999999999875  67899999999999999999999999887766543 23345667777777788888888


Q ss_pred             HHHHHhcCCCcEEEEecChhHHHHHHHHHHHcCCeEEEEcCCCCHHHHHHHHHHHhcCCccEEEEccccccCCCCCCCCE
Q 011446          349 NTLFSKLQINQSIIFCNSVNRVELLAKKITELGYSCFYIHAKMLQDHRNRVFHDFRNGACRNLVCTDLFTRGIDIQAVNV  428 (485)
Q Consensus       349 ~~l~~~~~~~~~lVf~~~~~~~~~l~~~L~~~~~~~~~~h~~~~~~~r~~i~~~f~~g~~~vlvaT~~~~~Gidi~~v~~  428 (485)
                      ..++.....+ +||||++++.|+.+++.|...++.+..+||++++.+|..+++.|++|+.+|||||+++++|+|+|++++
T Consensus       293 ~~~l~~~~~~-~lVF~~t~~~a~~l~~~L~~~~~~~~~lhg~~~~~~R~~~l~~F~~g~~~vLvaT~v~~rGlDi~~v~~  371 (434)
T 2db3_A          293 IEILSEQADG-TIVFVETKRGADFLASFLSEKEFPTTSIHGDRLQSQREQALRDFKNGSMKVLIATSVASRGLDIKNIKH  371 (434)
T ss_dssp             HHHHHHCCTT-EEEECSSHHHHHHHHHHHHHTTCCEEEESTTSCHHHHHHHHHHHHTSSCSEEEECGGGTSSCCCTTCCE
T ss_pred             HHHHHhCCCC-EEEEEeCcHHHHHHHHHHHhCCCCEEEEeCCCCHHHHHHHHHHHHcCCCcEEEEchhhhCCCCcccCCE
Confidence            8888876644 999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEEcCCCCChHHHHHHhhhccccCcccccc--------hHHHHHHHHHhhccccccC
Q 011446          429 VINFDFPKNSETYLHRVCWIQLSFSLSLPN--------LQFMCSMLMYICFTDRLVD  477 (485)
Q Consensus       429 VI~~~~p~s~~~~~Qr~GRagR~g~~~~~~--------~~~~~~~~~~~~~~~~~~~  477 (485)
                      ||+||+|.+.++|+||+||+||.|+.|...        ......+.+.+......++
T Consensus       372 VI~~d~p~~~~~y~qriGR~gR~g~~G~a~~~~~~~~~~~~~~~l~~~l~~~~~~vp  428 (434)
T 2db3_A          372 VINYDMPSKIDDYVHRIGRTGRVGNNGRATSFFDPEKDRAIAADLVKILEGSGQTVP  428 (434)
T ss_dssp             EEESSCCSSHHHHHHHHTTSSCTTCCEEEEEEECTTTCGGGHHHHHHHHHHTTCCCC
T ss_pred             EEEECCCCCHHHHHHHhcccccCCCCCEEEEEEeccccHHHHHHHHHHHHHcCCCCC
Confidence            999999999999999999999998866532        2234445555555444444



>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Back     alignment and structure
>3hgt_A HDA1 complex subunit 3; RECA-like domain, SWI2/SNF2 helical domain, chromatin regulator, coiled coil, nucleus, repressor, transcription; 2.20A {Saccharomyces cerevisiae} PDB: 3hgq_A Back     alignment and structure
>2o0j_A Terminase, DNA packaging protein GP17; nucleotide-binding fold, hydrolase; HET: DNA ADP; 1.80A {Enterobacteria phage T4} PDB: 2o0h_A* 2o0k_A* Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Back     alignment and structure
>3cpe_A Terminase, DNA packaging protein GP17; large terminase, alternative initiation, ATP-binding, DNA- binding, hydrolase, nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB: 3ezk_A* Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>1uaa_A REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>2zpa_A Uncharacterized protein YPFI; RNA modification enzyme, RNA helicase, acetyltransferase, GCN5 acetyltransferase; HET: ACO ADP; 2.35A {Escherichia coli K12} Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>3u4q_A ATP-dependent helicase/nuclease subunit A; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_A* Back     alignment and structure
>1pjr_A PCRA; DNA repair, DNA replication, SOS response, helicase, ATP- binding, DNA-binding; 2.50A {Geobacillus stearothermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1qhg_A* 3pjr_A* 2pjr_A* 1qhh_B* 1qhh_D* 1qhh_A* 1qhh_C* 2pjr_B* Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>2l8b_A Protein TRAI, DNA helicase I; RECD, hydrolase; NMR {Escherichia coli} Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3hjh_A Transcription-repair-coupling factor; MFD, mutation frequency decline, ATP-binding, DNA DAMA repair, DNA-binding, helicase, hydrolase; 1.95A {Escherichia coli} PDB: 2b2n_A* 4dfc_A Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>1e9r_A Conjugal transfer protein TRWB; coupling protein, bacterial conjugation, F1-ATPase-like quaternary structure, ring helicases; 2.4A {Escherichia coli} SCOP: c.37.1.11 PDB: 1e9s_A 1gki_A* 1gl7_A* 1gl6_A* Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A* Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 485
d1hv8a1208 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase 9e-46
d1veca_206 c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Huma 7e-44
d2j0sa1222 c.37.1.19 (A:22-243) Probable ATP-dependent RNA he 5e-43
d1t6na_207 c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP5 4e-42
d1qdea_212 c.37.1.19 (A:) Initiation factor 4a {Baker's yeast 3e-41
d1s2ma1206 c.37.1.19 (A:46-251) Putative ATP-dependent RNA he 4e-41
d2g9na1218 c.37.1.19 (A:21-238) Initiation factor 4a {Human ( 4e-41
d1wrba1238 c.37.1.19 (A:164-401) putative ATP-dependent RNA h 4e-37
d1gkub1237 c.37.1.16 (B:1-250) Helicase-like "domain" of reve 2e-33
d2bmfa2305 c.37.1.14 (A:178-482) Dengue virus helicase {Dengu 2e-30
d1q0ua_209 c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR 1e-29
d1oywa2206 c.37.1.19 (A:1-206) RecQ helicase domain {Escheric 3e-24
d2p6ra3202 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus 3e-22
d2j0sa2168 c.37.1.19 (A:244-411) Probable ATP-dependent RNA h 8e-22
d1a1va2 299 c.37.1.14 (A:326-624) HCV helicase domain {Human h 5e-21
d1fuka_162 c.37.1.19 (A:) Initiation factor 4a {Baker's yeast 3e-19
d1wp9a2286 c.37.1.19 (A:201-486) putative ATP-dependent RNA h 2e-18
d1s2ma2171 c.37.1.19 (A:252-422) Putative ATP-dependent RNA h 2e-17
d1wp9a1200 c.37.1.19 (A:1-200) putative ATP-dependent RNA hel 1e-15
d1hv8a2155 c.37.1.19 (A:211-365) Putative DEAD box RNA helica 3e-15
d2rb4a1168 c.37.1.19 (A:307-474) ATP-dependent RNA helicase D 4e-14
d1oywa3200 c.37.1.19 (A:207-406) RecQ helicase domain {Escher 1e-13
d1jr6a_138 c.37.1.14 (A:) HCV helicase domain {Human hepatiti 1e-13
d1t5la2181 c.37.1.19 (A:415-595) Nucleotide excision repair e 6e-13
d1gkub2248 c.37.1.16 (B:251-498) Helicase-like "domain" of re 1e-12
d2fwra1200 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Ar 2e-12
d1c4oa2174 c.37.1.19 (A:410-583) Nucleotide excision repair e 5e-11
d1t5ia_168 c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP5 2e-10
d1gm5a4206 c.37.1.19 (A:550-755) RecG helicase domain {Thermo 1e-08
d1yksa2 299 c.37.1.14 (A:325-623) YFV helicase domain {Yellow 1e-05
d2p6ra4201 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglob 7e-05
d2fz4a1206 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Arc 1e-04
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 208 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Putative DEAD box RNA helicase
species: Archaeon Methanococcus jannaschii [TaxId: 2190]
 Score =  156 bits (396), Expect = 9e-46
 Identities = 73/203 (35%), Positives = 122/203 (60%), Gaps = 3/203 (1%)

Query: 122 FEDYFLKRELLMGIFEKGFERPSPIQEESIPIALTG-SDILARAKNGTGKTAAFCIPALE 180
           F +  L   +L  I  KGFE+P+ IQ + IP+ L    +I+A+A+ G+GKTA+F IP +E
Sbjct: 6   FNELNLSDNILNAIRNKGFEKPTDIQMKVIPLFLNDEYNIVAQARTGSGKTASFAIPLIE 65

Query: 181 KIDQDNNVIQVVILVPTRELALQTSQVCKELGKHLNIQVMVTTGGTSLKDDIMRLYQPVH 240
            ++++N  I+ +IL PTRELA+Q +   + L  + N+++    GG ++   I  L +  +
Sbjct: 66  LVNENNG-IEAIILTPTRELAIQVADEIESLKGNKNLKIAKIYGGKAIYPQIKAL-KNAN 123

Query: 241 LLVGTPGRILDLSKKGVCILKDCSMLVMDEADKLLSPEFQPSVEQLIRFLPANRQILMFS 300
           ++VGTPGRILD   +G   LK+    ++DEAD++L+  F   VE+++     +++IL+FS
Sbjct: 124 IVVGTPGRILDHINRGTLNLKNVKYFILDEADEMLNMGFIKDVEKILNACNKDKRILLFS 183

Query: 301 ATFPVTVKDFKDKYLQKPYVINL 323
           AT P  + +   KY+     I  
Sbjct: 184 ATMPREILNLAKKYMGDYSFIKA 206


>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Length = 206 Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Length = 222 Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Length = 207 Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 212 Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 206 Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Length = 218 Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Length = 238 Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 237 Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Length = 209 Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Length = 206 Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 202 Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Length = 168 Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 299 Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 162 Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 286 Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 171 Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 200 Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 155 Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Length = 200 Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 138 Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Length = 181 Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 248 Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 200 Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Length = 174 Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Length = 168 Back     information, alignment and structure
>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Length = 206 Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Length = 299 Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 201 Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 206 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query485
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 100.0
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 100.0
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 100.0
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 100.0
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 100.0
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 100.0
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 100.0
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 100.0
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 100.0
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 100.0
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 99.95
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.95
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.95
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.94
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 99.94
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 99.94
d1oywa3200 RecQ helicase domain {Escherichia coli [TaxId: 562 99.94
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 99.94
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.94
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 99.93
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 99.91
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 99.91
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.91
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 99.86
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 99.79
d1wp9a2286 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.79
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 99.77
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 99.76
d2p6ra4201 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.76
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.75
d2fwra1200 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.74
d1a1va2 299 HCV helicase domain {Human hepatitis C virus (HCV) 99.74
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 99.73
d1gkub2248 Helicase-like "domain" of reverse gyrase {Archaeon 99.72
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 99.68
d1gm5a4206 RecG helicase domain {Thermotoga maritima [TaxId: 99.64
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 99.64
d1yksa2 299 YFV helicase domain {Yellow fever virus [TaxId: 11 99.55
d1z3ix1346 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 99.44
d1z5za1244 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 99.38
d1z3ix2298 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 99.38
d1z63a1230 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 99.29
d1tf5a4175 Translocation ATPase SecA, nucleotide-binding doma 99.17
d1tf5a3273 Translocation ATPase SecA, nucleotide-binding doma 98.89
d1nkta3288 Translocation ATPase SecA, nucleotide-binding doma 98.75
d1nkta4219 Translocation ATPase SecA, nucleotide-binding doma 98.59
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 98.31
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 97.57
d1ls1a2207 GTPase domain of the signal sequence recognition p 97.52
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 97.44
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 97.27
d2qy9a2211 GTPase domain of the signal recognition particle r 97.11
d1okkd2207 GTPase domain of the signal recognition particle r 97.11
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 96.98
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 96.87
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 96.82
d1vmaa2213 GTPase domain of the signal recognition particle r 96.81
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 96.76
d1j8yf2211 GTPase domain of the signal sequence recognition p 96.74
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 96.67
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 96.58
g1qhh.1 623 DEXX box DNA helicase {Bacillus stearothermophilus 96.57
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 96.47
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 96.4
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 96.15
d2b8ta1139 Thymidine kinase, TK1, N-terminal domain {Ureaplas 96.13
d1t5la1413 Nucleotide excision repair enzyme UvrB {Bacillus c 95.85
d1xx6a1141 Thymidine kinase, TK1, N-terminal domain {Clostrid 95.82
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 95.42
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 95.39
d1xbta1133 Thymidine kinase, TK1, N-terminal domain {Human (H 95.16
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 95.05
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 94.89
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 94.55
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 94.51
d1g5ta_157 ATP:corrinoid adenosyltransferase CobA {Salmonella 93.8
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 93.45
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 93.11
d1c4oa1408 Nucleotide excision repair enzyme UvrB {Thermus th 92.67
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 92.53
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 91.37
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 91.19
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 90.95
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 90.83
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 90.5
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 90.38
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 90.19
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 90.08
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 90.02
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 89.89
d2hyda1255 Putative multidrug export ATP-binding/permease pro 89.82
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 89.66
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 88.89
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 88.8
d1e9ra_433 Bacterial conjugative coupling protein TrwB {Esche 88.76
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 88.59
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 88.46
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 88.42
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 87.77
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 87.5
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 87.32
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 87.05
d1oywa3200 RecQ helicase domain {Escherichia coli [TaxId: 562 86.83
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 86.56
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 86.55
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 86.47
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 86.45
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 86.4
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 85.94
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 85.71
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 85.61
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 85.44
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 85.36
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 85.27
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 85.2
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 85.0
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 84.99
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 84.8
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 84.77
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 84.61
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 84.37
d1w36b1 485 Exodeoxyribonuclease V beta chain (RecB), N-termin 84.31
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 84.3
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 84.17
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 84.15
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 84.1
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 83.65
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 83.65
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 83.35
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 83.26
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 83.0
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 82.71
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 82.67
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 82.19
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 81.92
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 81.75
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 81.72
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 81.62
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 81.55
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 80.69
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 80.09
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 80.03
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Probable ATP-dependent RNA helicase DDX48
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=5e-41  Score=302.59  Aligned_cols=205  Identities=36%  Similarity=0.638  Sum_probs=195.2

Q ss_pred             CCcccccCCCHHHHHHHHHcCCCCCcHHHHHHHHHHhcCCCEEEEccCCCchhHHhHHHHHhhhhccCCceEEEEEcCcH
Q 011446          119 GNEFEDYFLKRELLMGIFEKGFERPSPIQEESIPIALTGSDILARAKNGTGKTAAFCIPALEKIDQDNNVIQVVILVPTR  198 (485)
Q Consensus       119 ~~~~~~~~l~~~l~~~l~~~~~~~~~~~Q~~~i~~i~~~~~~ii~~~TGsGKT~~~~~~~l~~l~~~~~~~~~lil~P~~  198 (485)
                      ..+|++++|++.++++|.++||..|+++|.++||.+++|+|+++.++||||||++|++|+++.+......++++|++||+
T Consensus        16 ~~sF~~l~L~~~l~~~L~~~g~~~pt~IQ~~aIp~il~g~dvi~~a~TGSGKTlayllPil~~l~~~~~~~~~lil~Ptr   95 (222)
T d2j0sa1          16 TPTFDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFSISVLQCLDIQVRETQALILAPTR   95 (222)
T ss_dssp             CCSGGGGCCCHHHHHHHHHHTCCSCCHHHHHHHHHHHTTCCEEEECCTTSSHHHHHHHHHHHTCCTTSCSCCEEEECSSH
T ss_pred             CCCHHHCCCCHHHHHHHHHCCCCCCCHHHHHHHHHHHCCCCeEEEcCcchhhhhhhcccccccccccccCceeEEecchH
Confidence            34799999999999999999999999999999999999999999999999999999999999998887788999999999


Q ss_pred             HHHHHHHHHHHHHhccCCceEEEEECCCChHHHHHHhcCCCeEEEEcchHHHHhhhcCccccCCcceEEeeccccccCCC
Q 011446          199 ELALQTSQVCKELGKHLNIQVMVTTGGTSLKDDIMRLYQPVHLLVGTPGRILDLSKKGVCILKDCSMLVMDEADKLLSPE  278 (485)
Q Consensus       199 ~la~q~~~~~~~~~~~~~~~v~~~~g~~~~~~~~~~~~~~~~Ili~Tp~~l~~~~~~~~~~l~~~~~iViDEah~~~~~~  278 (485)
                      +|+.|+++.+.+++...++++..++|+.....+...+..+++|+|+||++|.+++.+....+++++++|+||||++++.+
T Consensus        96 eLa~Qi~~~~~~l~~~~~i~~~~~~g~~~~~~~~~~l~~~~~Ilv~TPgrl~~~~~~~~~~~~~l~~lVlDEaD~ll~~~  175 (222)
T d2j0sa1          96 ELAVQIQKGLLALGDYMNVQCHACIGGTNVGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLRTRAIKMLVLDEADEMLNKG  175 (222)
T ss_dssp             HHHHHHHHHHHHHTTTTTCCEEEECTTSCHHHHHHHHHHCCSEEEECHHHHHHHHHTTSSCCTTCCEEEEETHHHHTSTT
T ss_pred             HHHHHHHHHHHHHhCccceeEEEEeecccchhhHHHhccCCeEEeCCCCcHHhcccccccccccceeeeecchhHhhhcC
Confidence            99999999999999999999999999999998888888889999999999999999888889999999999999999999


Q ss_pred             CHHHHHHHHHhCCCCCcEEEEecccchHHHHHHHHhcCCCeEEee
Q 011446          279 FQPSVEQLIRFLPANRQILMFSATFPVTVKDFKDKYLQKPYVINL  323 (485)
Q Consensus       279 ~~~~~~~i~~~~~~~~~~i~~SATl~~~~~~~~~~~~~~~~~~~~  323 (485)
                      |...+..++..++.++|++++|||++.++.++++.++.+|..+.+
T Consensus       176 f~~~i~~I~~~l~~~~Q~ilfSAT~~~~v~~l~~~~l~~Pv~I~V  220 (222)
T d2j0sa1         176 FKEQIYDVYRYLPPATQVVLISATLPHEILEMTNKFMTDPIRILV  220 (222)
T ss_dssp             THHHHHHHHTTSCTTCEEEEEESCCCHHHHTTGGGTCSSCEEECC
T ss_pred             cHHHHHHHHHhCCCCCEEEEEEEeCCHHHHHHHHHHCCCCEEEEE
Confidence            999999999999999999999999999999999999999976654



>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1nkta4 c.37.1.19 (A:397-615) Translocation ATPase SecA, nucleotide-binding domains {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} Back     information, alignment and structure
>d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1xx6a1 c.37.1.24 (A:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xbta1 c.37.1.24 (A:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g5ta_ c.37.1.11 (A:) ATP:corrinoid adenosyltransferase CobA {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c4oa1 c.37.1.19 (A:2-409) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w36b1 c.37.1.19 (B:1-485) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure