Citrus Sinensis ID: 011454
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 485 | ||||||
| 255566078 | 508 | RNA polymerase sigma factor rpoD, putati | 0.997 | 0.952 | 0.773 | 0.0 | |
| 224146103 | 509 | predicted protein [Populus trichocarpa] | 1.0 | 0.952 | 0.744 | 0.0 | |
| 356543070 | 503 | PREDICTED: RNA polymerase sigma factor r | 0.983 | 0.948 | 0.725 | 0.0 | |
| 356531599 | 503 | PREDICTED: RNA polymerase sigma factor r | 0.983 | 0.948 | 0.723 | 0.0 | |
| 449468291 | 508 | PREDICTED: RNA polymerase sigma factor s | 0.997 | 0.952 | 0.715 | 0.0 | |
| 224124068 | 499 | predicted protein [Populus trichocarpa] | 0.979 | 0.951 | 0.724 | 0.0 | |
| 2565297 | 502 | RNA polymerase sigma subunit 1 [Arabidop | 0.962 | 0.930 | 0.685 | 0.0 | |
| 15217767 | 502 | sigma factor A [Arabidopsis thaliana] gi | 0.962 | 0.930 | 0.684 | 0.0 | |
| 11762220 | 502 | At1g64860 [Arabidopsis thaliana] | 0.962 | 0.930 | 0.682 | 0.0 | |
| 2398851 | 502 | plastid RNA polymerase sigma-subunit [Ar | 0.962 | 0.930 | 0.682 | 0.0 |
| >gi|255566078|ref|XP_002524027.1| RNA polymerase sigma factor rpoD, putative [Ricinus communis] gi|223536754|gb|EEF38395.1| RNA polymerase sigma factor rpoD, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 781 bits (2018), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 393/508 (77%), Positives = 434/508 (85%), Gaps = 24/508 (4%)
Query: 2 MATAAVIGLSAGKRLLSSSFYYSDISEKFSYINDLGSANSQVGSTKNVVAAKKSSNYNPS 61
MATAAVIGLSAGKRLLSS+FYYSD++EK S N+ G + Q+ STK ++ AKKSSNY PS
Sbjct: 1 MATAAVIGLSAGKRLLSSTFYYSDLTEKLSSANEHGLTHYQITSTKTLIVAKKSSNYGPS 60
Query: 62 FPSSNRQTQPIKALKEHVDTNFA-STAEPWAEPPNSIEEESSELDYSVEALLLLQKSMLE 120
FPSSNR TQ IKALKEHVDT A STA + N +EEESS+LDYSVEALLLLQKSMLE
Sbjct: 61 FPSSNRNTQSIKALKEHVDTASAPSTAATQFKTFNDMEEESSDLDYSVEALLLLQKSMLE 120
Query: 121 KQWNLSFERTVLTDSPSKKTHKKVPVTCSGVSARQRRLNSKKKILSQNKSILQQNGSKQL 180
KQWNLSFERT +DSPS+K+ KK+PVTCSGVSARQRR+N ++K LSQ+K +Q N KQL
Sbjct: 121 KQWNLSFERTDSSDSPSRKSQKKIPVTCSGVSARQRRINIRRKNLSQSKFTVQANVFKQL 180
Query: 181 RSMISPELIQNRLKGYVKGVVSEELLTHAEVVRLSKKIKTGLSLDDHKLRLKERLGCEPS 240
+S +SPEL+QNRLKGYVKGVVSEELL+HAEVVRLS+ IK GLSL+DHK RLKERLGC+PS
Sbjct: 181 KSAVSPELLQNRLKGYVKGVVSEELLSHAEVVRLSRIIKAGLSLEDHKSRLKERLGCDPS 240
Query: 241 MEQLAASLRISRPELQSILMECSLAREKLVMSNVRLVMSIAQRYDNMGADMADLVQGGLI 300
EQ+A SL+ISR ELQS + CSLAREKL MSNVRLVMSIAQRYDNMGA+MADLVQGGLI
Sbjct: 241 DEQVATSLKISRAELQSKSIACSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLVQGGLI 300
Query: 301 GLLRGIEKFDSSKGFKISTYVYWWIRQGVSRALVENSRTLRLPNHLHERLGLIRNAKLRL 360
GLLRGIEKFDSSKGF+ISTYVYWWIRQGVSRALVENSRTLRLPNHLHERLGLIRNAK+RL
Sbjct: 301 GLLRGIEKFDSSKGFRISTYVYWWIRQGVSRALVENSRTLRLPNHLHERLGLIRNAKIRL 360
Query: 361 EEKGVTPSVDRIAEYLNMSQKKVRNATEVL-----------------------AYIADNR 397
EEKGVTPS+DRIAE LN+SQKKVRNATE + +YIADN
Sbjct: 361 EEKGVTPSIDRIAESLNISQKKVRNATEAVSKVFSLDREAFPSLNGLPGETHHSYIADNC 420
Query: 398 VENNPWHGVDDWALKDEVNKLIIVTLGEREREIIRLYYGLDKECLTWEDISKRIGLSRER 457
+ENNPWHGVDDWALKDEVNKLI +TL ERE+EIIRLYYGLD E LTWEDISKRIGLSRER
Sbjct: 421 LENNPWHGVDDWALKDEVNKLINLTLQEREQEIIRLYYGLDNESLTWEDISKRIGLSRER 480
Query: 458 VRQVGLVALEKLKHAARKKKMEAMLVKH 485
VRQVGLVALEKLKHAARKKK+EAMLVKH
Sbjct: 481 VRQVGLVALEKLKHAARKKKLEAMLVKH 508
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224146103|ref|XP_002325882.1| predicted protein [Populus trichocarpa] gi|222862757|gb|EEF00264.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356543070|ref|XP_003539986.1| PREDICTED: RNA polymerase sigma factor rpoD-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356531599|ref|XP_003534364.1| PREDICTED: RNA polymerase sigma factor rpoD-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449468291|ref|XP_004151855.1| PREDICTED: RNA polymerase sigma factor sigA-like [Cucumis sativus] gi|449514942|ref|XP_004164521.1| PREDICTED: RNA polymerase sigma factor sigA-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|224124068|ref|XP_002319237.1| predicted protein [Populus trichocarpa] gi|222857613|gb|EEE95160.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|2565297|gb|AAB81958.1| RNA polymerase sigma subunit 1 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|15217767|ref|NP_176666.1| sigma factor A [Arabidopsis thaliana] gi|75098242|sp|O24629.1|SIGA_ARATH RecName: Full=RNA polymerase sigma factor sigA; Short=Sigma factor A; Short=Sigma-A; AltName: Full=RNA polymerase sigma factor sig1; Short=Atsig1; Short=Sigma factor 1; AltName: Full=RNA polymerase sigma factor sig2; Short=Atsig2; Short=Sigma factor 2; AltName: Full=RNA polymerase sigma factor sigB; Short=Sigma factor B; Short=Sigma-B; Flags: Precursor gi|5042421|gb|AAD38260.1|AC006193_16 RNA polymerase sigma subunit 1 [Arabidopsis thaliana] gi|2353171|gb|AAB69384.1| sigma factor 1 [Arabidopsis thaliana] gi|2443408|dbj|BAA22421.1| SigA [Arabidopsis thaliana] gi|2558514|emb|CAA74640.1| plastid RNA polymerase sigma factor [Arabidopsis thaliana] gi|5478439|dbj|BAA82448.1| sigma factor SigA [Arabidopsis thaliana] gi|17064900|gb|AAL32604.1| RNA polymerase sigma subunit 1 [Arabidopsis thaliana] gi|20259916|gb|AAM13305.1| RNA polymerase sigma subunit 1 [Arabidopsis thaliana] gi|222423019|dbj|BAH19492.1| AT1G64860 [Arabidopsis thaliana] gi|332196177|gb|AEE34298.1| sigma factor A [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|11762220|gb|AAG40388.1|AF325036_1 At1g64860 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|2398851|dbj|BAA22214.1| plastid RNA polymerase sigma-subunit [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 485 | ||||||
| TAIR|locus:2010871 | 502 | SIGA "AT1G64860" [Arabidopsis | 0.777 | 0.750 | 0.649 | 3.4e-125 | |
| UNIPROTKB|O48655 | 519 | rsigA "Plastid RNA polymerase | 0.785 | 0.734 | 0.478 | 8.2e-83 | |
| TAIR|locus:2025650 | 572 | SIG2 "AT1G08540" [Arabidopsis | 0.472 | 0.400 | 0.357 | 6.6e-43 | |
| TAIR|locus:2057996 | 547 | SIGF "AT2G36990" [Arabidopsis | 0.393 | 0.349 | 0.364 | 3.9e-39 | |
| TIGR_CMR|GSU_3089 | 577 | GSU_3089 "RNA polymerase sigma | 0.389 | 0.327 | 0.356 | 7.2e-35 | |
| UNIPROTKB|P0A602 | 528 | rpoD "RNA polymerase sigma fac | 0.371 | 0.340 | 0.365 | 8.4e-34 | |
| TIGR_CMR|CBU_1669 | 352 | CBU_1669 "RNA polymerase sigma | 0.463 | 0.639 | 0.301 | 4.1e-32 | |
| TIGR_CMR|APH_0576 | 627 | APH_0576 "RNA polymerase sigma | 0.453 | 0.350 | 0.306 | 1.1e-31 | |
| TIGR_CMR|CBU_1596 | 698 | CBU_1596 "RNA polymerase sigma | 0.257 | 0.179 | 0.365 | 5.7e-31 | |
| TIGR_CMR|SPO_1750 | 660 | SPO_1750 "RNA polymerase sigma | 0.265 | 0.195 | 0.4 | 7.5e-31 |
| TAIR|locus:2010871 SIGA "AT1G64860" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1230 (438.0 bits), Expect = 3.4e-125, P = 3.4e-125
Identities = 261/402 (64%), Positives = 306/402 (76%)
Query: 2 MATAAVIGLSAGKRLLSSSFYYSDISEKFSYINDLGSANSQVGSTKNVVAAKKXXXXXXX 61
MATAAVIGL+ GKRLLSSSFY+SD++EKF +ND S+ + STK+ + AKK
Sbjct: 1 MATAAVIGLNTGKRLLSSSFYHSDVTEKFLSVNDHCSSQYHIASTKSGITAKKASNYSPS 60
Query: 62 XXXXXRQTQPIKALKEHVDTNFASTAEPWA------EPPNXXXXXXXXLDYSVEALLLLQ 115
R TQ KALKE VD AST +PW E + +SVEA+LLLQ
Sbjct: 61 FPSSNRHTQSAKALKESVDV--ASTEKPWLPNGTDKELEEECYDDDDLISHSVEAILLLQ 118
Query: 116 KSMLEKQWNLSFERTVLTDSPSKKT--HKKVPV-TCSGVSARQRRLNSKKKI-LSQNKSI 171
KSMLEK WNLSFE+ V ++ P K T KK+PV TCSG+SARQRR+ +KKK ++ K++
Sbjct: 119 KSMLEKSWNLSFEKAVSSEYPGKGTIRKKKIPVITCSGISARQRRIGAKKKTNMTHVKAV 178
Query: 172 LQQNGSKQLRSMISPELIQNRLKGYVKGVVSEELLTHAEVVRLSKKIKTGLSLDDHKLRL 231
+ KQ+R GYVKGV+SE++L+H EVVRLSKKIK+GL LDDHK RL
Sbjct: 179 SDVSSGKQVR-------------GYVKGVISEDVLSHVEVVRLSKKIKSGLRLDDHKSRL 225
Query: 232 KERLGCEPSMEQLAASLRISRPELQSILMECSLAREKLVMSNVRLVMSIAQRYDNMGADM 291
K+RLGCEPS EQLA SL+ISR ELQ+ LMEC LAREKL MSNVRLVMSIAQRYDN+GA+M
Sbjct: 226 KDRLGCEPSDEQLAVSLKISRAELQAWLMECHLAREKLAMSNVRLVMSIAQRYDNLGAEM 285
Query: 292 ADLVQGGLIGLLRGIEKFDSSKGFKISTYVYWWIRQGVSRALVENSRTLRLPNHLHERLG 351
+DLVQGGLIGLLRGIEKFDSSKGF+ISTYVYWWIRQGVSRALV+NSRTLRLP HLHERLG
Sbjct: 286 SDLVQGGLIGLLRGIEKFDSSKGFRISTYVYWWIRQGVSRALVDNSRTLRLPTHLHERLG 345
Query: 352 LIRNAKLRLEEKGVTPSVDRIAEYLNMSQKKVRNATEVLAYI 393
LIRNAKLRL+EKG+TPS+DRIAE LNMSQKKVRNATE ++ +
Sbjct: 346 LIRNAKLRLQEKGITPSIDRIAESLNMSQKKVRNATEAVSKV 387
|
|
| UNIPROTKB|O48655 rsigA "Plastid RNA polymerase sigma factor" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2025650 SIG2 "AT1G08540" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2057996 SIGF "AT2G36990" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|GSU_3089 GSU_3089 "RNA polymerase sigma factor RpoD" [Geobacter sulfurreducens PCA (taxid:243231)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P0A602 rpoD "RNA polymerase sigma factor RpoD" [Mycobacterium tuberculosis (taxid:1773)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CBU_1669 CBU_1669 "RNA polymerase sigma factor RpoS" [Coxiella burnetii RSA 493 (taxid:227377)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|APH_0576 APH_0576 "RNA polymerase sigma factor RpoD" [Anaplasma phagocytophilum HZ (taxid:212042)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CBU_1596 CBU_1596 "RNA polymerase sigma factor RpoD" [Coxiella burnetii RSA 493 (taxid:227377)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SPO_1750 SPO_1750 "RNA polymerase sigma-70 factor RpoD" [Ruegeria pomeroyi DSS-3 (taxid:246200)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| grail3.0065010301 | hypothetical protein (510 aa) | ||||||||||
(Populus trichocarpa) | |||||||||||
| gw1.XIV.2894.1 | • | 0.431 | |||||||||
| fgenesh4_pg.C_LG_XVII000398 | • | 0.430 | |||||||||
| eugene3.17410001 | • | 0.429 | |||||||||
| estExt_fgenesh4_pg.C_3210002 | • | 0.426 | |||||||||
| gw1.321.23.1 | • | 0.420 | |||||||||
| eugene3.00001972 | • | 0.411 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 485 | |||
| TIGR02997 | 298 | TIGR02997, Sig70-cyanoRpoD, RNA polymerase sigma f | 2e-73 | |
| PRK07405 | 317 | PRK07405, PRK07405, RNA polymerase sigma factor Si | 1e-55 | |
| PRK07406 | 373 | PRK07406, PRK07406, RNA polymerase sigma factor Rp | 3e-54 | |
| TIGR02393 | 238 | TIGR02393, RpoD_Cterm, RNA polymerase sigma factor | 3e-54 | |
| COG0568 | 342 | COG0568, RpoD, DNA-directed RNA polymerase, sigma | 5e-51 | |
| PRK07598 | 415 | PRK07598, PRK07598, RNA polymerase sigma factor Si | 1e-48 | |
| PRK05949 | 327 | PRK05949, PRK05949, RNA polymerase sigma factor; V | 3e-48 | |
| PRK07921 | 324 | PRK07921, PRK07921, RNA polymerase sigma factor Si | 5e-47 | |
| TIGR02394 | 285 | TIGR02394, rpoS_proteo, RNA polymerase sigma facto | 1e-43 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 1e-41 | |
| PRK09210 | 367 | PRK09210, PRK09210, RNA polymerase sigma factor Rp | 9e-41 | |
| PRK05657 | 325 | PRK05657, PRK05657, RNA polymerase sigma factor Rp | 2e-40 | |
| PRK05658 | 619 | PRK05658, PRK05658, RNA polymerase sigma factor Rp | 1e-27 | |
| TIGR02980 | 227 | TIGR02980, SigBFG, RNA polymerase sigma-70 factor, | 1e-24 | |
| COG1191 | 247 | COG1191, FliA, DNA-directed RNA polymerase special | 3e-24 | |
| PRK05572 | 252 | PRK05572, PRK05572, sporulation sigma factor SigF; | 7e-22 | |
| TIGR02392 | 270 | TIGR02392, rpoH_proteo, alternative sigma factor R | 3e-21 | |
| PRK06596 | 284 | PRK06596, PRK06596, RNA polymerase factor sigma-32 | 4e-21 | |
| TIGR02885 | 231 | TIGR02885, spore_sigF, RNA polymerase sigma-F fact | 1e-20 | |
| PRK07500 | 289 | PRK07500, rpoH2, RNA polymerase factor sigma-32; R | 5e-20 | |
| PRK08215 | 258 | PRK08215, PRK08215, sporulation sigma factor SigG; | 2e-18 | |
| pfam04542 | 71 | pfam04542, Sigma70_r2, Sigma-70 region 2 | 9e-18 | |
| TIGR02850 | 254 | TIGR02850, spore_sigG, RNA polymerase sigma-G fact | 4e-17 | |
| PRK05803 | 233 | PRK05803, PRK05803, sporulation sigma factor SigK; | 3e-15 | |
| TIGR02479 | 224 | TIGR02479, FliA_WhiG, RNA polymerase sigma factor, | 7e-15 | |
| TIGR02941 | 255 | TIGR02941, Sigma_B, RNA polymerase sigma-B factor | 2e-14 | |
| TIGR02846 | 227 | TIGR02846, spore_sigmaK, RNA polymerase sigma-K fa | 7e-14 | |
| TIGR02937 | 158 | TIGR02937, sigma70-ECF, RNA polymerase sigma facto | 2e-12 | |
| PRK08583 | 257 | PRK08583, PRK08583, RNA polymerase sigma factor Si | 7e-12 | |
| PRK06288 | 268 | PRK06288, PRK06288, RNA polymerase sigma factor Wh | 2e-10 | |
| TIGR02835 | 234 | TIGR02835, spore_sigmaE, RNA polymerase sigma-E fa | 2e-09 | |
| PRK07670 | 251 | PRK07670, PRK07670, RNA polymerase sigma factor Si | 2e-09 | |
| PRK07122 | 264 | PRK07122, PRK07122, RNA polymerase sigma factor Si | 3e-09 | |
| PRK06986 | 236 | PRK06986, fliA, flagellar biosynthesis sigma facto | 5e-09 | |
| pfam04545 | 50 | pfam04545, Sigma70_r4, Sigma-70, region 4 | 2e-08 | |
| PRK07408 | 256 | PRK07408, PRK07408, RNA polymerase sigma factor Si | 6e-08 | |
| PRK05911 | 257 | PRK05911, PRK05911, RNA polymerase sigma factor si | 5e-07 | |
| PRK08301 | 234 | PRK08301, PRK08301, sporulation sigma factor SigE; | 7e-07 | |
| cd06171 | 55 | cd06171, Sigma70_r4, Sigma70, region (SR) 4 refers | 9e-07 | |
| pfam04539 | 78 | pfam04539, Sigma70_r3, Sigma-70 region 3 | 4e-04 |
| >gnl|CDD|234082 TIGR02997, Sig70-cyanoRpoD, RNA polymerase sigma factor, cyanobacterial RpoD-like family | Back alignment and domain information |
|---|
Score = 233 bits (596), Expect = 2e-73
Identities = 110/287 (38%), Positives = 176/287 (61%), Gaps = 24/287 (8%)
Query: 205 LLTHAEVVRLSKKIKTGLSLDDHKLRLKERLGCEPSMEQLAASLRISRPELQSILMECSL 264
LLT E + L+++++ + L++ + L+E+LG EPS E+ AA+ +S EL+ L +
Sbjct: 15 LLTPEEEIELARQVQQMMVLEELREELEEQLGREPSKEEWAAAAGLSEAELRQRLRQGQR 74
Query: 265 AREKLVMSNVRLVMSIAQRYDNMGADMADLVQGGLIGLLRGIEKFDSSKGFKISTYVYWW 324
A+EK++ +N+RLV+S+A++Y N G ++ DL+Q G +GL R +EKFD ++G+K STY YWW
Sbjct: 75 AKEKMIKANLRLVVSVAKKYQNRGLELLDLIQEGSLGLERAVEKFDPTRGYKFSTYAYWW 134
Query: 325 IRQGVSRALVENSRTLRLPNHLHERLGLIRNAKLRL-EEKGVTPSVDRIAEYLNMSQKKV 383
IRQG++RA+ SRT+RLP H+ E+L I+ + L ++ G TPS IAE L + ++V
Sbjct: 135 IRQGITRAIANQSRTIRLPIHITEKLNKIKKVQRELSQKLGRTPSEAEIAEALELEPEQV 194
Query: 384 RNA-------------------TEVLAYIADNRVENNPWHGVDDWALKDEVNKLIIVTLG 424
R TE+ + D+ +P V+ +L+ ++ L+ L
Sbjct: 195 RELLQRARQPVSLDAPVGDEEDTELGDLLEDD--GESPEEQVERESLRQDLESLLA-ELT 251
Query: 425 EREREIIRLYYGLDKEC-LTWEDISKRIGLSRERVRQVGLVALEKLK 470
RER+++RL +GLD LT +I +R+ LSRERVRQ+ AL KL+
Sbjct: 252 PRERQVLRLRFGLDGGEPLTLAEIGRRLNLSRERVRQIEAKALRKLR 298
|
This family includes a number of closely related sigma-70 (TIGR02937) factors in the cyanobacteria. All appear most closely related to the essential sigma-70 factor RpoD, and some score above trusted to the RpoD C-terminal domain model (TIGR02393). Length = 298 |
| >gnl|CDD|180963 PRK07405, PRK07405, RNA polymerase sigma factor SigD; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236012 PRK07406, PRK07406, RNA polymerase sigma factor RpoD; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|213709 TIGR02393, RpoD_Cterm, RNA polymerase sigma factor RpoD, C-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|223642 COG0568, RpoD, DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|236067 PRK07598, PRK07598, RNA polymerase sigma factor SigC; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|180321 PRK05949, PRK05949, RNA polymerase sigma factor; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|181169 PRK07921, PRK07921, RNA polymerase sigma factor SigB; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|131447 TIGR02394, rpoS_proteo, RNA polymerase sigma factor RpoS | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236413 PRK09210, PRK09210, RNA polymerase sigma factor RpoD; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235548 PRK05657, PRK05657, RNA polymerase sigma factor RpoS; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235549 PRK05658, PRK05658, RNA polymerase sigma factor RpoD; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|234078 TIGR02980, SigBFG, RNA polymerase sigma-70 factor, sigma-B/F/G subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|224112 COG1191, FliA, DNA-directed RNA polymerase specialized sigma subunit [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|180137 PRK05572, PRK05572, sporulation sigma factor SigF; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|233844 TIGR02392, rpoH_proteo, alternative sigma factor RpoH | Back alignment and domain information |
|---|
| >gnl|CDD|235838 PRK06596, PRK06596, RNA polymerase factor sigma-32; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|131931 TIGR02885, spore_sigF, RNA polymerase sigma-F factor | Back alignment and domain information |
|---|
| >gnl|CDD|236033 PRK07500, rpoH2, RNA polymerase factor sigma-32; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|181296 PRK08215, PRK08215, sporulation sigma factor SigG; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|218138 pfam04542, Sigma70_r2, Sigma-70 region 2 | Back alignment and domain information |
|---|
| >gnl|CDD|131897 TIGR02850, spore_sigG, RNA polymerase sigma-G factor | Back alignment and domain information |
|---|
| >gnl|CDD|180266 PRK05803, PRK05803, sporulation sigma factor SigK; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|233885 TIGR02479, FliA_WhiG, RNA polymerase sigma factor, FliA/WhiG family | Back alignment and domain information |
|---|
| >gnl|CDD|131987 TIGR02941, Sigma_B, RNA polymerase sigma-B factor | Back alignment and domain information |
|---|
| >gnl|CDD|131893 TIGR02846, spore_sigmaK, RNA polymerase sigma-K factor | Back alignment and domain information |
|---|
| >gnl|CDD|234065 TIGR02937, sigma70-ECF, RNA polymerase sigma factor, sigma-70 family | Back alignment and domain information |
|---|
| >gnl|CDD|236306 PRK08583, PRK08583, RNA polymerase sigma factor SigB; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235770 PRK06288, PRK06288, RNA polymerase sigma factor WhiG; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|131882 TIGR02835, spore_sigmaE, RNA polymerase sigma-E factor | Back alignment and domain information |
|---|
| >gnl|CDD|181075 PRK07670, PRK07670, RNA polymerase sigma factor SigD; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|168831 PRK07122, PRK07122, RNA polymerase sigma factor SigF; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|235901 PRK06986, fliA, flagellar biosynthesis sigma factor; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|218139 pfam04545, Sigma70_r4, Sigma-70, region 4 | Back alignment and domain information |
|---|
| >gnl|CDD|180965 PRK07408, PRK07408, RNA polymerase sigma factor SigF; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|235644 PRK05911, PRK05911, RNA polymerase sigma factor sigma-28; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|236228 PRK08301, PRK08301, sporulation sigma factor SigE; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|100119 cd06171, Sigma70_r4, Sigma70, region (SR) 4 refers to the most C-terminal of four conserved domains found in Escherichia coli (Ec) sigma70, the main housekeeping sigma, and related sigma-factors (SFs) | Back alignment and domain information |
|---|
| >gnl|CDD|146934 pfam04539, Sigma70_r3, Sigma-70 region 3 | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 485 | |||
| PRK07598 | 415 | RNA polymerase sigma factor SigC; Validated | 100.0 | |
| PRK07406 | 373 | RNA polymerase sigma factor RpoD; Validated | 100.0 | |
| PRK05949 | 327 | RNA polymerase sigma factor; Validated | 100.0 | |
| TIGR02997 | 298 | Sig70-cyanoRpoD RNA polymerase sigma factor, cyano | 100.0 | |
| PRK07405 | 317 | RNA polymerase sigma factor SigD; Validated | 100.0 | |
| PRK05901 | 509 | RNA polymerase sigma factor; Provisional | 100.0 | |
| PRK07921 | 324 | RNA polymerase sigma factor SigB; Reviewed | 100.0 | |
| COG0568 | 342 | RpoD DNA-directed RNA polymerase, sigma subunit (s | 100.0 | |
| PRK09210 | 367 | RNA polymerase sigma factor RpoD; Validated | 100.0 | |
| PRK05658 | 619 | RNA polymerase sigma factor RpoD; Validated | 100.0 | |
| PRK05657 | 325 | RNA polymerase sigma factor RpoS; Validated | 100.0 | |
| PRK06596 | 284 | RNA polymerase factor sigma-32; Reviewed | 100.0 | |
| TIGR02393 | 238 | RpoD_Cterm RNA polymerase sigma factor RpoD, C-ter | 100.0 | |
| PRK07500 | 289 | rpoH2 RNA polymerase factor sigma-32; Reviewed | 100.0 | |
| TIGR02392 | 270 | rpoH_proteo alternative sigma factor RpoH. A sigma | 100.0 | |
| TIGR02394 | 285 | rpoS_proteo RNA polymerase sigma factor RpoS. A si | 100.0 | |
| PRK07122 | 264 | RNA polymerase sigma factor SigF; Reviewed | 100.0 | |
| COG1191 | 247 | FliA DNA-directed RNA polymerase specialized sigma | 100.0 | |
| PRK07408 | 256 | RNA polymerase sigma factor SigF; Reviewed | 100.0 | |
| TIGR02850 | 254 | spore_sigG RNA polymerase sigma-G factor. Members | 100.0 | |
| PRK08215 | 258 | sporulation sigma factor SigG; Reviewed | 100.0 | |
| TIGR02941 | 255 | Sigma_B RNA polymerase sigma-B factor. This sigma | 100.0 | |
| PRK05911 | 257 | RNA polymerase sigma factor sigma-28; Reviewed | 100.0 | |
| PRK06288 | 268 | RNA polymerase sigma factor WhiG; Reviewed | 100.0 | |
| PRK08583 | 257 | RNA polymerase sigma factor SigB; Validated | 100.0 | |
| TIGR02980 | 227 | SigBFG RNA polymerase sigma-70 factor, sigma-B/F/G | 100.0 | |
| TIGR02885 | 231 | spore_sigF RNA polymerase sigma-F factor. Members | 100.0 | |
| PRK07670 | 251 | RNA polymerase sigma factor SigD; Validated | 100.0 | |
| PRK05572 | 252 | sporulation sigma factor SigF; Validated | 100.0 | |
| TIGR02479 | 224 | FliA_WhiG RNA polymerase sigma factor, FliA/WhiG f | 99.97 | |
| PRK06986 | 236 | fliA flagellar biosynthesis sigma factor; Validate | 99.97 | |
| PRK12427 | 231 | flagellar biosynthesis sigma factor; Provisional | 99.97 | |
| PRK05803 | 233 | sporulation sigma factor SigK; Reviewed | 99.95 | |
| TIGR02846 | 227 | spore_sigmaK RNA polymerase sigma-K factor. The sp | 99.93 | |
| PRK08301 | 234 | sporulation sigma factor SigE; Reviewed | 99.93 | |
| PRK09648 | 189 | RNA polymerase sigma factor SigD; Reviewed | 99.91 | |
| TIGR02835 | 234 | spore_sigmaE RNA polymerase sigma-E factor. Member | 99.91 | |
| PRK09646 | 194 | RNA polymerase sigma factor SigK; Reviewed | 99.9 | |
| PRK05602 | 186 | RNA polymerase sigma factor; Reviewed | 99.9 | |
| PRK12513 | 194 | RNA polymerase sigma factor; Provisional | 99.9 | |
| TIGR02952 | 170 | Sig70_famx2 RNA polymerase sigma-70 factor, TIGR02 | 99.9 | |
| PRK08295 | 208 | RNA polymerase factor sigma-70; Validated | 99.89 | |
| PRK12519 | 194 | RNA polymerase sigma factor; Provisional | 99.89 | |
| PRK06759 | 154 | RNA polymerase factor sigma-70; Validated | 99.89 | |
| PRK11923 | 193 | algU RNA polymerase sigma factor AlgU; Provisional | 99.89 | |
| PRK11922 | 231 | RNA polymerase sigma factor; Provisional | 99.89 | |
| PRK12524 | 196 | RNA polymerase sigma factor; Provisional | 99.89 | |
| PRK12514 | 179 | RNA polymerase sigma factor; Provisional | 99.89 | |
| PRK12537 | 182 | RNA polymerase sigma factor; Provisional | 99.88 | |
| PRK12534 | 187 | RNA polymerase sigma factor; Provisional | 99.88 | |
| PRK12538 | 233 | RNA polymerase sigma factor; Provisional | 99.88 | |
| PRK13919 | 186 | putative RNA polymerase sigma E protein; Provision | 99.88 | |
| PRK12526 | 206 | RNA polymerase sigma factor; Provisional | 99.88 | |
| TIGR02948 | 187 | SigW_bacill RNA polymerase sigma-W factor. This si | 99.88 | |
| PRK09652 | 182 | RNA polymerase sigma factor RpoE; Provisional | 99.88 | |
| TIGR02859 | 198 | spore_sigH RNA polymerase sigma-H factor. Members | 99.87 | |
| PRK12531 | 194 | RNA polymerase sigma factor; Provisional | 99.87 | |
| PRK06811 | 189 | RNA polymerase factor sigma-70; Validated | 99.87 | |
| TIGR02939 | 190 | RpoE_Sigma70 RNA polymerase sigma factor RpoE. A s | 99.87 | |
| PRK12542 | 185 | RNA polymerase sigma factor; Provisional | 99.87 | |
| PRK09640 | 188 | RNA polymerase sigma factor SigX; Reviewed | 99.87 | |
| PRK09641 | 187 | RNA polymerase sigma factor SigW; Provisional | 99.87 | |
| PRK09643 | 192 | RNA polymerase sigma factor SigM; Reviewed | 99.87 | |
| PRK11924 | 179 | RNA polymerase sigma factor; Provisional | 99.86 | |
| PRK12515 | 189 | RNA polymerase sigma factor; Provisional | 99.86 | |
| TIGR02954 | 169 | Sig70_famx3 RNA polymerase sigma-70 factor, TIGR02 | 99.86 | |
| PRK12543 | 179 | RNA polymerase sigma factor; Provisional | 99.86 | |
| PRK09638 | 176 | RNA polymerase sigma factor SigY; Reviewed | 99.86 | |
| PRK12536 | 181 | RNA polymerase sigma factor; Provisional | 99.86 | |
| PRK09645 | 173 | RNA polymerase sigma factor SigL; Provisional | 99.86 | |
| PRK12512 | 184 | RNA polymerase sigma factor; Provisional | 99.86 | |
| PRK09649 | 185 | RNA polymerase sigma factor SigC; Reviewed | 99.86 | |
| TIGR03001 | 244 | Sig-70_gmx1 RNA polymerase sigma-70 factor, Myxoco | 99.86 | |
| TIGR02999 | 183 | Sig-70_X6 RNA polymerase sigma factor, TIGR02999 f | 99.86 | |
| PRK12539 | 184 | RNA polymerase sigma factor; Provisional | 99.85 | |
| PRK09415 | 179 | RNA polymerase factor sigma C; Reviewed | 99.85 | |
| TIGR02985 | 161 | Sig70_bacteroi1 RNA polymerase sigma-70 factor, Ba | 99.85 | |
| TIGR02989 | 159 | Sig-70_gvs1 RNA polymerase sigma-70 factor, Rhodop | 99.85 | |
| TIGR02937 | 158 | sigma70-ECF RNA polymerase sigma factor, sigma-70 | 99.85 | |
| PRK12518 | 175 | RNA polymerase sigma factor; Provisional | 99.85 | |
| PRK12520 | 191 | RNA polymerase sigma factor; Provisional | 99.85 | |
| PRK12522 | 173 | RNA polymerase sigma factor; Provisional | 99.84 | |
| PRK12516 | 187 | RNA polymerase sigma factor; Provisional | 99.84 | |
| PRK09642 | 160 | RNA polymerase sigma factor SigW; Reviewed | 99.84 | |
| PRK12535 | 196 | RNA polymerase sigma factor; Provisional | 99.84 | |
| TIGR02983 | 162 | SigE-fam_strep RNA polymerase sigma-70 factor, sig | 99.84 | |
| TIGR02984 | 189 | Sig-70_plancto1 RNA polymerase sigma-70 factor, Pl | 99.84 | |
| PRK12547 | 164 | RNA polymerase sigma factor; Provisional | 99.84 | |
| COG1595 | 182 | RpoE DNA-directed RNA polymerase specialized sigma | 99.83 | |
| PRK09644 | 165 | RNA polymerase sigma factor SigM; Provisional | 99.83 | |
| TIGR02947 | 193 | SigH_actino RNA polymerase sigma-70 factor, TIGR02 | 99.83 | |
| PRK12523 | 172 | RNA polymerase sigma factor; Reviewed | 99.83 | |
| PRK12533 | 216 | RNA polymerase sigma factor; Provisional | 99.83 | |
| PRK12529 | 178 | RNA polymerase sigma factor; Provisional | 99.83 | |
| PRK09647 | 203 | RNA polymerase sigma factor SigE; Reviewed | 99.82 | |
| PRK09639 | 166 | RNA polymerase sigma factor SigX; Provisional | 99.82 | |
| PRK12528 | 161 | RNA polymerase sigma factor; Provisional | 99.81 | |
| PRK12541 | 161 | RNA polymerase sigma factor; Provisional | 99.81 | |
| TIGR02943 | 188 | Sig70_famx1 RNA polymerase sigma-70 factor, TIGR02 | 99.81 | |
| PRK08241 | 339 | RNA polymerase factor sigma-70; Validated | 99.81 | |
| PRK12540 | 182 | RNA polymerase sigma factor; Provisional | 99.81 | |
| PRK12532 | 195 | RNA polymerase sigma factor; Provisional | 99.8 | |
| PRK12545 | 201 | RNA polymerase sigma factor; Provisional | 99.8 | |
| PRK09637 | 181 | RNA polymerase sigma factor SigZ; Provisional | 99.8 | |
| PRK12530 | 189 | RNA polymerase sigma factor; Provisional | 99.8 | |
| PRK12544 | 206 | RNA polymerase sigma factor; Provisional | 99.8 | |
| TIGR02950 | 154 | SigM_subfam RNA polymerase sigma factor, SigM fami | 99.79 | |
| PRK12517 | 188 | RNA polymerase sigma factor; Provisional | 99.79 | |
| PRK07037 | 163 | extracytoplasmic-function sigma-70 factor; Validat | 99.79 | |
| TIGR02960 | 324 | SigX5 RNA polymerase sigma-70 factor, TIGR02960 fa | 99.79 | |
| PRK09651 | 172 | RNA polymerase sigma factor FecI; Provisional | 99.79 | |
| PRK12527 | 159 | RNA polymerase sigma factor; Reviewed | 99.79 | |
| TIGR02959 | 170 | SigZ RNA polymerase sigma factor, SigZ family. Thi | 99.79 | |
| PRK12546 | 188 | RNA polymerase sigma factor; Provisional | 99.78 | |
| PRK12511 | 182 | RNA polymerase sigma factor; Provisional | 99.77 | |
| TIGR02895 | 218 | spore_sigI RNA polymerase sigma-I factor. Members | 99.77 | |
| PRK12525 | 168 | RNA polymerase sigma factor; Provisional | 99.76 | |
| PRK06704 | 228 | RNA polymerase factor sigma-70; Validated | 99.72 | |
| PRK09047 | 161 | RNA polymerase factor sigma-70; Validated | 99.7 | |
| PRK09636 | 293 | RNA polymerase sigma factor SigJ; Provisional | 99.69 | |
| TIGR02957 | 281 | SigX4 RNA polymerase sigma-70 factor, TIGR02957 fa | 99.67 | |
| PRK09635 | 290 | sigI RNA polymerase sigma factor SigI; Provisional | 99.66 | |
| PRK09191 | 261 | two-component response regulator; Provisional | 99.6 | |
| TIGR03209 | 142 | P21_Cbot clostridium toxin-associated regulator Bo | 99.56 | |
| PRK08311 | 237 | putative RNA polymerase sigma factor SigI; Reviewe | 99.55 | |
| PF07638 | 185 | Sigma70_ECF: ECF sigma factor | 99.52 | |
| PF04542 | 71 | Sigma70_r2: Sigma-70 region 2 ; InterPro: IPR00762 | 99.26 | |
| PF04545 | 50 | Sigma70_r4: Sigma-70, region 4; InterPro: IPR00763 | 99.18 | |
| PF08281 | 54 | Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013 | 98.96 | |
| PRK06930 | 170 | positive control sigma-like factor; Validated | 98.71 | |
| PRK00118 | 104 | putative DNA-binding protein; Validated | 98.61 | |
| cd06171 | 55 | Sigma70_r4 Sigma70, region (SR) 4 refers to the mo | 98.39 | |
| TIGR00721 | 137 | tfx DNA-binding protein, Tfx family. Tfx from Meth | 98.28 | |
| PRK03975 | 141 | tfx putative transcriptional regulator; Provisiona | 98.24 | |
| PRK04217 | 110 | hypothetical protein; Provisional | 98.24 | |
| PF04297 | 101 | UPF0122: Putative helix-turn-helix protein, YlxM / | 98.21 | |
| smart00421 | 58 | HTH_LUXR helix_turn_helix, Lux Regulon. lux regulo | 97.93 | |
| PF00196 | 58 | GerE: Bacterial regulatory proteins, luxR family; | 97.85 | |
| TIGR01636 | 134 | phage_rinA phage transcriptional activator, RinA f | 97.85 | |
| cd06170 | 57 | LuxR_C_like C-terminal DNA-binding domain of LuxR- | 97.8 | |
| PF07374 | 100 | DUF1492: Protein of unknown function (DUF1492); In | 97.79 | |
| TIGR03879 | 73 | near_KaiC_dom probable regulatory domain. This mod | 97.72 | |
| PF04967 | 53 | HTH_10: HTH DNA binding domain; InterPro: IPR00705 | 97.71 | |
| PRK15411 | 207 | rcsA colanic acid capsular biosynthesis activation | 97.59 | |
| PRK11475 | 207 | DNA-binding transcriptional activator BglJ; Provis | 97.56 | |
| PF00140 | 37 | Sigma70_r1_2: Sigma-70 factor, region 1.2; InterPr | 97.55 | |
| PRK15201 | 198 | fimbriae regulatory protein FimW; Provisional | 97.54 | |
| PRK10840 | 216 | transcriptional regulator RcsB; Provisional | 97.52 | |
| TIGR01321 | 94 | TrpR trp operon repressor, proteobacterial. This m | 97.49 | |
| PRK13719 | 217 | conjugal transfer transcriptional regulator TraJ; | 97.48 | |
| COG2197 | 211 | CitB Response regulator containing a CheY-like rec | 97.48 | |
| PF13936 | 44 | HTH_38: Helix-turn-helix domain; PDB: 2W48_A. | 97.41 | |
| COG4566 | 202 | TtrR Response regulator [Signal transduction mecha | 97.39 | |
| TIGR03541 | 232 | reg_near_HchA LuxR family transcriptional regulato | 97.38 | |
| TIGR03020 | 247 | EpsA transcriptional regulator EpsA. Proteins in t | 97.36 | |
| PRK10100 | 216 | DNA-binding transcriptional regulator CsgD; Provis | 97.36 | |
| PRK10188 | 240 | DNA-binding transcriptional activator SdiA; Provis | 97.3 | |
| PF02001 | 106 | DUF134: Protein of unknown function DUF134; InterP | 97.29 | |
| PRK13870 | 234 | transcriptional regulator TraR; Provisional | 97.27 | |
| COG2771 | 65 | CsgD DNA-binding HTH domain-containing proteins [T | 97.24 | |
| PRK09483 | 217 | response regulator; Provisional | 97.14 | |
| COG4941 | 415 | Predicted RNA polymerase sigma factor containing a | 97.11 | |
| COG2739 | 105 | Uncharacterized protein conserved in bacteria [Fun | 97.09 | |
| PRK15369 | 211 | two component system sensor kinase SsrB; Provision | 97.03 | |
| COG3413 | 215 | Predicted DNA binding protein [General function pr | 96.89 | |
| PRK10651 | 216 | transcriptional regulator NarL; Provisional | 96.82 | |
| PF04539 | 78 | Sigma70_r3: Sigma-70 region 3; InterPro: IPR007624 | 96.72 | |
| PRK09390 | 202 | fixJ response regulator FixJ; Provisional | 96.71 | |
| PRK15320 | 251 | transcriptional activator SprB; Provisional | 96.67 | |
| COG1342 | 99 | Predicted DNA-binding proteins [General function p | 96.54 | |
| PRK01381 | 99 | Trp operon repressor; Provisional | 96.52 | |
| TIGR01637 | 132 | phage_arpU phage transcriptional regulator, ArpU f | 96.34 | |
| COG1356 | 143 | tfx Transcriptional regulator [DNA replication, re | 96.34 | |
| PRK10403 | 215 | transcriptional regulator NarP; Provisional | 96.34 | |
| PF12645 | 65 | HTH_16: Helix-turn-helix domain; InterPro: IPR0247 | 96.16 | |
| PRK10360 | 196 | DNA-binding transcriptional activator UhpA; Provis | 96.16 | |
| PRK09935 | 210 | transcriptional regulator FimZ; Provisional | 96.15 | |
| PRK04841 | 903 | transcriptional regulator MalT; Provisional | 96.12 | |
| PRK13558 | 665 | bacterio-opsin activator; Provisional | 96.01 | |
| PRK09958 | 204 | DNA-binding transcriptional activator EvgA; Provis | 95.95 | |
| PF13613 | 53 | HTH_Tnp_4: Helix-turn-helix of DDE superfamily end | 95.79 | |
| PF13384 | 50 | HTH_23: Homeodomain-like domain; PDB: 2X48_C. | 95.71 | |
| PRK05658 | 619 | RNA polymerase sigma factor RpoD; Validated | 95.58 | |
| PRK15418 | 318 | transcriptional regulator LsrR; Provisional | 95.55 | |
| PF13412 | 48 | HTH_24: Winged helix-turn-helix DNA-binding; PDB: | 95.33 | |
| TIGR02531 | 88 | yecD_yerC TrpR-related protein YerC/YecD. This mod | 95.29 | |
| PF02796 | 45 | HTH_7: Helix-turn-helix domain of resolvase; Inter | 95.19 | |
| cd00569 | 42 | HTH_Hin_like Helix-turn-helix domain of Hin and re | 94.9 | |
| PF05263 | 130 | DUF722: Protein of unknown function (DUF722); Inte | 94.69 | |
| PF06056 | 58 | Terminase_5: Putative ATPase subunit of terminase | 94.3 | |
| PF00325 | 32 | Crp: Bacterial regulatory proteins, crp family; In | 94.23 | |
| PF06530 | 125 | Phage_antitermQ: Phage antitermination protein Q; | 94.16 | |
| COG2909 | 894 | MalT ATP-dependent transcriptional regulator [Tran | 93.89 | |
| PF01726 | 65 | LexA_DNA_bind: LexA DNA binding domain; InterPro: | 93.89 | |
| PF13404 | 42 | HTH_AsnC-type: AsnC-type helix-turn-helix domain; | 93.79 | |
| PRK10430 | 239 | DNA-binding transcriptional activator DcuR; Provis | 93.63 | |
| PF04539 | 78 | Sigma70_r3: Sigma-70 region 3; InterPro: IPR007624 | 93.51 | |
| PF13518 | 52 | HTH_28: Helix-turn-helix domain | 93.5 | |
| PF10668 | 60 | Phage_terminase: Phage terminase small subunit; In | 93.4 | |
| COG2390 | 321 | DeoR Transcriptional regulator, contains sigma fac | 93.39 | |
| smart00351 | 125 | PAX Paired Box domain. | 93.07 | |
| PF09862 | 113 | DUF2089: Protein of unknown function (DUF2089); In | 92.71 | |
| PF12802 | 62 | MarR_2: MarR family; PDB: 3ECO_B 2QWW_B 3KP6_B 3KP | 92.44 | |
| PF04218 | 53 | CENP-B_N: CENP-B N-terminal DNA-binding domain; In | 92.21 | |
| PF01022 | 47 | HTH_5: Bacterial regulatory protein, arsR family; | 92.01 | |
| PF01371 | 87 | Trp_repressor: Trp repressor protein; InterPro: IP | 91.89 | |
| PF12840 | 61 | HTH_20: Helix-turn-helix domain; PDB: 1ULY_A 2CWE_ | 91.72 | |
| PF13730 | 55 | HTH_36: Helix-turn-helix domain | 91.41 | |
| PHA00675 | 78 | hypothetical protein | 91.21 | |
| PHA02591 | 83 | hypothetical protein; Provisional | 91.16 | |
| cd00131 | 128 | PAX Paired Box domain | 91.1 | |
| PF13744 | 80 | HTH_37: Helix-turn-helix domain; PDB: 2A6C_B 2O38_ | 90.48 | |
| PF08279 | 55 | HTH_11: HTH domain; InterPro: IPR013196 Winged hel | 89.95 | |
| PF13022 | 142 | HTH_Tnp_1_2: Helix-turn-helix of insertion element | 89.91 | |
| smart00550 | 68 | Zalpha Z-DNA-binding domain in adenosine deaminase | 89.9 | |
| PF01418 | 77 | HTH_6: Helix-turn-helix domain, rpiR family; Inter | 89.76 | |
| PF01325 | 60 | Fe_dep_repress: Iron dependent repressor, N-termin | 89.62 | |
| COG3415 | 138 | Transposase and inactivated derivatives [DNA repli | 89.39 | |
| PF13542 | 52 | HTH_Tnp_ISL3: Helix-turn-helix domain of transposa | 89.2 | |
| TIGR02395 | 429 | rpoN_sigma RNA polymerase sigma-54 factor. A sigma | 89.03 | |
| PRK11083 | 228 | DNA-binding response regulator CreB; Provisional | 88.79 | |
| PF00356 | 46 | LacI: Bacterial regulatory proteins, lacI family; | 88.72 | |
| PF01710 | 119 | HTH_Tnp_IS630: Transposase; InterPro: IPR002622 Tr | 88.57 | |
| PRK11179 | 153 | DNA-binding transcriptional regulator AsnC; Provis | 88.5 | |
| PF03444 | 78 | HrcA_DNA-bdg: Winged helix-turn-helix transcriptio | 88.15 | |
| PRK10046 | 225 | dpiA two-component response regulator DpiA; Provis | 88.13 | |
| PRK10336 | 219 | DNA-binding transcriptional regulator QseB; Provis | 88.0 | |
| PF02650 | 85 | HTH_WhiA: WhiA C-terminal HTH domain; InterPro: IP | 87.9 | |
| PRK09413 | 121 | IS2 repressor TnpA; Reviewed | 87.86 | |
| TIGR01610 | 95 | phage_O_Nterm phage replication protein O, N-termi | 87.84 | |
| PF01047 | 59 | MarR: MarR family; InterPro: IPR000835 The MarR-ty | 87.61 | |
| PRK05932 | 455 | RNA polymerase factor sigma-54; Reviewed | 87.53 | |
| smart00344 | 108 | HTH_ASNC helix_turn_helix ASNC type. AsnC: an auto | 87.45 | |
| PRK11169 | 164 | leucine-responsive transcriptional regulator; Prov | 87.19 | |
| PRK10710 | 240 | DNA-binding transcriptional regulator BaeR; Provis | 87.04 | |
| COG2973 | 103 | TrpR Trp operon repressor [Transcription] | 87.03 | |
| PRK13413 | 200 | mpi multiple promoter invertase; Provisional | 86.89 | |
| PHA02547 | 179 | 55 RNA polymerase sigma factor; Provisional | 86.79 | |
| PF13551 | 112 | HTH_29: Winged helix-turn helix | 86.24 | |
| PF12728 | 51 | HTH_17: Helix-turn-helix domain | 85.84 | |
| PF13551 | 112 | HTH_29: Winged helix-turn helix | 85.39 | |
| TIGR02154 | 226 | PhoB phosphate regulon transcriptional regulatory | 85.35 | |
| cd04762 | 49 | HTH_MerR-trunc Helix-Turn-Helix DNA binding domain | 85.26 | |
| PRK15479 | 221 | transcriptional regulatory protein TctD; Provision | 85.25 | |
| TIGR03787 | 227 | marine_sort_RR proteobacterial dedicated sortase s | 85.18 | |
| PF13463 | 68 | HTH_27: Winged helix DNA-binding domain; PDB: 3GFL | 85.11 | |
| PF11427 | 50 | HTH_Tnp_Tc3_1: Tc3 transposase; PDB: 1U78_A 1TC3_C | 85.05 | |
| COG2522 | 119 | Predicted transcriptional regulator [General funct | 84.93 | |
| COG1191 | 247 | FliA DNA-directed RNA polymerase specialized sigma | 84.86 | |
| PF00046 | 57 | Homeobox: Homeobox domain not present here.; Inter | 84.56 | |
| PF08822 | 165 | DUF1804: Protein of unknown function (DUF1804); In | 84.4 | |
| TIGR01764 | 49 | excise DNA binding domain, excisionase family. An | 83.69 | |
| PF13011 | 85 | LZ_Tnp_IS481: leucine-zipper of insertion element | 83.67 | |
| COG1522 | 154 | Lrp Transcriptional regulators [Transcription] | 83.61 | |
| PF01527 | 76 | HTH_Tnp_1: Transposase; InterPro: IPR002514 Transp | 83.48 | |
| CHL00148 | 240 | orf27 Ycf27; Reviewed | 83.26 | |
| PRK07408 | 256 | RNA polymerase sigma factor SigF; Reviewed | 83.19 | |
| PRK12423 | 202 | LexA repressor; Provisional | 83.06 | |
| PF01978 | 68 | TrmB: Sugar-specific transcriptional regulator Trm | 82.81 | |
| PF01381 | 55 | HTH_3: Helix-turn-helix; InterPro: IPR001387 This | 82.72 | |
| PF08220 | 57 | HTH_DeoR: DeoR-like helix-turn-helix domain; Inter | 82.41 | |
| PRK09210 | 367 | RNA polymerase sigma factor RpoD; Validated | 82.35 | |
| cd04761 | 49 | HTH_MerR-SF Helix-Turn-Helix DNA binding domain of | 82.26 | |
| KOG0484 | 125 | consensus Transcription factor PHOX2/ARIX, contain | 81.95 | |
| PHA01976 | 67 | helix-turn-helix protein | 81.89 | |
| PF02954 | 42 | HTH_8: Bacterial regulatory protein, Fis family; I | 81.64 | |
| TIGR02393 | 238 | RpoD_Cterm RNA polymerase sigma factor RpoD, C-ter | 81.2 | |
| PRK14082 | 65 | hypothetical protein; Provisional | 80.92 | |
| PRK05911 | 257 | RNA polymerase sigma factor sigma-28; Reviewed | 80.75 | |
| PHA00542 | 82 | putative Cro-like protein | 80.63 | |
| COG0856 | 203 | Orotate phosphoribosyltransferase homologs [Nucleo | 80.38 | |
| smart00420 | 53 | HTH_DEOR helix_turn_helix, Deoxyribose operon repr | 80.24 | |
| TIGR00122 | 69 | birA_repr_reg BirA biotin operon repressor domain. | 80.1 |
| >PRK07598 RNA polymerase sigma factor SigC; Validated | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.4e-51 Score=430.43 Aligned_cols=290 Identities=36% Similarity=0.637 Sum_probs=264.2
Q ss_pred hhHHHHHHhhccccCCCHHHHHHHHHHHHcCCc--------------------chhHHHHHHhhhCCCCchHHHHHHhh-
Q 011454 191 NRLKGYVKGVVSEELLTHAEVVRLSKKIKTGLS--------------------LDDHKLRLKERLGCEPSMEQLAASLR- 249 (485)
Q Consensus 191 ~~~~~yl~~i~~~~~Lt~eee~~L~~~ik~Gd~--------------------l~~~~~~l~~~~g~~p~~~~~a~~~~- 249 (485)
|.++.||++|++.|+||++||++|+++++.+-. |+..+.+|++.+|++|+..+||.++|
T Consensus 60 d~v~~yl~~igr~~lL~~~eEv~l~~~vq~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~l~~~~g~~pt~~ewa~~~~~ 139 (415)
T PRK07598 60 DLVRLYLQEIGRVRLLGRDEEVSEAQKVQRYMKLIVLANAAKEGDEVIKPYLRLIEVRERLTSELGHRPSLERWAKTADI 139 (415)
T ss_pred ChHHHHHHhcccccCCCHHHHHHHHHHHHHHHHHhhhhhhhhcccchhhhHHHHHHHHHHHHHHhCCCCCHHHHHHHhCC
Confidence 688999999999999999999999999999988 88899999999999999999995555
Q ss_pred ---------------------cChhHHHHhhhhhHHHHHHHHHHhHHHHHHHHHHhcCCCCcHHHHHHHHHHHHHHhHhc
Q 011454 250 ---------------------ISRPELQSILMECSLAREKLVMSNVRLVMSIAQRYDNMGADMADLVQGGLIGLLRGIEK 308 (485)
Q Consensus 250 ---------------------~s~~~L~~~l~~~~~A~e~Lie~yl~LV~sIA~ry~~~~~d~EDLiQEG~IgL~kAiek 308 (485)
++.++|++.+..|..|+++||..|+++|+++|++|.+++.+++||+|||++|||+|+++
T Consensus 140 ~~~~l~~~l~~~~~~~~~~~~l~~~eL~~~l~~G~~A~e~LI~~nlrLVvsiAkky~~~g~~~eDLiQEG~iGL~ravek 219 (415)
T PRK07598 140 SLADLKPTLAEGKRRWAEIAKLTVEELEQIQKQGLRAKEHMIKANLRLVVSVAKKYQNRGLELLDLVQEGTLGLERAVEK 219 (415)
T ss_pred cHHHHHHhhhhhhhhhhhhccCCHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHccCCCCHHHHHHHHHHHHHHHHHH
Confidence 55566666667888999999999999999999999999999999999999999999999
Q ss_pred CCCCCCcchhhHHHHHHHHHHHHHHHHhhhhccccccHHHHHHHHHHHHHHHH-HcCCCCCHHHHHHHhCCCHHHHHHHH
Q 011454 309 FDSSKGFKISTYVYWWIRQGVSRALVENSRTLRLPNHLHERLGLIRNAKLRLE-EKGVTPSVDRIAEYLNMSQKKVRNAT 387 (485)
Q Consensus 309 FDp~rG~rFsTYA~~~Ir~~I~~~I~~~~r~irip~~~~~~~~kirka~~~L~-~~gr~ps~eEIae~L~is~eev~~~l 387 (485)
|||.+|++|+||++||||++|.+++.++.+++++|.++.+.+++++++...+. .+|+.|+.++||+.+|++++++++++
T Consensus 220 FDp~rG~rFSTYa~wwIRqaI~r~i~~~srtIrlP~~i~e~l~~lrk~~r~L~~~lgR~pt~~EiA~~l~is~~~vr~~l 299 (415)
T PRK07598 220 FDPTKGYRFSTYAYWWIRQGITRAIATQSRTIRLPVHITEKLNKIKKAQRKISQEKGRTPTIEDIAQELEMTPTQVREVL 299 (415)
T ss_pred cCcccCCCHHHHHHHHHHHHHHHHHHHcCCceehhHHHHHHHHHHHHHHHHHHHHhCCCCCHHHHHHHhCCCHHHHHHHH
Confidence 99999999999999999999999999999999999999999999999998884 78999999999999999999999987
Q ss_pred HHH-------------------HhhhcccCCCCCcchHHHHHHHHHHHHHHHhhCCHHHHHHHhhHhcc-CCCCCCHHHH
Q 011454 388 EVL-------------------AYIADNRVENNPWHGVDDWALKDEVNKLIIVTLGEREREIIRLYYGL-DKECLTWEDI 447 (485)
Q Consensus 388 ~~~-------------------~~l~D~~~e~~pee~~e~~el~e~L~~~L~~~Lp~rER~VI~LryGL-~~eg~S~eEI 447 (485)
... +++++. ...|++.+....+...|..+| +.|||+||.||.|+||| +++++|++||
T Consensus 300 ~~~~~~~SLd~~vg~~~d~~l~d~l~~~--~~~pee~~~~~~l~~~L~~~L-~~L~~reR~VI~LRygl~d~~~~Tl~EI 376 (415)
T PRK07598 300 LRVPRSVSLETKVGKDKDTELGDLLETD--DISPEEMLMRESLQRDLQHLL-ADLTSRERDVIRMRFGLADGHTYSLAEI 376 (415)
T ss_pred HHccCCcccccccCCCccccHHHhccCC--CCCHHHHHHHHHHHHHHHHHH-HhCCHHHHHHHHHHHhcCCCCCCCHHHH
Confidence 653 122211 235667777778888999999 89999999999999998 4578999999
Q ss_pred HHHHCCCHHHHHHHHHHHHHHHHHHHHhhhHHHhhh
Q 011454 448 SKRIGLSRERVRQVGLVALEKLKHAARKKKMEAMLV 483 (485)
Q Consensus 448 Ae~LgIS~~tVrqi~~rALkKLRk~L~~~~l~~~l~ 483 (485)
|+.||||+++|++++++|+++||+.-....++.|+.
T Consensus 377 A~~LGvS~erVRqie~rAl~KLR~~~~~~~l~~y~~ 412 (415)
T PRK07598 377 GRALDLSRERVRQIESKALQKLRQPKRRNRIRDYLE 412 (415)
T ss_pred HHHHCcCHHHHHHHHHHHHHHHhchhHHHHHHHHHH
Confidence 999999999999999999999999988889999985
|
|
| >PRK07406 RNA polymerase sigma factor RpoD; Validated | Back alignment and domain information |
|---|
| >PRK05949 RNA polymerase sigma factor; Validated | Back alignment and domain information |
|---|
| >TIGR02997 Sig70-cyanoRpoD RNA polymerase sigma factor, cyanobacterial RpoD-like family | Back alignment and domain information |
|---|
| >PRK07405 RNA polymerase sigma factor SigD; Validated | Back alignment and domain information |
|---|
| >PRK05901 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK07921 RNA polymerase sigma factor SigB; Reviewed | Back alignment and domain information |
|---|
| >COG0568 RpoD DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) [Transcription] | Back alignment and domain information |
|---|
| >PRK09210 RNA polymerase sigma factor RpoD; Validated | Back alignment and domain information |
|---|
| >PRK05658 RNA polymerase sigma factor RpoD; Validated | Back alignment and domain information |
|---|
| >PRK05657 RNA polymerase sigma factor RpoS; Validated | Back alignment and domain information |
|---|
| >PRK06596 RNA polymerase factor sigma-32; Reviewed | Back alignment and domain information |
|---|
| >TIGR02393 RpoD_Cterm RNA polymerase sigma factor RpoD, C-terminal domain | Back alignment and domain information |
|---|
| >PRK07500 rpoH2 RNA polymerase factor sigma-32; Reviewed | Back alignment and domain information |
|---|
| >TIGR02392 rpoH_proteo alternative sigma factor RpoH | Back alignment and domain information |
|---|
| >TIGR02394 rpoS_proteo RNA polymerase sigma factor RpoS | Back alignment and domain information |
|---|
| >PRK07122 RNA polymerase sigma factor SigF; Reviewed | Back alignment and domain information |
|---|
| >COG1191 FliA DNA-directed RNA polymerase specialized sigma subunit [Transcription] | Back alignment and domain information |
|---|
| >PRK07408 RNA polymerase sigma factor SigF; Reviewed | Back alignment and domain information |
|---|
| >TIGR02850 spore_sigG RNA polymerase sigma-G factor | Back alignment and domain information |
|---|
| >PRK08215 sporulation sigma factor SigG; Reviewed | Back alignment and domain information |
|---|
| >TIGR02941 Sigma_B RNA polymerase sigma-B factor | Back alignment and domain information |
|---|
| >PRK05911 RNA polymerase sigma factor sigma-28; Reviewed | Back alignment and domain information |
|---|
| >PRK06288 RNA polymerase sigma factor WhiG; Reviewed | Back alignment and domain information |
|---|
| >PRK08583 RNA polymerase sigma factor SigB; Validated | Back alignment and domain information |
|---|
| >TIGR02980 SigBFG RNA polymerase sigma-70 factor, sigma-B/F/G subfamily | Back alignment and domain information |
|---|
| >TIGR02885 spore_sigF RNA polymerase sigma-F factor | Back alignment and domain information |
|---|
| >PRK07670 RNA polymerase sigma factor SigD; Validated | Back alignment and domain information |
|---|
| >PRK05572 sporulation sigma factor SigF; Validated | Back alignment and domain information |
|---|
| >TIGR02479 FliA_WhiG RNA polymerase sigma factor, FliA/WhiG family | Back alignment and domain information |
|---|
| >PRK06986 fliA flagellar biosynthesis sigma factor; Validated | Back alignment and domain information |
|---|
| >PRK12427 flagellar biosynthesis sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK05803 sporulation sigma factor SigK; Reviewed | Back alignment and domain information |
|---|
| >TIGR02846 spore_sigmaK RNA polymerase sigma-K factor | Back alignment and domain information |
|---|
| >PRK08301 sporulation sigma factor SigE; Reviewed | Back alignment and domain information |
|---|
| >PRK09648 RNA polymerase sigma factor SigD; Reviewed | Back alignment and domain information |
|---|
| >TIGR02835 spore_sigmaE RNA polymerase sigma-E factor | Back alignment and domain information |
|---|
| >PRK09646 RNA polymerase sigma factor SigK; Reviewed | Back alignment and domain information |
|---|
| >PRK05602 RNA polymerase sigma factor; Reviewed | Back alignment and domain information |
|---|
| >PRK12513 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >TIGR02952 Sig70_famx2 RNA polymerase sigma-70 factor, TIGR02952 family | Back alignment and domain information |
|---|
| >PRK08295 RNA polymerase factor sigma-70; Validated | Back alignment and domain information |
|---|
| >PRK12519 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK06759 RNA polymerase factor sigma-70; Validated | Back alignment and domain information |
|---|
| >PRK11923 algU RNA polymerase sigma factor AlgU; Provisional | Back alignment and domain information |
|---|
| >PRK11922 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK12524 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK12514 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK12537 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK12534 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK12538 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK13919 putative RNA polymerase sigma E protein; Provisional | Back alignment and domain information |
|---|
| >PRK12526 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >TIGR02948 SigW_bacill RNA polymerase sigma-W factor | Back alignment and domain information |
|---|
| >PRK09652 RNA polymerase sigma factor RpoE; Provisional | Back alignment and domain information |
|---|
| >TIGR02859 spore_sigH RNA polymerase sigma-H factor | Back alignment and domain information |
|---|
| >PRK12531 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK06811 RNA polymerase factor sigma-70; Validated | Back alignment and domain information |
|---|
| >TIGR02939 RpoE_Sigma70 RNA polymerase sigma factor RpoE | Back alignment and domain information |
|---|
| >PRK12542 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK09640 RNA polymerase sigma factor SigX; Reviewed | Back alignment and domain information |
|---|
| >PRK09641 RNA polymerase sigma factor SigW; Provisional | Back alignment and domain information |
|---|
| >PRK09643 RNA polymerase sigma factor SigM; Reviewed | Back alignment and domain information |
|---|
| >PRK11924 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK12515 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >TIGR02954 Sig70_famx3 RNA polymerase sigma-70 factor, TIGR02954 family | Back alignment and domain information |
|---|
| >PRK12543 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK09638 RNA polymerase sigma factor SigY; Reviewed | Back alignment and domain information |
|---|
| >PRK12536 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK09645 RNA polymerase sigma factor SigL; Provisional | Back alignment and domain information |
|---|
| >PRK12512 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK09649 RNA polymerase sigma factor SigC; Reviewed | Back alignment and domain information |
|---|
| >TIGR03001 Sig-70_gmx1 RNA polymerase sigma-70 factor, Myxococcales family 1 | Back alignment and domain information |
|---|
| >TIGR02999 Sig-70_X6 RNA polymerase sigma factor, TIGR02999 family | Back alignment and domain information |
|---|
| >PRK12539 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK09415 RNA polymerase factor sigma C; Reviewed | Back alignment and domain information |
|---|
| >TIGR02985 Sig70_bacteroi1 RNA polymerase sigma-70 factor, Bacteroides expansion family 1 | Back alignment and domain information |
|---|
| >TIGR02989 Sig-70_gvs1 RNA polymerase sigma-70 factor, Rhodopirellula/Verrucomicrobium family | Back alignment and domain information |
|---|
| >TIGR02937 sigma70-ECF RNA polymerase sigma factor, sigma-70 family | Back alignment and domain information |
|---|
| >PRK12518 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK12520 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK12522 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK12516 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK09642 RNA polymerase sigma factor SigW; Reviewed | Back alignment and domain information |
|---|
| >PRK12535 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >TIGR02983 SigE-fam_strep RNA polymerase sigma-70 factor, sigma-E family | Back alignment and domain information |
|---|
| >TIGR02984 Sig-70_plancto1 RNA polymerase sigma-70 factor, Planctomycetaceae-specific subfamily 1 | Back alignment and domain information |
|---|
| >PRK12547 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >COG1595 RpoE DNA-directed RNA polymerase specialized sigma subunit, sigma24 homolog [Transcription] | Back alignment and domain information |
|---|
| >PRK09644 RNA polymerase sigma factor SigM; Provisional | Back alignment and domain information |
|---|
| >TIGR02947 SigH_actino RNA polymerase sigma-70 factor, TIGR02947 family | Back alignment and domain information |
|---|
| >PRK12523 RNA polymerase sigma factor; Reviewed | Back alignment and domain information |
|---|
| >PRK12533 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK12529 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK09647 RNA polymerase sigma factor SigE; Reviewed | Back alignment and domain information |
|---|
| >PRK09639 RNA polymerase sigma factor SigX; Provisional | Back alignment and domain information |
|---|
| >PRK12528 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK12541 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >TIGR02943 Sig70_famx1 RNA polymerase sigma-70 factor, TIGR02943 family | Back alignment and domain information |
|---|
| >PRK08241 RNA polymerase factor sigma-70; Validated | Back alignment and domain information |
|---|
| >PRK12540 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK12532 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK12545 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK09637 RNA polymerase sigma factor SigZ; Provisional | Back alignment and domain information |
|---|
| >PRK12530 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK12544 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >TIGR02950 SigM_subfam RNA polymerase sigma factor, SigM family | Back alignment and domain information |
|---|
| >PRK12517 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK07037 extracytoplasmic-function sigma-70 factor; Validated | Back alignment and domain information |
|---|
| >TIGR02960 SigX5 RNA polymerase sigma-70 factor, TIGR02960 family | Back alignment and domain information |
|---|
| >PRK09651 RNA polymerase sigma factor FecI; Provisional | Back alignment and domain information |
|---|
| >PRK12527 RNA polymerase sigma factor; Reviewed | Back alignment and domain information |
|---|
| >TIGR02959 SigZ RNA polymerase sigma factor, SigZ family | Back alignment and domain information |
|---|
| >PRK12546 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK12511 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >TIGR02895 spore_sigI RNA polymerase sigma-I factor | Back alignment and domain information |
|---|
| >PRK12525 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK06704 RNA polymerase factor sigma-70; Validated | Back alignment and domain information |
|---|
| >PRK09047 RNA polymerase factor sigma-70; Validated | Back alignment and domain information |
|---|
| >PRK09636 RNA polymerase sigma factor SigJ; Provisional | Back alignment and domain information |
|---|
| >TIGR02957 SigX4 RNA polymerase sigma-70 factor, TIGR02957 family | Back alignment and domain information |
|---|
| >PRK09635 sigI RNA polymerase sigma factor SigI; Provisional | Back alignment and domain information |
|---|
| >PRK09191 two-component response regulator; Provisional | Back alignment and domain information |
|---|
| >TIGR03209 P21_Cbot clostridium toxin-associated regulator BotR | Back alignment and domain information |
|---|
| >PRK08311 putative RNA polymerase sigma factor SigI; Reviewed | Back alignment and domain information |
|---|
| >PF07638 Sigma70_ECF: ECF sigma factor | Back alignment and domain information |
|---|
| >PF04542 Sigma70_r2: Sigma-70 region 2 ; InterPro: IPR007627 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription | Back alignment and domain information |
|---|
| >PF04545 Sigma70_r4: Sigma-70, region 4; InterPro: IPR007630 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription | Back alignment and domain information |
|---|
| >PF08281 Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013249 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription | Back alignment and domain information |
|---|
| >PRK06930 positive control sigma-like factor; Validated | Back alignment and domain information |
|---|
| >PRK00118 putative DNA-binding protein; Validated | Back alignment and domain information |
|---|
| >cd06171 Sigma70_r4 Sigma70, region (SR) 4 refers to the most C-terminal of four conserved domains found in Escherichia coli (Ec) sigma70, the main housekeeping sigma, and related sigma-factors (SFs) | Back alignment and domain information |
|---|
| >TIGR00721 tfx DNA-binding protein, Tfx family | Back alignment and domain information |
|---|
| >PRK03975 tfx putative transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >PRK04217 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF04297 UPF0122: Putative helix-turn-helix protein, YlxM / p13 like; InterPro: IPR007394 Members of this family are predicted to contain a helix-turn-helix motif, for example residues 37-55 in Mycoplasma mycoides p13 (O05290 from SWISSPROT) | Back alignment and domain information |
|---|
| >smart00421 HTH_LUXR helix_turn_helix, Lux Regulon | Back alignment and domain information |
|---|
| >PF00196 GerE: Bacterial regulatory proteins, luxR family; InterPro: IPR000792 This domain is a DNA-binding, helix-turn-helix (HTH) domain of about 65 amino acids, present in transcription regulators of the LuxR/FixJ family of response regulators | Back alignment and domain information |
|---|
| >TIGR01636 phage_rinA phage transcriptional activator, RinA family | Back alignment and domain information |
|---|
| >cd06170 LuxR_C_like C-terminal DNA-binding domain of LuxR-like proteins | Back alignment and domain information |
|---|
| >PF07374 DUF1492: Protein of unknown function (DUF1492); InterPro: IPR010861 This entry is represented by Streptococcus phage 7201, Orf19 | Back alignment and domain information |
|---|
| >TIGR03879 near_KaiC_dom probable regulatory domain | Back alignment and domain information |
|---|
| >PF04967 HTH_10: HTH DNA binding domain; InterPro: IPR007050 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif | Back alignment and domain information |
|---|
| >PRK15411 rcsA colanic acid capsular biosynthesis activation protein A; Provisional | Back alignment and domain information |
|---|
| >PRK11475 DNA-binding transcriptional activator BglJ; Provisional | Back alignment and domain information |
|---|
| >PF00140 Sigma70_r1_2: Sigma-70 factor, region 1 | Back alignment and domain information |
|---|
| >PRK15201 fimbriae regulatory protein FimW; Provisional | Back alignment and domain information |
|---|
| >PRK10840 transcriptional regulator RcsB; Provisional | Back alignment and domain information |
|---|
| >TIGR01321 TrpR trp operon repressor, proteobacterial | Back alignment and domain information |
|---|
| >PRK13719 conjugal transfer transcriptional regulator TraJ; Provisional | Back alignment and domain information |
|---|
| >COG2197 CitB Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription] | Back alignment and domain information |
|---|
| >PF13936 HTH_38: Helix-turn-helix domain; PDB: 2W48_A | Back alignment and domain information |
|---|
| >COG4566 TtrR Response regulator [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR03541 reg_near_HchA LuxR family transcriptional regulatory, chaperone HchA-associated | Back alignment and domain information |
|---|
| >TIGR03020 EpsA transcriptional regulator EpsA | Back alignment and domain information |
|---|
| >PRK10100 DNA-binding transcriptional regulator CsgD; Provisional | Back alignment and domain information |
|---|
| >PRK10188 DNA-binding transcriptional activator SdiA; Provisional | Back alignment and domain information |
|---|
| >PF02001 DUF134: Protein of unknown function DUF134; InterPro: IPR002852 The bacterial and archaeal proteins in this family have no known function | Back alignment and domain information |
|---|
| >PRK13870 transcriptional regulator TraR; Provisional | Back alignment and domain information |
|---|
| >COG2771 CsgD DNA-binding HTH domain-containing proteins [Transcription] | Back alignment and domain information |
|---|
| >PRK09483 response regulator; Provisional | Back alignment and domain information |
|---|
| >COG4941 Predicted RNA polymerase sigma factor containing a TPR repeat domain [Transcription] | Back alignment and domain information |
|---|
| >COG2739 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PRK15369 two component system sensor kinase SsrB; Provisional | Back alignment and domain information |
|---|
| >COG3413 Predicted DNA binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10651 transcriptional regulator NarL; Provisional | Back alignment and domain information |
|---|
| >PF04539 Sigma70_r3: Sigma-70 region 3; InterPro: IPR007624 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription | Back alignment and domain information |
|---|
| >PRK09390 fixJ response regulator FixJ; Provisional | Back alignment and domain information |
|---|
| >PRK15320 transcriptional activator SprB; Provisional | Back alignment and domain information |
|---|
| >COG1342 Predicted DNA-binding proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PRK01381 Trp operon repressor; Provisional | Back alignment and domain information |
|---|
| >TIGR01637 phage_arpU phage transcriptional regulator, ArpU family | Back alignment and domain information |
|---|
| >COG1356 tfx Transcriptional regulator [DNA replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK10403 transcriptional regulator NarP; Provisional | Back alignment and domain information |
|---|
| >PF12645 HTH_16: Helix-turn-helix domain; InterPro: IPR024760 This domain appears to be a helix-turn-helix domain, suggesting a transcriptional regulatory protein | Back alignment and domain information |
|---|
| >PRK10360 DNA-binding transcriptional activator UhpA; Provisional | Back alignment and domain information |
|---|
| >PRK09935 transcriptional regulator FimZ; Provisional | Back alignment and domain information |
|---|
| >PRK04841 transcriptional regulator MalT; Provisional | Back alignment and domain information |
|---|
| >PRK13558 bacterio-opsin activator; Provisional | Back alignment and domain information |
|---|
| >PRK09958 DNA-binding transcriptional activator EvgA; Provisional | Back alignment and domain information |
|---|
| >PF13613 HTH_Tnp_4: Helix-turn-helix of DDE superfamily endonuclease | Back alignment and domain information |
|---|
| >PF13384 HTH_23: Homeodomain-like domain; PDB: 2X48_C | Back alignment and domain information |
|---|
| >PRK05658 RNA polymerase sigma factor RpoD; Validated | Back alignment and domain information |
|---|
| >PRK15418 transcriptional regulator LsrR; Provisional | Back alignment and domain information |
|---|
| >PF13412 HTH_24: Winged helix-turn-helix DNA-binding; PDB: 1I1G_B 2IA0_B 3I4P_A 2GQQ_A 2L4A_A 2CFX_B 2DBB_B 2EFO_A 2EFQ_A 2PN6_A | Back alignment and domain information |
|---|
| >TIGR02531 yecD_yerC TrpR-related protein YerC/YecD | Back alignment and domain information |
|---|
| >PF02796 HTH_7: Helix-turn-helix domain of resolvase; InterPro: IPR006120 Site-specific recombination plays an important role in DNA rearrangement in prokaryotic organisms | Back alignment and domain information |
|---|
| >cd00569 HTH_Hin_like Helix-turn-helix domain of Hin and related proteins, a family of DNA-binding domains unique to bacteria and represented by the Hin protein of Salmonella | Back alignment and domain information |
|---|
| >PF05263 DUF722: Protein of unknown function (DUF722); InterPro: IPR007927 This entry is represented by Bacteriophage bIL285, Orf38 | Back alignment and domain information |
|---|
| >PF06056 Terminase_5: Putative ATPase subunit of terminase (gpP-like); InterPro: IPR010332 This family of proteins are annotated as ATPase subunits of phage terminase after [] | Back alignment and domain information |
|---|
| >PF00325 Crp: Bacterial regulatory proteins, crp family; InterPro: IPR001808 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif | Back alignment and domain information |
|---|
| >PF06530 Phage_antitermQ: Phage antitermination protein Q; InterPro: IPR010534 This entry is represented by Bacteriophage 933W, GpQ | Back alignment and domain information |
|---|
| >COG2909 MalT ATP-dependent transcriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >PF01726 LexA_DNA_bind: LexA DNA binding domain; InterPro: IPR006199 This is the DNA binding domain of the LexA SOS regulon repressor which prevents expression of DNA repair proteins in bacteria | Back alignment and domain information |
|---|
| >PF13404 HTH_AsnC-type: AsnC-type helix-turn-helix domain; PDB: 2ZNY_E 2ZNZ_G 1RI7_A 2CYY_A 2E1C_A 2VC1_B 2QZ8_A 2W29_C 2IVM_B 2VBX_B | Back alignment and domain information |
|---|
| >PRK10430 DNA-binding transcriptional activator DcuR; Provisional | Back alignment and domain information |
|---|
| >PF04539 Sigma70_r3: Sigma-70 region 3; InterPro: IPR007624 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription | Back alignment and domain information |
|---|
| >PF13518 HTH_28: Helix-turn-helix domain | Back alignment and domain information |
|---|
| >PF10668 Phage_terminase: Phage terminase small subunit; InterPro: IPR018925 This entry describes the terminase small subunit from Enterococcus phage phiFL1A, related proteins in other bacteriophage, and prophage regions of bacterial genomes | Back alignment and domain information |
|---|
| >COG2390 DeoR Transcriptional regulator, contains sigma factor-related N-terminal domain [Transcription] | Back alignment and domain information |
|---|
| >smart00351 PAX Paired Box domain | Back alignment and domain information |
|---|
| >PF09862 DUF2089: Protein of unknown function (DUF2089); InterPro: IPR018658 This family consists of various hypothetical prokaryotic proteins | Back alignment and domain information |
|---|
| >PF12802 MarR_2: MarR family; PDB: 3ECO_B 2QWW_B 3KP6_B 3KP4_B 3KP2_A 3KP5_A 3KP3_B 3KP7_A 3NQO_B 3K0L_B | Back alignment and domain information |
|---|
| >PF04218 CENP-B_N: CENP-B N-terminal DNA-binding domain; InterPro: IPR006695 Centromere Protein B (CENP-B) is a DNA-binding protein localized to the centromere | Back alignment and domain information |
|---|
| >PF01022 HTH_5: Bacterial regulatory protein, arsR family; InterPro: IPR001845 Bacterial transcription regulatory proteins that bind DNA via a helix-turn-helix (HTH) motif can be grouped into families on the basis of sequence similarities | Back alignment and domain information |
|---|
| >PF01371 Trp_repressor: Trp repressor protein; InterPro: IPR000831 The Trp repressor (TrpR) binds to at least five operators in the Escherichia coli genome, repressing gene expression | Back alignment and domain information |
|---|
| >PF12840 HTH_20: Helix-turn-helix domain; PDB: 1ULY_A 2CWE_A 1Y0U_B 2QUF_B 2QLZ_C 2OQG_B 2ZKZ_C 3PQK_A 3PQJ_D 3F6O_B | Back alignment and domain information |
|---|
| >PF13730 HTH_36: Helix-turn-helix domain | Back alignment and domain information |
|---|
| >PHA00675 hypothetical protein | Back alignment and domain information |
|---|
| >PHA02591 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd00131 PAX Paired Box domain | Back alignment and domain information |
|---|
| >PF13744 HTH_37: Helix-turn-helix domain; PDB: 2A6C_B 2O38_A | Back alignment and domain information |
|---|
| >PF08279 HTH_11: HTH domain; InterPro: IPR013196 Winged helix DNA-binding proteins share a related winged helix-turn-helix DNA-binding motif, where the "wings", or loops, are small beta-sheets | Back alignment and domain information |
|---|
| >PF13022 HTH_Tnp_1_2: Helix-turn-helix of insertion element transposase; PDB: 2AO9_I | Back alignment and domain information |
|---|
| >smart00550 Zalpha Z-DNA-binding domain in adenosine deaminases | Back alignment and domain information |
|---|
| >PF01418 HTH_6: Helix-turn-helix domain, rpiR family; InterPro: IPR000281 This domain contains a helix-turn-helix motif [] | Back alignment and domain information |
|---|
| >PF01325 Fe_dep_repress: Iron dependent repressor, N-terminal DNA binding domain; InterPro: IPR022687 The DtxR-type HTH domain is a DNA-binding, winged helix-turn-helix (wHTH) domain of about 65 residues present in metalloregulators of the DtxR/MntR family | Back alignment and domain information |
|---|
| >COG3415 Transposase and inactivated derivatives [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF13542 HTH_Tnp_ISL3: Helix-turn-helix domain of transposase family ISL3 | Back alignment and domain information |
|---|
| >TIGR02395 rpoN_sigma RNA polymerase sigma-54 factor | Back alignment and domain information |
|---|
| >PRK11083 DNA-binding response regulator CreB; Provisional | Back alignment and domain information |
|---|
| >PF00356 LacI: Bacterial regulatory proteins, lacI family; InterPro: IPR000843 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif | Back alignment and domain information |
|---|
| >PF01710 HTH_Tnp_IS630: Transposase; InterPro: IPR002622 Transposase proteins are necessary for efficient DNA transposition | Back alignment and domain information |
|---|
| >PRK11179 DNA-binding transcriptional regulator AsnC; Provisional | Back alignment and domain information |
|---|
| >PF03444 HrcA_DNA-bdg: Winged helix-turn-helix transcription repressor, HrcA DNA-binding; InterPro: IPR005104 Prokaryotic cells have a defence mechanism against a sudden heat-shock stress | Back alignment and domain information |
|---|
| >PRK10046 dpiA two-component response regulator DpiA; Provisional | Back alignment and domain information |
|---|
| >PRK10336 DNA-binding transcriptional regulator QseB; Provisional | Back alignment and domain information |
|---|
| >PF02650 HTH_WhiA: WhiA C-terminal HTH domain; InterPro: IPR023054 This domain is found at the C terminus of the sporulation regulator WhiA | Back alignment and domain information |
|---|
| >PRK09413 IS2 repressor TnpA; Reviewed | Back alignment and domain information |
|---|
| >TIGR01610 phage_O_Nterm phage replication protein O, N-terminal domain | Back alignment and domain information |
|---|
| >PF01047 MarR: MarR family; InterPro: IPR000835 The MarR-type HTH domain is a DNA-binding, winged helix-turn-helix (wHTH) domain of about 135 amino acids present in transcription regulators of the MarR/SlyA family, involved in the development of antibiotic resistance | Back alignment and domain information |
|---|
| >PRK05932 RNA polymerase factor sigma-54; Reviewed | Back alignment and domain information |
|---|
| >smart00344 HTH_ASNC helix_turn_helix ASNC type | Back alignment and domain information |
|---|
| >PRK11169 leucine-responsive transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >PRK10710 DNA-binding transcriptional regulator BaeR; Provisional | Back alignment and domain information |
|---|
| >COG2973 TrpR Trp operon repressor [Transcription] | Back alignment and domain information |
|---|
| >PRK13413 mpi multiple promoter invertase; Provisional | Back alignment and domain information |
|---|
| >PHA02547 55 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PF13551 HTH_29: Winged helix-turn helix | Back alignment and domain information |
|---|
| >PF12728 HTH_17: Helix-turn-helix domain | Back alignment and domain information |
|---|
| >PF13551 HTH_29: Winged helix-turn helix | Back alignment and domain information |
|---|
| >TIGR02154 PhoB phosphate regulon transcriptional regulatory protein PhoB | Back alignment and domain information |
|---|
| >cd04762 HTH_MerR-trunc Helix-Turn-Helix DNA binding domain of truncated MerR-like proteins | Back alignment and domain information |
|---|
| >PRK15479 transcriptional regulatory protein TctD; Provisional | Back alignment and domain information |
|---|
| >TIGR03787 marine_sort_RR proteobacterial dedicated sortase system response regulator | Back alignment and domain information |
|---|
| >PF13463 HTH_27: Winged helix DNA-binding domain; PDB: 3GFL_A 2YR2_B 3GFM_A 3GFJ_A 3GF2_A 3GEZ_A 2GXG_A 3GFI_A 2EB7_A | Back alignment and domain information |
|---|
| >PF11427 HTH_Tnp_Tc3_1: Tc3 transposase; PDB: 1U78_A 1TC3_C | Back alignment and domain information |
|---|
| >COG2522 Predicted transcriptional regulator [General function prediction only] | Back alignment and domain information |
|---|
| >COG1191 FliA DNA-directed RNA polymerase specialized sigma subunit [Transcription] | Back alignment and domain information |
|---|
| >PF00046 Homeobox: Homeobox domain not present here | Back alignment and domain information |
|---|
| >PF08822 DUF1804: Protein of unknown function (DUF1804); InterPro: IPR014926 This entry is represented by Bacteriophage D3112, Orf24 | Back alignment and domain information |
|---|
| >TIGR01764 excise DNA binding domain, excisionase family | Back alignment and domain information |
|---|
| >PF13011 LZ_Tnp_IS481: leucine-zipper of insertion element IS481 | Back alignment and domain information |
|---|
| >COG1522 Lrp Transcriptional regulators [Transcription] | Back alignment and domain information |
|---|
| >PF01527 HTH_Tnp_1: Transposase; InterPro: IPR002514 Transposase proteins are necessary for efficient DNA transposition | Back alignment and domain information |
|---|
| >CHL00148 orf27 Ycf27; Reviewed | Back alignment and domain information |
|---|
| >PRK07408 RNA polymerase sigma factor SigF; Reviewed | Back alignment and domain information |
|---|
| >PRK12423 LexA repressor; Provisional | Back alignment and domain information |
|---|
| >PF01978 TrmB: Sugar-specific transcriptional regulator TrmB; InterPro: IPR002831 TrmB, is a protein of 38,800 apparent molecular weight, that is involved in the maltose-specific regulation of the trehalose/maltose ABC transport operon in Thermococcus litoralis | Back alignment and domain information |
|---|
| >PF01381 HTH_3: Helix-turn-helix; InterPro: IPR001387 This is large family of DNA binding helix-turn helix proteins that include a bacterial plasmid copy control protein, bacterial methylases, various bacteriophage transcription control proteins and a vegetative specific protein from Dictyostelium discoideum (Slime mould) | Back alignment and domain information |
|---|
| >PF08220 HTH_DeoR: DeoR-like helix-turn-helix domain; InterPro: IPR001034 The deoR-type HTH domain is a DNA-binding, helix-turn-helix (HTH) domain of about 50-60 amino acids present in transcription regulators of the deoR family, involved in sugar catabolism | Back alignment and domain information |
|---|
| >PRK09210 RNA polymerase sigma factor RpoD; Validated | Back alignment and domain information |
|---|
| >cd04761 HTH_MerR-SF Helix-Turn-Helix DNA binding domain of transcription regulators from the MerR superfamily | Back alignment and domain information |
|---|
| >KOG0484 consensus Transcription factor PHOX2/ARIX, contains HOX domain [Transcription] | Back alignment and domain information |
|---|
| >PHA01976 helix-turn-helix protein | Back alignment and domain information |
|---|
| >PF02954 HTH_8: Bacterial regulatory protein, Fis family; InterPro: IPR002197 The Factor for Inversion Stimulation (FIS) protein is a regulator of bacterial functions, and binds specifically to weakly related DNA sequences [,] | Back alignment and domain information |
|---|
| >TIGR02393 RpoD_Cterm RNA polymerase sigma factor RpoD, C-terminal domain | Back alignment and domain information |
|---|
| >PRK14082 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK05911 RNA polymerase sigma factor sigma-28; Reviewed | Back alignment and domain information |
|---|
| >PHA00542 putative Cro-like protein | Back alignment and domain information |
|---|
| >COG0856 Orotate phosphoribosyltransferase homologs [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >smart00420 HTH_DEOR helix_turn_helix, Deoxyribose operon repressor | Back alignment and domain information |
|---|
| >TIGR00122 birA_repr_reg BirA biotin operon repressor domain | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 485 | ||||
| 4igc_X | 613 | X-ray Crystal Structure Of Escherichia Coli Sigma70 | 1e-32 | ||
| 3iyd_F | 613 | Three-Dimensional Em Structure Of An Intact Activat | 2e-32 | ||
| 1l9u_H | 332 | Thermus Aquaticus Rna Polymerase Holoenzyme At 4 A | 4e-30 | ||
| 1l9z_H | 438 | Thermus Aquaticus Rna Polymerase HoloenzymeFORK-Jun | 7e-30 | ||
| 3dxj_F | 423 | Crystal Structure Of Thermus Thermophilus Rna Polym | 1e-29 | ||
| 1iw7_F | 423 | Crystal Structure Of The Rna Polymerase Holoenzyme | 1e-29 | ||
| 4g7h_F | 443 | Crystal Structure Of Thermus Thermophilus Transcrip | 1e-29 | ||
| 3ugo_A | 245 | Crystal Structure Of Rna-Polymerase Sigma Subunit D | 2e-23 | ||
| 1ku2_A | 241 | Crystal Structure Of Thermus Aquaticus Rna Polymera | 3e-23 | ||
| 1l0o_C | 243 | Crystal Structure Of The Bacillus Stearothermophilu | 4e-18 | ||
| 3les_A | 179 | 2f5 Epitope Scaffold Es2 Length = 179 | 6e-17 | ||
| 1sig_A | 339 | Crystal Structure Of A Sigma70 Subunit Fragment Fro | 6e-17 | ||
| 4g6d_A | 73 | G1 Orf67 / Staphyloccus Aureus Sigmaa Domain 4 Comp | 6e-07 | ||
| 1tty_A | 87 | Solution Structure Of Sigma A Region 4 From Thermot | 5e-06 | ||
| 1tlh_B | 81 | T4 Asia Bound To Sigma70 Region 4 Length = 81 | 6e-05 | ||
| 2p7v_B | 68 | Crystal Structure Of The Escherichia Coli Regulator | 1e-04 | ||
| 1rp3_A | 239 | Cocrystal Structure Of The Flagellar SigmaANTI-Sigm | 1e-04 | ||
| 3t72_q | 99 | Phob(E)-Sigma70(4)-(Rnap-Betha-Flap-Tip-Helix)-Dna | 2e-04 | ||
| 4g94_A | 62 | G1 Orf67 / Staphyloccus Aureus Sigmaa Domain 4 Comp | 2e-04 |
| >pdb|4IGC|X Chain X, X-ray Crystal Structure Of Escherichia Coli Sigma70 Holoenzyme Length = 613 | Back alignment and structure |
|
| >pdb|3IYD|F Chain F, Three-Dimensional Em Structure Of An Intact Activator-Dependent Transcription Initiation Complex Length = 613 | Back alignment and structure |
| >pdb|1L9U|H Chain H, Thermus Aquaticus Rna Polymerase Holoenzyme At 4 A Resolution Length = 332 | Back alignment and structure |
| >pdb|1L9Z|H Chain H, Thermus Aquaticus Rna Polymerase HoloenzymeFORK-Junction Promoter Dna Complex At 6.5 A Resolution Length = 438 | Back alignment and structure |
| >pdb|3DXJ|F Chain F, Crystal Structure Of Thermus Thermophilus Rna Polymerase Holoenzyme In Complex With The Antibiotic Myxopyronin Length = 423 | Back alignment and structure |
| >pdb|1IW7|F Chain F, Crystal Structure Of The Rna Polymerase Holoenzyme From Thermus Thermophilus At 2.6a Resolution Length = 423 | Back alignment and structure |
| >pdb|4G7H|F Chain F, Crystal Structure Of Thermus Thermophilus Transcription Initiation Complex Length = 443 | Back alignment and structure |
| >pdb|3UGO|A Chain A, Crystal Structure Of Rna-Polymerase Sigma Subunit Domain 2 Complexed With -10 Promoter Element Ssdna Oligo (Tacaat) Length = 245 | Back alignment and structure |
| >pdb|1KU2|A Chain A, Crystal Structure Of Thermus Aquaticus Rna Polymerase Sigma Subunit Fragment Containing Regions 1.2 To 3.1 Length = 241 | Back alignment and structure |
| >pdb|1L0O|C Chain C, Crystal Structure Of The Bacillus Stearothermophilus Anti- Sigma Factor Spoiiab With The Sporulation Sigma Factor Sigmaf Length = 243 | Back alignment and structure |
| >pdb|3LES|A Chain A, 2f5 Epitope Scaffold Es2 Length = 179 | Back alignment and structure |
| >pdb|1SIG|A Chain A, Crystal Structure Of A Sigma70 Subunit Fragment From Escherichia Coli Rna Polymerase Length = 339 | Back alignment and structure |
| >pdb|4G6D|A Chain A, G1 Orf67 / Staphyloccus Aureus Sigmaa Domain 4 Complex Length = 73 | Back alignment and structure |
| >pdb|1TTY|A Chain A, Solution Structure Of Sigma A Region 4 From Thermotoga Maritima Length = 87 | Back alignment and structure |
| >pdb|1TLH|B Chain B, T4 Asia Bound To Sigma70 Region 4 Length = 81 | Back alignment and structure |
| >pdb|2P7V|B Chain B, Crystal Structure Of The Escherichia Coli Regulator Of Sigma 70, Rsd, In Complex With Sigma 70 Domain 4 Length = 68 | Back alignment and structure |
| >pdb|1RP3|A Chain A, Cocrystal Structure Of The Flagellar SigmaANTI-Sigma Complex, Sigma-28FLGM Length = 239 | Back alignment and structure |
| >pdb|3T72|QQ Chain q, Phob(E)-Sigma70(4)-(Rnap-Betha-Flap-Tip-Helix)-Dna Transcription Activation Sub-Complex Length = 99 | Back alignment and structure |
| >pdb|4G94|A Chain A, G1 Orf67 / Staphyloccus Aureus Sigmaa Domain 4 Complex Length = 62 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 485 | |||
| 1l0o_C | 243 | Sigma factor; bergerat fold, helix-turn-helix, pro | 4e-45 | |
| 3iyd_F | 613 | RNA polymerase sigma factor RPOD; transcription, i | 1e-43 | |
| 2a6h_F | 423 | RNA polymerase sigma factor RPOD; RNA polymerase h | 2e-43 | |
| 1l9z_H | 438 | Sigma factor SIGA; helix-turn-helix, coiled-coil, | 4e-42 | |
| 1rp3_A | 239 | RNA polymerase sigma factor sigma-28 (FLIA); trans | 1e-37 | |
| 3ugo_A | 245 | RNA polymerase sigma factor; protein-DNA complex, | 2e-32 | |
| 1sig_A | 339 | Sigma70, RNA polymerase primary sigma factor; RNA | 7e-20 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-13 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-11 | |
| 1tty_A | 87 | Sigma-A, RNA polymerase sigma factor RPOD; helix-t | 1e-11 | |
| 3t72_q | 99 | RNA polymerase sigma factor RPOD, DNA-directed RN | 3e-11 | |
| 2p7v_B | 68 | Sigma-70, RNA polymerase sigma factor RPOD; RSD, r | 9e-11 | |
| 3mzy_A | 164 | RNA polymerase sigma-H factor; PSI, MCSG, structur | 2e-10 | |
| 1ku3_A | 73 | Sigma factor SIGA; helix-turn-helix, transcription | 7e-09 |
| >1l0o_C Sigma factor; bergerat fold, helix-turn-helix, protein binding; HET: ADP; 2.90A {Geobacillus stearothermophilus} SCOP: a.4.13.2 Length = 243 | Back alignment and structure |
|---|
Score = 156 bits (398), Expect = 4e-45
Identities = 69/224 (30%), Positives = 111/224 (49%), Gaps = 27/224 (12%)
Query: 265 AREKLVMSNVRLVMSIAQRYDNMGADMADLVQGGLIGLLRGIEKFDSSKGFKISTYVYWW 324
AR++++ N+RLV S+ QR+ N G + DL Q G IGLL+ ++KFD S K STY
Sbjct: 29 ARDEIIEKNMRLVWSVVQRFLNRGYEADDLFQIGCIGLLKSVDKFDLSYDVKFSTYAVPM 88
Query: 325 IRQGVSRALVENSRTLRLPNHLHERLGLIRNAKLRL-EEKGVTPSVDRIAEYLNMSQKKV 383
I + R L ++ T+++ L E IR AK L + +G P+V IA++L +S + V
Sbjct: 89 IIGEIQRFLRDDG-TVKVSRSLKEMGNKIRKAKDELSKTRGRAPTVTEIADHLGISPEDV 147
Query: 384 RNATEVL-----------------AYIADNRVENNPWHGVDDWALKDEVNKLIIVTLGER 426
A E + + D + + D ALK I L ER
Sbjct: 148 VLAQEAVRLPTSIHETVYENDGDPITLLDQIADADEASWFDKIALKK-----AIEELDER 202
Query: 427 EREIIRLYYGLDKECLTWEDISKRIGLSRERVRQVGLVALEKLK 470
ER I+ L Y D+ T +++ R+G+S+ ++ ++ L+ +K
Sbjct: 203 ERLIVYLRYYKDQ---TQSEVASRLGISQVQMSRLEKKILQHIK 243
|
| >3iyd_F RNA polymerase sigma factor RPOD; transcription, initiation, class I, activator, RNA polymeras holoenzyme, sigma70, open complex, CAP, CRP; HET: DNA CMP; 19.80A {Escherichia coli k-12} Length = 613 | Back alignment and structure |
|---|
| >2a6h_F RNA polymerase sigma factor RPOD; RNA polymerase holoenzyme, streptolydigin, antibiotic, transcription regulation; HET: STD; 2.40A {Thermus thermophilus} SCOP: a.4.13.1 a.4.13.2 a.177.1.1 PDB: 1smy_F* 1zyr_F* 1iw7_F* 2a69_F* 2a6e_F 2a68_F* 2be5_F* 2cw0_F 3eql_F* 3dxj_F* 1l9u_H Length = 423 | Back alignment and structure |
|---|
| >1l9z_H Sigma factor SIGA; helix-turn-helix, coiled-coil, transcription/DNA complex; 6.50A {Thermus aquaticus} SCOP: i.8.1.1 Length = 438 | Back alignment and structure |
|---|
| >1rp3_A RNA polymerase sigma factor sigma-28 (FLIA); transcription; 2.30A {Aquifex aeolicus} SCOP: a.4.13.1 a.4.13.2 a.177.1.1 PDB: 1sc5_A Length = 239 | Back alignment and structure |
|---|
| >3ugo_A RNA polymerase sigma factor; protein-DNA complex, bacterial promoter opening, G-quartet, quadruplex, DNA binding; 2.10A {Thermus aquaticus} PDB: 3ugp_A 1ku2_A 3lev_A* 3les_A* Length = 245 | Back alignment and structure |
|---|
| >1sig_A Sigma70, RNA polymerase primary sigma factor; RNA polymerase sigma factor, transcription regulation; 2.60A {Escherichia coli} SCOP: a.177.1.1 Length = 339 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1tty_A Sigma-A, RNA polymerase sigma factor RPOD; helix-turn-helix, transcription; NMR {Thermotoga maritima} SCOP: a.4.13.2 Length = 87 | Back alignment and structure |
|---|
| >3t72_q RNA polymerase sigma factor RPOD, DNA-directed RN polymerase subunit beta; winged-helix motif, transcription activation, DNA-binding; 4.33A {Escherichia coli} PDB: 1tlh_B Length = 99 | Back alignment and structure |
|---|
| >2p7v_B Sigma-70, RNA polymerase sigma factor RPOD; RSD, regulator of sigma 70, sigma 70 domain 4, transcription, regulation, helix-turn-helix; 2.60A {Escherichia coli} SCOP: a.4.13.2 Length = 68 | Back alignment and structure |
|---|
| >3mzy_A RNA polymerase sigma-H factor; PSI, MCSG, structural genomics, midwest center for structura genomics, protein structure initiative; 2.50A {Fusobacterium nucleatum subsp} Length = 164 | Back alignment and structure |
|---|
| >1ku3_A Sigma factor SIGA; helix-turn-helix, transcription; 1.80A {Thermus aquaticus} SCOP: a.4.13.2 PDB: 1ku7_A 1rio_H 3n97_A* Length = 73 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 485 | |||
| 1l9z_H | 438 | Sigma factor SIGA; helix-turn-helix, coiled-coil, | 100.0 | |
| 2a6h_F | 423 | RNA polymerase sigma factor RPOD; RNA polymerase h | 100.0 | |
| 3iyd_F | 613 | RNA polymerase sigma factor RPOD; transcription, i | 100.0 | |
| 1rp3_A | 239 | RNA polymerase sigma factor sigma-28 (FLIA); trans | 99.96 | |
| 3ugo_A | 245 | RNA polymerase sigma factor; protein-DNA complex, | 99.96 | |
| 1l0o_C | 243 | Sigma factor; bergerat fold, helix-turn-helix, pro | 99.95 | |
| 1or7_A | 194 | Sigma-24, RNA polymerase sigma-E factor; regulatio | 99.91 | |
| 2q1z_A | 184 | RPOE, ECF SIGE; ECF sigma factor, cupin fold, zinc | 99.89 | |
| 3mzy_A | 164 | RNA polymerase sigma-H factor; PSI, MCSG, structur | 99.84 | |
| 2lfw_A | 157 | PHYR sigma-like domain; signal transduction, respo | 99.77 | |
| 3n0r_A | 286 | Response regulator; sigma factor, receiver, two-co | 99.65 | |
| 1sig_A | 339 | Sigma70, RNA polymerase primary sigma factor; RNA | 99.62 | |
| 3t72_q | 99 | RNA polymerase sigma factor RPOD, DNA-directed RN | 99.44 | |
| 3hug_A | 92 | RNA polymerase sigma factor; ECF sigma factor, zin | 99.3 | |
| 2p7v_B | 68 | Sigma-70, RNA polymerase sigma factor RPOD; RSD, r | 99.2 | |
| 1tty_A | 87 | Sigma-A, RNA polymerase sigma factor RPOD; helix-t | 99.16 | |
| 2o7g_A | 112 | Probable RNA polymerase sigma-C factor; sigma fact | 99.14 | |
| 1ku3_A | 73 | Sigma factor SIGA; helix-turn-helix, transcription | 99.06 | |
| 2o8x_A | 70 | Probable RNA polymerase sigma-C factor; promoter r | 99.02 | |
| 1h3l_A | 87 | RNA polymerase sigma factor; transcription, DNA-bi | 98.99 | |
| 1xsv_A | 113 | Hypothetical UPF0122 protein SAV1236; helix-turn-h | 98.91 | |
| 1s7o_A | 113 | Hypothetical UPF0122 protein SPY1201/SPYM3_0842/SP | 98.76 | |
| 3clo_A | 258 | Transcriptional regulator; NP_811094.1, bacterial | 98.73 | |
| 3c57_A | 95 | Two component transcriptional regulatory protein; | 98.56 | |
| 2rnj_A | 91 | Response regulator protein VRAR; HTH LUXR-type dom | 98.55 | |
| 1x3u_A | 79 | Transcriptional regulatory protein FIXJ; helix-tur | 98.53 | |
| 1jhg_A | 101 | Trp operon repressor; complex (regulatory protein- | 98.5 | |
| 1je8_A | 82 | Nitrate/nitrite response regulator protein NARL; p | 98.43 | |
| 1fse_A | 74 | GERE; helix-turn-helix DNA-binding protein transcr | 98.23 | |
| 3ulq_B | 90 | Transcriptional regulatory protein COMA; tetratric | 98.16 | |
| 1p4w_A | 99 | RCSB; solution structure, DNA binding domain, DNA | 98.06 | |
| 2jpc_A | 61 | SSRB; DNA binding protein, structural genomics, PS | 98.04 | |
| 2q0o_A | 236 | Probable transcriptional activator protein TRAR; h | 97.64 | |
| 1l3l_A | 234 | Transcriptional activator protein TRAR; helix-turn | 97.62 | |
| 3szt_A | 237 | QCSR, quorum-sensing control repressor; quorum sen | 97.51 | |
| 3qp6_A | 265 | CVIR transcriptional regulator; quorum sensing, ag | 97.37 | |
| 1tc3_C | 51 | Protein (TC3 transposase); DNA binding, helix-turn | 97.28 | |
| 2w7n_A | 101 | TRFB transcriptional repressor protein; INCP, plas | 97.12 | |
| 2x48_A | 55 | CAG38821; archeal virus, viral protein; 2.60A {Sul | 96.84 | |
| 1yio_A | 208 | Response regulatory protein; transcription regulat | 96.77 | |
| 1a04_A | 215 | Nitrate/nitrite response regulator protein NARL; s | 96.65 | |
| 3c3w_A | 225 | Two component transcriptional regulatory protein; | 96.45 | |
| 3klo_A | 225 | Transcriptional regulator VPST; REC domain, HTH do | 95.92 | |
| 3p7n_A | 258 | Sensor histidine kinase; LOV domain, light-activat | 95.14 | |
| 1jko_C | 52 | HIN recombinase, DNA-invertase HIN; water-mediated | 94.64 | |
| 1p2f_A | 220 | Response regulator; DRRB, OMPR/PHOB, transcription | 94.59 | |
| 3kor_A | 119 | Possible Trp repressor; putative DNA-binding Trp r | 94.55 | |
| 2gwr_A | 238 | DNA-binding response regulator MTRA; two-component | 94.33 | |
| 2oqr_A | 230 | Sensory transduction protein REGX3; response regul | 94.26 | |
| 1kgs_A | 225 | DRRD, DNA binding response regulator D; DNA-bindin | 93.8 | |
| 1ys7_A | 233 | Transcriptional regulatory protein PRRA; response | 93.59 | |
| 1zx4_A | 192 | P1 PARB, plasmid partition PAR B protein, PARB; tr | 93.09 | |
| 1u78_A | 141 | TC3 transposase, transposable element TC3 transpos | 93.0 | |
| 1pdn_C | 128 | Protein (PRD paired); protein-DNA complex, double | 92.99 | |
| 3q9s_A | 249 | DNA-binding response regulator; DNA binding protei | 92.32 | |
| 2hqr_A | 223 | Putative transcriptional regulator; phosporylation | 92.3 | |
| 3ugo_A | 245 | RNA polymerase sigma factor; protein-DNA complex, | 92.03 | |
| 1k78_A | 149 | Paired box protein PAX5; paired domain, ETS domain | 91.83 | |
| 2elh_A | 87 | CG11849-PA, LD40883P; structural genomics, NPPSFA, | 91.46 | |
| 1qgp_A | 77 | Protein (double stranded RNA adenosine deaminase); | 91.14 | |
| 1oyi_A | 82 | Double-stranded RNA-binding protein; (alpha+beta) | 90.84 | |
| 3r0j_A | 250 | Possible two component system response transcript | 90.51 | |
| 3frw_A | 107 | Putative Trp repressor protein; structural genomic | 90.2 | |
| 1qbj_A | 81 | Protein (double-stranded RNA specific adenosine D | 90.11 | |
| 2glo_A | 59 | Brinker CG9653-PA; protein-DNA complex, helix-turn | 90.0 | |
| 3k2z_A | 196 | LEXA repressor; winged helix-turn-helix, SOS syste | 89.94 | |
| 2w48_A | 315 | Sorbitol operon regulator; SORC, activator, repres | 89.74 | |
| 3r0a_A | 123 | Putative transcriptional regulator; structural gen | 89.56 | |
| 2lkp_A | 119 | Transcriptional regulator, ARSR family; symmetric | 89.54 | |
| 2heo_A | 67 | Z-DNA binding protein 1; protein DLM1-Z-DNA comple | 89.45 | |
| 2jn6_A | 97 | Protein CGL2762, transposase; GFT PSI-2, protein s | 89.45 | |
| 2cfx_A | 144 | HTH-type transcriptional regulator LRPC; transcrip | 89.13 | |
| 2o3f_A | 111 | Putative HTH-type transcriptional regulator YBBH; | 89.05 | |
| 1uxc_A | 65 | FRUR (1-57), fructose repressor; DNA-binding prote | 89.04 | |
| 3iyd_F | 613 | RNA polymerase sigma factor RPOD; transcription, i | 89.02 | |
| 2k27_A | 159 | Paired box protein PAX-8; paired domain, solution | 88.32 | |
| 2d1h_A | 109 | ST1889, 109AA long hypothetical transcriptional re | 88.31 | |
| 1r1u_A | 106 | CZRA, repressor protein; zinc, DNA binding, transc | 88.27 | |
| 2w25_A | 150 | Probable transcriptional regulatory protein; trans | 87.92 | |
| 3tgn_A | 146 | ADC operon repressor ADCR; helix-turn-helix, trans | 87.89 | |
| 2cyy_A | 151 | Putative HTH-type transcriptional regulator PH151; | 87.85 | |
| 2p5v_A | 162 | Transcriptional regulator, LRP/ASNC family; NMB057 | 87.52 | |
| 2dbb_A | 151 | Putative HTH-type transcriptional regulator PH006; | 87.39 | |
| 1sfx_A | 109 | Conserved hypothetical protein AF2008; structural | 87.37 | |
| 2cg4_A | 152 | Regulatory protein ASNC; DNA binding, FFRP, LRP fa | 87.36 | |
| 2pn6_A | 150 | ST1022, 150AA long hypothetical transcriptional re | 87.29 | |
| 3pqk_A | 102 | Biofilm growth-associated repressor; helix-turn-he | 87.25 | |
| 2zkz_A | 99 | Transcriptional repressor PAGR; protein-DNA, HTH m | 87.16 | |
| 3iwf_A | 107 | Transcription regulator RPIR family; transcription | 87.15 | |
| 3i4p_A | 162 | Transcriptional regulator, ASNC family; PSI, struc | 86.99 | |
| 3jth_A | 98 | Transcription activator HLYU; transcription factor | 86.92 | |
| 3nqo_A | 189 | MARR-family transcriptional regulator; structural | 86.83 | |
| 1i1g_A | 141 | Transcriptional regulator LRPA; helix-turn-helix, | 86.69 | |
| 1u78_A | 141 | TC3 transposase, transposable element TC3 transpos | 86.13 | |
| 3ech_A | 142 | MEXR, multidrug resistance operon repressor; winge | 85.97 | |
| 2l0k_A | 93 | Stage III sporulation protein D; SPOIIID, solution | 85.87 | |
| 2e1c_A | 171 | Putative HTH-type transcriptional regulator PH151; | 85.78 | |
| 3cuo_A | 99 | Uncharacterized HTH-type transcriptional regulato; | 85.74 | |
| 3eco_A | 139 | MEPR; mutlidrug efflux pump regulator winged helix | 85.68 | |
| 1r1t_A | 122 | Transcriptional repressor SMTB; zinc, transcriptio | 85.66 | |
| 2dk5_A | 91 | DNA-directed RNA polymerase III 39 kDa polypeptide | 85.46 | |
| 3bro_A | 141 | Transcriptional regulator; helix_TURN_helix, multi | 85.31 | |
| 2kko_A | 108 | Possible transcriptional regulatory protein (possi | 84.82 | |
| 2ia0_A | 171 | Putative HTH-type transcriptional regulator PF086; | 84.59 | |
| 2gxg_A | 146 | 146AA long hypothetical transcriptional regulator; | 84.57 | |
| 2x4h_A | 139 | Hypothetical protein SSO2273; transcription; 2.30A | 84.56 | |
| 2oqg_A | 114 | Possible transcriptional regulator, ARSR family P; | 84.32 | |
| 2fu4_A | 83 | Ferric uptake regulation protein; DNA binding doma | 84.19 | |
| 1ku9_A | 152 | Hypothetical protein MJ223; putative transcription | 83.95 | |
| 1q1h_A | 110 | TFE, transcription factor E, TFE; TFIIE, transcrip | 83.84 | |
| 3bdd_A | 142 | Regulatory protein MARR; putative multiple antibio | 83.77 | |
| 2fa5_A | 162 | Transcriptional regulator MARR/EMRR family; multip | 83.54 | |
| 1uly_A | 192 | Hypothetical protein PH1932; helix-turn-helix, str | 83.54 | |
| 1jhf_A | 202 | LEXA repressor; LEXA SOS repressor, hydrolase; 1.8 | 83.4 | |
| 3bpv_A | 138 | Transcriptional regulator; MARR, DNA binding, tran | 83.29 | |
| 3hsr_A | 140 | HTH-type transcriptional regulator SARZ; helix-tur | 82.83 | |
| 3cdh_A | 155 | Transcriptional regulator, MARR family; helix-turn | 82.8 | |
| 2a6c_A | 83 | Helix-turn-helix motif; putative transcriptional r | 82.67 | |
| 1hlv_A | 131 | CENP-B, major centromere autoantigen B; helix-turn | 82.49 | |
| 2nnn_A | 140 | Probable transcriptional regulator; structural gen | 82.29 | |
| 2htj_A | 81 | P fimbrial regulatory protein KS71A; winged helix- | 82.29 | |
| 3o9x_A | 133 | Uncharacterized HTH-type transcriptional regulato; | 82.27 | |
| 3nrv_A | 148 | Putative transcriptional regulator (MARR/EMRR FAM; | 82.24 | |
| 1jgs_A | 138 | Multiple antibiotic resistance protein MARR; trans | 82.07 | |
| 1y0u_A | 96 | Arsenical resistance operon repressor, putative; s | 81.83 | |
| 1zug_A | 71 | Phage 434 CRO protein; gene regulating protein, tr | 81.75 | |
| 2xi8_A | 66 | Putative transcription regulator; HTH DNA-binding | 81.71 | |
| 2qww_A | 154 | Transcriptional regulator, MARR family; YP_013417. | 81.68 | |
| 1r69_A | 69 | Repressor protein CI; gene regulating protein; 2.0 | 81.62 | |
| 3qq6_A | 78 | HTH-type transcriptional regulator SINR; helix-tur | 81.43 | |
| 3oop_A | 143 | LIN2960 protein; protein structure initiative, PSI | 81.22 | |
| 4hbl_A | 149 | Transcriptional regulator, MARR family; HTH, trans | 81.2 | |
| 3kz3_A | 80 | Repressor protein CI; five helix bundle, DNA-bindi | 81.16 | |
| 1on2_A | 142 | Transcriptional regulator MNTR; helix-turn-helix, | 81.1 | |
| 1sfu_A | 75 | 34L protein; protein/Z-DNA complex, DNA binding pr | 80.8 | |
| 2a61_A | 145 | Transcriptional regulator TM0710; APC4350, MCSG, m | 80.65 | |
| 4b8x_A | 147 | SCO5413, possible MARR-transcriptional regulator; | 80.58 | |
| 1y7y_A | 74 | C.AHDI; helix-turn-helix, DNA-binding protein, tra | 80.46 | |
| 2r1j_L | 68 | Repressor protein C2; protein-DNA complex, helix-t | 80.16 | |
| 3t76_A | 88 | VANU, transcriptional regulator vanug; structural | 80.16 | |
| 3f6w_A | 83 | XRE-family like protein; helix-turn-helix, DNA bin | 80.11 | |
| 2b5a_A | 77 | C.BCLI; helix-turn-helix motif, gene regulation; 1 | 80.06 | |
| 3f3x_A | 144 | Transcriptional regulator, MARR family, putative; | 80.02 |
| >1l9z_H Sigma factor SIGA; helix-turn-helix, coiled-coil, transcription/DNA complex; 6.50A {Thermus aquaticus} SCOP: i.8.1.1 | Back alignment and structure |
|---|
Probab=100.00 E-value=2e-44 Score=379.75 Aligned_cols=291 Identities=32% Similarity=0.533 Sum_probs=249.7
Q ss_pred hhHHHHHHhhccccCCCHHHHHHHHHHHHcCCcchhHHH------------------HHHhhhCCCCchHHHHH------
Q 011454 191 NRLKGYVKGVVSEELLTHAEVVRLSKKIKTGLSLDDHKL------------------RLKERLGCEPSMEQLAA------ 246 (485)
Q Consensus 191 ~~~~~yl~~i~~~~~Lt~eee~~L~~~ik~Gd~l~~~~~------------------~l~~~~g~~p~~~~~a~------ 246 (485)
+.++.||++|+++|+||++||++|+++++.|..+++... +.....++.|+..+|+.
T Consensus 94 d~~~~Yl~ei~~~pLLt~eEE~~La~~i~~g~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 173 (438)
T 1l9z_H 94 DPVRQYLHEIGQVPLLTLEEEIDLARKVEEGMEAIKKLSEATGLDQELIREVVRAKILGTARIQKIPGLKEKPDPKTVEE 173 (438)
T ss_pred ChHHHHHHHhccCCCCCHHHHHHHHHHHHHhhhHHHHHHhhhccchhhhhhhhhhhhhhcccccccccccccccchhhhh
Confidence 578889999999999999999999999999965433211 11224567788777642
Q ss_pred ------HhhcChhHHHHhhhhhHHHHHHHHHHhHHHHHHHHHHhcCCCCcHHHHHHHHHHHHHHhHhcCCCCCCcchhhH
Q 011454 247 ------SLRISRPELQSILMECSLAREKLVMSNVRLVMSIAQRYDNMGADMADLVQGGLIGLLRGIEKFDSSKGFKISTY 320 (485)
Q Consensus 247 ------~~~~s~~~L~~~l~~~~~A~e~Lie~yl~LV~sIA~ry~~~~~d~EDLiQEG~IgL~kAiekFDp~rG~rFsTY 320 (485)
..+++..+|.+.+.++..|+++||..|+++|+++|++|.+++.+++||+||||||||+|+++|||.+|++|+||
T Consensus 174 ~~~~~~~~~~~~~eLi~~~~~d~~A~~~Li~~nlrlVv~iA~ry~~~g~~aeDLIQEg~IgL~kAvekFDp~kG~rFsTY 253 (438)
T 1l9z_H 174 VDGKLKSLPKELKRYLHIAREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGLIRAVEKFEYKRRFKFSTY 253 (438)
T ss_pred hhhhhhcccchHHHHHHHHhcCHHHHHHHHHHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHHHHHHhcCcccCCChHHH
Confidence 23566788999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHHHHHHHHhhhhccccccHHHHHHHHHHHHHHHH-HcCCCCCHHHHHHHhC--CCHHHHHHHHHHH-------
Q 011454 321 VYWWIRQGVSRALVENSRTLRLPNHLHERLGLIRNAKLRLE-EKGVTPSVDRIAEYLN--MSQKKVRNATEVL------- 390 (485)
Q Consensus 321 A~~~Ir~~I~~~I~~~~r~irip~~~~~~~~kirka~~~L~-~~gr~ps~eEIae~L~--is~eev~~~l~~~------- 390 (485)
++||||+.|.++|+++++.+++|.++...++++++..+.+. ..|+.|+.++||+.+| ++.++|..++...
T Consensus 254 A~~wIR~~I~~~i~~~~R~irlp~~~~~~l~~lrr~~r~l~~~lgr~pt~eeiA~~l~~~v~~e~V~~~~~~~~~~~SLd 333 (438)
T 1l9z_H 254 ATWWIRQAINRAIADQARTIRIPVHMVETINKLSRTARQLQQELGREPSYEEIAEAMGPGWDAKRVEETLKIAQEPVSLE 333 (438)
T ss_pred HHHHHHHHHHHHHHHhcchhccchHHHHHHHHHHHHHHHHHHHhCCCCCHHHHHHHhCCCCCHHHHHHHHHhcccccccc
Confidence 99999999999999999999999999999999998888774 6899999999999999 9999998775432
Q ss_pred ------------HhhhcccCCCCCcchHHHHHHHHHHHHHHHhhCCHHHHHHHhhHhccC-CCCCCHHHHHHHHCCCHHH
Q 011454 391 ------------AYIADNRVENNPWHGVDDWALKDEVNKLIIVTLGEREREIIRLYYGLD-KECLTWEDISKRIGLSRER 457 (485)
Q Consensus 391 ------------~~l~D~~~e~~pee~~e~~el~e~L~~~L~~~Lp~rER~VI~LryGL~-~eg~S~eEIAe~LgIS~~t 457 (485)
+++++.. ..+|++.+...+....|..+| +.||+++|.||.++|||+ .+++|++|||+.||||++|
T Consensus 334 ~~~~~d~d~~l~d~l~d~~-~~~pee~~~~~~~~~~L~~aL-~~L~ereR~VI~LRygL~~~e~~TleEIAe~LgIS~er 411 (438)
T 1l9z_H 334 TPIGDEKDSFYGDFIPDEN-LPSPVEAAAQSLLSEELEKAL-SKLSEREAMVLKLRKGLIDGREHTLEEVGAYFGVTRER 411 (438)
T ss_pred cccccccchhhhhhhcccc-cCCHHHHHHHHHHHHHHHHHH-HhCCHHHHHHHHHHHhccCCCCCCHHHHHHHHCcCHHH
Confidence 0111111 124566666777888999999 899999999999999884 5799999999999999999
Q ss_pred HHHHHHHHHHHHH-HHHHhhhHHHhhh
Q 011454 458 VRQVGLVALEKLK-HAARKKKMEAMLV 483 (485)
Q Consensus 458 Vrqi~~rALkKLR-k~L~~~~l~~~l~ 483 (485)
|+|++++|+++|| +.+....++.|+.
T Consensus 412 VRqi~~RAlkKLR~~~~~~~~l~~yl~ 438 (438)
T 1l9z_H 412 IRQIENKALRKLKYHESRTRKLRDFLE 438 (438)
T ss_pred HHHHHHHHHHHHHHhHhhHHHHHHhhC
Confidence 9999999999999 8888888999873
|
| >2a6h_F RNA polymerase sigma factor RPOD; RNA polymerase holoenzyme, streptolydigin, antibiotic, transcription regulation; HET: STD; 2.40A {Thermus thermophilus} SCOP: a.4.13.1 a.4.13.2 a.177.1.1 PDB: 1smy_F* 1zyr_F* 1iw7_F* 2a69_F* 2a6e_F 2a68_F* 2be5_F* 2cw0_F 3eql_F* 3dxj_F* 1l9u_H | Back alignment and structure |
|---|
| >3iyd_F RNA polymerase sigma factor RPOD; transcription, initiation, class I, activator, RNA polymeras holoenzyme, sigma70, open complex, CAP, CRP; HET: DNA CMP; 19.80A {Escherichia coli k-12} | Back alignment and structure |
|---|
| >1rp3_A RNA polymerase sigma factor sigma-28 (FLIA); transcription; 2.30A {Aquifex aeolicus} SCOP: a.4.13.1 a.4.13.2 a.177.1.1 PDB: 1sc5_A | Back alignment and structure |
|---|
| >3ugo_A RNA polymerase sigma factor; protein-DNA complex, bacterial promoter opening, G-quartet, quadruplex, DNA binding; 2.10A {Thermus aquaticus} PDB: 3ugp_A 4gor_A 1ku2_A 3lev_A* 3les_A* | Back alignment and structure |
|---|
| >1l0o_C Sigma factor; bergerat fold, helix-turn-helix, protein binding; HET: ADP; 2.90A {Geobacillus stearothermophilus} SCOP: a.4.13.2 | Back alignment and structure |
|---|
| >1or7_A Sigma-24, RNA polymerase sigma-E factor; regulation, DNA-binding, transmembrane, transcription; 2.00A {Escherichia coli} SCOP: a.4.13.2 a.177.1.1 PDB: 2h27_A | Back alignment and structure |
|---|
| >3mzy_A RNA polymerase sigma-H factor; PSI, MCSG, structural genomics, midwest center for structura genomics, protein structure initiative; 2.50A {Fusobacterium nucleatum subsp} | Back alignment and structure |
|---|
| >2lfw_A PHYR sigma-like domain; signal transduction, response regulator, sigma factor mimicr sigma factor, general stress response, signaling protein; NMR {Sphingomonas SP} | Back alignment and structure |
|---|
| >3n0r_A Response regulator; sigma factor, receiver, two-component SI transduction, signaling protein; HET: MSE GOL; 1.25A {Caulobacter vibrioides} PDB: 3t0y_A | Back alignment and structure |
|---|
| >1sig_A Sigma70, RNA polymerase primary sigma factor; RNA polymerase sigma factor, transcription regulation; 2.60A {Escherichia coli} SCOP: a.177.1.1 | Back alignment and structure |
|---|
| >3t72_q RNA polymerase sigma factor RPOD, DNA-directed RN polymerase subunit beta; winged-helix motif, transcription activation, DNA-binding; 4.33A {Escherichia coli} PDB: 1tlh_B | Back alignment and structure |
|---|
| >3hug_A RNA polymerase sigma factor; ECF sigma factor, zinc binding anti-sigma factor, oxidative transcription regulation; 2.35A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2p7v_B Sigma-70, RNA polymerase sigma factor RPOD; RSD, regulator of sigma 70, sigma 70 domain 4, transcription, regulation, helix-turn-helix; 2.60A {Escherichia coli} SCOP: a.4.13.2 | Back alignment and structure |
|---|
| >1tty_A Sigma-A, RNA polymerase sigma factor RPOD; helix-turn-helix, transcription; NMR {Thermotoga maritima} SCOP: a.4.13.2 | Back alignment and structure |
|---|
| >2o7g_A Probable RNA polymerase sigma-C factor; sigma factor, transcription regulation, -10 element recognit domain, transcription; 2.70A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1ku3_A Sigma factor SIGA; helix-turn-helix, transcription; 1.80A {Thermus aquaticus} SCOP: a.4.13.2 PDB: 1ku7_A 1rio_H 3n97_A* | Back alignment and structure |
|---|
| >2o8x_A Probable RNA polymerase sigma-C factor; promoter recognition, transcription regulation, helix-turn-H motif, transcription; 3.00A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1h3l_A RNA polymerase sigma factor; transcription, DNA-binding, transcription regulation; 2.37A {Streptomyces coelicolor A3} SCOP: a.177.1.1 | Back alignment and structure |
|---|
| >1xsv_A Hypothetical UPF0122 protein SAV1236; helix-turn-helix, putative DNA-binding protein, signal recognition particle, unknown function; 1.70A {Staphylococcus aureus subsp} SCOP: a.4.13.3 | Back alignment and structure |
|---|
| >1s7o_A Hypothetical UPF0122 protein SPY1201/SPYM3_0842/SPS1042/SPYM18_1152; putative DNA binding protein, structural genomics; 2.31A {Streptococcus pyogenes serotype M3} SCOP: a.4.13.3 | Back alignment and structure |
|---|
| >3clo_A Transcriptional regulator; NP_811094.1, bacterial regulatory proteins, LUXR family, structural genomics; 2.04A {Bacteroides thetaiotaomicron vpi-5482} | Back alignment and structure |
|---|
| >3c57_A Two component transcriptional regulatory protein; response regulator, two-component regulatory system, DNA-BIN protein; 1.70A {Mycobacterium tuberculosis} PDB: 1zlk_A 1zlj_A | Back alignment and structure |
|---|
| >2rnj_A Response regulator protein VRAR; HTH LUXR-type domain, DNA binding domain, activator, antibiotic resistance, cytoplasm, DNA-binding; NMR {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1x3u_A Transcriptional regulatory protein FIXJ; helix-turn-helix; NMR {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1jhg_A Trp operon repressor; complex (regulatory protein-peptide), DNA-binding regulatory complex (regulatory protein-peptide) complex; HET: TRP; 1.30A {Escherichia coli} SCOP: a.4.12.1 PDB: 1co0_A* 1mi7_R 1p6z_R 1wrp_R* 1zt9_A* 2oz9_R* 3ssw_R 3wrp_A 1rcs_A* 1wrs_R* 1wrt_R 2xdi_A 3ssx_R* 1trr_A* 1tro_A* | Back alignment and structure |
|---|
| >1je8_A Nitrate/nitrite response regulator protein NARL; protein-DNA complex, two-component response regulator, helix-turn-helix, DNA bending; 2.12A {Escherichia coli} SCOP: a.4.6.2 PDB: 1zg1_A 1zg5_A | Back alignment and structure |
|---|
| >1fse_A GERE; helix-turn-helix DNA-binding protein transcriptional regulat transcription; 2.05A {Bacillus subtilis} SCOP: a.4.6.2 | Back alignment and structure |
|---|
| >3ulq_B Transcriptional regulatory protein COMA; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} PDB: 2krf_A | Back alignment and structure |
|---|
| >1p4w_A RCSB; solution structure, DNA binding domain, DNA binding protein; NMR {Erwinia amylovora} SCOP: a.4.6.2 | Back alignment and structure |
|---|
| >2jpc_A SSRB; DNA binding protein, structural genomics, PSI-2, protein structure initiative; NMR {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2q0o_A Probable transcriptional activator protein TRAR; helix-turn-helix, two-helix coiled coil; HET: LAE; 2.00A {Rhizobium SP} | Back alignment and structure |
|---|
| >1l3l_A Transcriptional activator protein TRAR; helix-turn-helix DNA binding motif, alpha/beta/alpha sandwich; HET: LAE; 1.66A {Agrobacterium tumefaciens} SCOP: a.4.6.2 d.110.5.1 PDB: 1h0m_A* | Back alignment and structure |
|---|
| >3szt_A QCSR, quorum-sensing control repressor; quorum sensing acyl-homoserine lactone, helix-turn-helix, transcription factor, 3-OXO-C12 HSL; HET: OHN; 2.55A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3qp6_A CVIR transcriptional regulator; quorum sensing, agonist, antagonist, LUXR, acylated homoseri lactone, transcription factor; HET: HL6; 2.00A {Chromobacterium violaceum} PDB: 3qp5_A* | Back alignment and structure |
|---|
| >1tc3_C Protein (TC3 transposase); DNA binding, helix-turn-helix, TC1/mariner family, complex (transposase/DNA), DNA binding protein/DNA complex; HET: DNA; 2.45A {Caenorhabditis elegans} SCOP: a.4.1.2 | Back alignment and structure |
|---|
| >2w7n_A TRFB transcriptional repressor protein; INCP, plasmid, repressor, DNA-binding, transcription/DNA; HET: BRU; 1.85A {Escherichia coli} | Back alignment and structure |
|---|
| >2x48_A CAG38821; archeal virus, viral protein; 2.60A {Sulfolobus islandicus rod-shaped virusorganism_taxid} | Back alignment and structure |
|---|
| >1yio_A Response regulatory protein; transcription regulation, DNA binding protein; 2.20A {Pseudomonas fluorescens} SCOP: a.4.6.2 c.23.1.1 PDB: 1zn2_A | Back alignment and structure |
|---|
| >1a04_A Nitrate/nitrite response regulator protein NARL; signal transduction protein, response regulators, two- component systems; 2.20A {Escherichia coli} SCOP: a.4.6.2 c.23.1.1 PDB: 1rnl_A | Back alignment and structure |
|---|
| >3c3w_A Two component transcriptional regulatory protein; response regulator, two-component regulatory system, DNA-BIN protein; 2.20A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3klo_A Transcriptional regulator VPST; REC domain, HTH domain, DNA-binding, transcription regulation; HET: C2E TAR; 2.80A {Vibrio cholerae} PDB: 3kln_A* | Back alignment and structure |
|---|
| >3p7n_A Sensor histidine kinase; LOV domain, light-activated transcription factor, DNA bindin; HET: FMN; 2.10A {Erythrobacter litoralis} | Back alignment and structure |
|---|
| >1jko_C HIN recombinase, DNA-invertase HIN; water-mediated recognition, protein-DNA complex, A10G mutant, DNA binding protein/DNA complex; 2.24A {Synthetic} SCOP: a.4.1.2 PDB: 1ijw_C* 1jj6_C* 1jj8_C* 1hcr_A 1jkp_C 1jkq_C 1jkr_C | Back alignment and structure |
|---|
| >1p2f_A Response regulator; DRRB, OMPR/PHOB, transcription; HET: MSE; 1.80A {Thermotoga maritima} SCOP: a.4.6.1 c.23.1.1 PDB: 3nns_A* | Back alignment and structure |
|---|
| >3kor_A Possible Trp repressor; putative DNA-binding Trp repressor, TRPR like protein, struc genomics, transcription; 1.60A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2gwr_A DNA-binding response regulator MTRA; two-component regulatory system, transcription regulation, phosphorylation, OMPR family; 2.10A {Mycobacterium tuberculosis} PDB: 3nhz_A | Back alignment and structure |
|---|
| >2oqr_A Sensory transduction protein REGX3; response regulator, winged-helix-turn-helix, DNA-binding, 3D swapping, two component system; 2.03A {Mycobacterium tuberculosis H37RV} | Back alignment and structure |
|---|
| >1kgs_A DRRD, DNA binding response regulator D; DNA-binding protein, ALPH-beta sandwich, winged-helix, helix helix, DNA binding protein; HET: DNA MSE; 1.50A {Thermotoga maritima} SCOP: a.4.6.1 c.23.1.1 PDB: 3nnn_A* | Back alignment and structure |
|---|
| >1ys7_A Transcriptional regulatory protein PRRA; response regulator, DNA binding domain, phosphorylation; 1.58A {Mycobacterium tuberculosis} SCOP: a.4.6.1 c.23.1.1 PDB: 1ys6_A | Back alignment and structure |
|---|
| >1zx4_A P1 PARB, plasmid partition PAR B protein, PARB; translation; HET: CIT; 2.98A {Enterobacteria phage P1} PDB: 2ntz_A | Back alignment and structure |
|---|
| >1u78_A TC3 transposase, transposable element TC3 transposase; transposon DNA, bipartite DNA-binding, HTH- motif, DNA binding protein/DNA complex; 2.69A {Caenorhabditis elegans} SCOP: a.4.1.2 a.4.1.2 | Back alignment and structure |
|---|
| >1pdn_C Protein (PRD paired); protein-DNA complex, double helix, PAX, paired domain, DNA-binding protein, gene regulation/DNA complex; HET: DNA; 2.50A {Drosophila melanogaster} SCOP: a.4.1.5 | Back alignment and structure |
|---|
| >3q9s_A DNA-binding response regulator; DNA binding protein; 2.40A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >2hqr_A Putative transcriptional regulator; phosporylation-independent response regulator, H. pylori, SY dimer, signaling protein; NMR {Helicobacter pylori} | Back alignment and structure |
|---|
| >3ugo_A RNA polymerase sigma factor; protein-DNA complex, bacterial promoter opening, G-quartet, quadruplex, DNA binding; 2.10A {Thermus aquaticus} PDB: 3ugp_A 4gor_A 1ku2_A 3lev_A* 3les_A* | Back alignment and structure |
|---|
| >1k78_A Paired box protein PAX5; paired domain, ETS domain, transcription factor, transcription/DNA complex; 2.25A {Homo sapiens} SCOP: a.4.1.5 a.4.1.5 PDB: 1mdm_A 6pax_A | Back alignment and structure |
|---|
| >2elh_A CG11849-PA, LD40883P; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1qgp_A Protein (double stranded RNA adenosine deaminase); Z-alpha-Z-DNA binding domain, RNA-editing, Z-DNA recognition, ADAR1, helix- turn-helix; NMR {Homo sapiens} SCOP: a.4.5.19 | Back alignment and structure |
|---|
| >1oyi_A Double-stranded RNA-binding protein; (alpha+beta) helix-turn-helix, viral protein; NMR {Vaccinia virus} SCOP: a.4.5.19 | Back alignment and structure |
|---|
| >3r0j_A Possible two component system response transcript positive regulator PHOP; beta-alpha fold, winged helix-turn-helix; 2.50A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3frw_A Putative Trp repressor protein; structural genomics, APC21159, PSI-2, P structure initiative; 2.05A {Ruminococcus obeum atcc 29174} PDB: 3g1c_A | Back alignment and structure |
|---|
| >1qbj_A Protein (double-stranded RNA specific adenosine D (ADAR1)); protein-Z-DNA complex, hydrolase-DNA complex; HET: DNA; 2.10A {Homo sapiens} SCOP: a.4.5.19 PDB: 3f21_A* 3f22_A* 3f23_A* 3irr_A* 3irq_D* 2gxb_A 2acj_A 2l54_A | Back alignment and structure |
|---|
| >2glo_A Brinker CG9653-PA; protein-DNA complex, helix-turn-helix motif, transcription/DNA complex; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3k2z_A LEXA repressor; winged helix-turn-helix, SOS system, autoca cleavage, DNA damage, DNA repair, DNA replication, DNA-BIND hydrolase; 1.37A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2w48_A Sorbitol operon regulator; SORC, activator, repressor, DNA-binding, transcription, transcription regulator, transcription regulation; 3.20A {Klebsiella pneumoniae} | Back alignment and structure |
|---|
| >3r0a_A Putative transcriptional regulator; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.31A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >2lkp_A Transcriptional regulator, ARSR family; symmetric homodimer, NI(II) binding protein, DNA binding Pro transcription regulator; NMR {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2heo_A Z-DNA binding protein 1; protein DLM1-Z-DNA complex, immune system-DNA complex; 1.70A {Mus musculus} PDB: 1j75_A | Back alignment and structure |
|---|
| >2jn6_A Protein CGL2762, transposase; GFT PSI-2, protein structure, structural genomics, protein structure initiative; NMR {Corynebacterium glutamicum} SCOP: a.4.1.19 | Back alignment and structure |
|---|
| >2cfx_A HTH-type transcriptional regulator LRPC; transcriptional regulation, DNA binding, FFRP; 2.4A {Bacillus subtilis} SCOP: a.4.5.32 d.58.4.2 | Back alignment and structure |
|---|
| >2o3f_A Putative HTH-type transcriptional regulator YBBH; APC85504, putative transcriptional regulator YBBH; HET: MLY; 1.75A {Bacillus subtilis} SCOP: a.4.1.20 | Back alignment and structure |
|---|
| >1uxc_A FRUR (1-57), fructose repressor; DNA-binding protein, LACI family, transc regulation; NMR {Escherichia coli} SCOP: a.35.1.5 PDB: 1uxd_A | Back alignment and structure |
|---|
| >3iyd_F RNA polymerase sigma factor RPOD; transcription, initiation, class I, activator, RNA polymeras holoenzyme, sigma70, open complex, CAP, CRP; HET: DNA CMP; 19.80A {Escherichia coli k-12} | Back alignment and structure |
|---|
| >2k27_A Paired box protein PAX-8; paired domain, solution structure, triple frequency, 3D NMR, induced FIT, alternative splicing, developmental protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d1h_A ST1889, 109AA long hypothetical transcriptional regulator; helix-turn-helix, intermolecular and intramolecular S-S bond structural genomics; 2.05A {Sulfolobus tokodaii} SCOP: a.4.5.50 | Back alignment and structure |
|---|
| >1r1u_A CZRA, repressor protein; zinc, DNA binding, transcriptional regulation, winged HTH protein, transcription repressor; 2.00A {Staphylococcus aureus} SCOP: a.4.5.5 PDB: 1r1v_A 2kjb_A 2kjc_A | Back alignment and structure |
|---|
| >2w25_A Probable transcriptional regulatory protein; transcription regulation, mutant, RV3291C, Glu104Ala, DNA-binding; 2.15A {Mycobacterium tuberculosis} PDB: 2vbw_A* 2vbx_A* 2vby_A* 2vbz_A* 2vc0_A 2vc1_A 2w24_A 2ivm_A 2w29_A 2qz8_A | Back alignment and structure |
|---|
| >3tgn_A ADC operon repressor ADCR; helix-turn-helix, transcriptional regulator, transcription; 2.00A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >2cyy_A Putative HTH-type transcriptional regulator PH151; structural genomics, pyrococcus horikosii OT3, NPPSFA; HET: MSE GLN; 1.80A {Pyrococcus horikoshii} SCOP: a.4.5.32 d.58.4.2 | Back alignment and structure |
|---|
| >2p5v_A Transcriptional regulator, LRP/ASNC family; NMB0573, structu genomics; 1.99A {Neisseria meningitidis} PDB: 2p6s_A 2p6t_A | Back alignment and structure |
|---|
| >2dbb_A Putative HTH-type transcriptional regulator PH006; ASNC family, helix-turn-helix (HTH) domain, structural genom NPPSFA; 2.00A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1sfx_A Conserved hypothetical protein AF2008; structural genomics, HTH MOT protein structure initiative, midwest center for structural genomics; 1.55A {Archaeoglobus fulgidus} SCOP: a.4.5.50 | Back alignment and structure |
|---|
| >2cg4_A Regulatory protein ASNC; DNA binding, FFRP, LRP family, transcription, DNA- binding, transcription regulation; 2.4A {Escherichia coli} SCOP: a.4.5.32 d.58.4.2 | Back alignment and structure |
|---|
| >2pn6_A ST1022, 150AA long hypothetical transcriptional regulator; LRP/ASNC family Gln binding, structural genomics, NPPSFA; HET: GLN; 1.44A {Sulfolobus tokodaii} PDB: 2efn_A* 2e7x_A* 2e7w_A* 2yx4_A* 2efq_A* 2pmh_A* 2yx7_A* 2efp_A* 2efo_A* | Back alignment and structure |
|---|
| >3pqk_A Biofilm growth-associated repressor; helix-turn-helix motif, winged-helix fold, transcriptional R DNA binding, transcription; 2.09A {Xylella fastidiosa} PDB: 3pqj_A | Back alignment and structure |
|---|
| >2zkz_A Transcriptional repressor PAGR; protein-DNA, HTH motif, dimer, DN binding, transcription regulation; 2.00A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3iwf_A Transcription regulator RPIR family; transcriptional, N-terminal, PSI, MCSG, structural genomics, midwest center structural genomics; 1.40A {Staphylococcus epidermidis} | Back alignment and structure |
|---|
| >3i4p_A Transcriptional regulator, ASNC family; PSI, structural genom protein structure initiative, midwest center for structural genomics; 2.30A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3jth_A Transcription activator HLYU; transcription factor, RTXA, DNA-binding, transcription regulation; 2.00A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >3nqo_A MARR-family transcriptional regulator; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE PG4; 2.20A {Clostridium difficile} | Back alignment and structure |
|---|
| >1i1g_A Transcriptional regulator LRPA; helix-turn-helix, LRP/ASNC family; 2.90A {Pyrococcus furiosus} SCOP: a.4.5.32 d.58.4.2 | Back alignment and structure |
|---|
| >1u78_A TC3 transposase, transposable element TC3 transposase; transposon DNA, bipartite DNA-binding, HTH- motif, DNA binding protein/DNA complex; 2.69A {Caenorhabditis elegans} SCOP: a.4.1.2 a.4.1.2 | Back alignment and structure |
|---|
| >3ech_A MEXR, multidrug resistance operon repressor; winged helix, helix-turn-helix, protein-peptide complex; 1.80A {Pseudomonas aeruginosa} SCOP: a.4.5.28 PDB: 1lnw_A 3mex_A | Back alignment and structure |
|---|
| >2l0k_A Stage III sporulation protein D; SPOIIID, solution structure, DNA binding, bacillus subti transcription factor, transcription; NMR {Bacillus subtilis} | Back alignment and structure |
|---|
| >3cuo_A Uncharacterized HTH-type transcriptional regulato; DNA-binding transcriptional regulator, structural genomics, MCSG; 2.00A {Escherichia coli K12} | Back alignment and structure |
|---|
| >3eco_A MEPR; mutlidrug efflux pump regulator winged helix-turn-helix motif, DNA-binding, transcription, transcription regulation; 2.40A {Staphylococcus aureus} SCOP: a.4.5.0 | Back alignment and structure |
|---|
| >1r1t_A Transcriptional repressor SMTB; zinc, transcriptional regulation, winged HTH protein, DNA binding, transcription repressor; 1.70A {Synechococcus elongatus pcc 7942} SCOP: a.4.5.5 PDB: 1r23_A 1smt_A 1r22_A | Back alignment and structure |
|---|
| >2dk5_A DNA-directed RNA polymerase III 39 kDa polypeptide; structural genomics, winged helix domain, NPPSFA; NMR {Homo sapiens} SCOP: a.4.5.85 | Back alignment and structure |
|---|
| >3bro_A Transcriptional regulator; helix_TURN_helix, multiple antibiotic resistance protein (MA structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.04A {Oenococcus oeni} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >2kko_A Possible transcriptional regulatory protein (possibly ARSR-family); NESG, DNA-binding, transcription regulation, WHTH, homodimer; NMR {Mycobacterium bovis} PDB: 3gw2_A | Back alignment and structure |
|---|
| >2ia0_A Putative HTH-type transcriptional regulator PF086; ASNC, PSI, structural genomics, southeast collaboratory for structural genomics; 2.37A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2gxg_A 146AA long hypothetical transcriptional regulator; winged helix; 1.45A {Sulfolobus tokodaii} PDB: 2eb7_A 2yr2_A 3gez_A 3gf2_A* 3gfi_A 3gfm_A 3gfj_A 3gfl_A | Back alignment and structure |
|---|
| >2x4h_A Hypothetical protein SSO2273; transcription; 2.30A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2oqg_A Possible transcriptional regulator, ARSR family P; winged-helix-turn-helix, structural genomics, PSI-2, protein structure initiative; 1.54A {Rhodococcus SP} | Back alignment and structure |
|---|
| >2fu4_A Ferric uptake regulation protein; DNA binding domain, helix-turn-helix, DNA binding protein; 1.80A {Escherichia coli} | Back alignment and structure |
|---|
| >1ku9_A Hypothetical protein MJ223; putative transcription factor, homodimeric winged-helix fold, structural genomics, PSI; 2.80A {Methanocaldococcus jannaschii} SCOP: a.4.5.36 | Back alignment and structure |
|---|
| >1q1h_A TFE, transcription factor E, TFE; TFIIE, transcription initiation, preinitiation complex, RNA polymerase II, transcription bubble; 2.90A {Sulfolobus solfataricus} SCOP: a.4.5.41 | Back alignment and structure |
|---|
| >3bdd_A Regulatory protein MARR; putative multiple antibiotic-resistance repressor, structura genomics, joint center for structural genomics, JCSG; 2.20A {Streptococcus suis} | Back alignment and structure |
|---|
| >2fa5_A Transcriptional regulator MARR/EMRR family; multiple antibiotics resistance repressor, XCC structural genomics, X-RAY diffraction; 1.80A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >1uly_A Hypothetical protein PH1932; helix-turn-helix, structural genomics, DNA binding protein; 2.50A {Pyrococcus horikoshii} SCOP: a.4.5.58 PDB: 2cwe_A | Back alignment and structure |
|---|
| >1jhf_A LEXA repressor; LEXA SOS repressor, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.2 b.87.1.1 PDB: 1jhh_A 3jso_A* 3jsp_A* 3k3r_E* 1jhc_A 1jhe_A 1lea_A 1leb_A | Back alignment and structure |
|---|
| >3bpv_A Transcriptional regulator; MARR, DNA binding, transcription factor, winged helix motif, DNA-binding; 1.40A {Methanobacterium thermoautotrophicum} PDB: 3bpx_A* | Back alignment and structure |
|---|
| >3hsr_A HTH-type transcriptional regulator SARZ; helix-turn-helix, cysteine disulfide, MARR-family transcript regulator, DNA-binding; 1.90A {Staphylococcus aureus subsp} PDB: 3hse_A 3hrm_A 4gxo_A | Back alignment and structure |
|---|
| >3cdh_A Transcriptional regulator, MARR family; helix-turn-hleix, structura genomics, PSI-2, protein structure initiative; 2.69A {Silicibacter pomeroyi dss-3} | Back alignment and structure |
|---|
| >2a6c_A Helix-turn-helix motif; putative transcriptional regulator, structural genomics, JOI for structural genomics, JCSG; HET: CIT; 1.90A {Nitrosomonas europaea} SCOP: a.35.1.13 | Back alignment and structure |
|---|
| >1hlv_A CENP-B, major centromere autoantigen B; helix-turn-helix, protein-DNA complex, riken structural genomics/proteomics initiative, RSGI; 2.50A {Homo sapiens} SCOP: a.4.1.7 a.4.1.7 PDB: 1bw6_A | Back alignment and structure |
|---|
| >2nnn_A Probable transcriptional regulator; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.40A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2htj_A P fimbrial regulatory protein KS71A; winged helix-turn-helix, PAP PILI, transcription activator; NMR {Escherichia coli} SCOP: a.4.5.73 | Back alignment and structure |
|---|
| >3o9x_A Uncharacterized HTH-type transcriptional regulato; HTH-XRE DNA binding motif, transcriptional regulator, bacter antitoxin, Zn binding protein, transcription regulator-DNA; HET: DNA; 2.10A {Escherichia coli} PDB: 3gn5_A* 3gn5_B* 2kz8_A | Back alignment and structure |
|---|
| >3nrv_A Putative transcriptional regulator (MARR/EMRR FAM; PSI-2, protein structure initiati structural genomics; HET: MSE; 2.00A {Acinetobacter SP} | Back alignment and structure |
|---|
| >1jgs_A Multiple antibiotic resistance protein MARR; transcription regulation, DNA-binding, repressor, transcription; HET: SAL; 2.30A {Escherichia coli} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >1y0u_A Arsenical resistance operon repressor, putative; structural genomics, protein structure initiative, PSI; HET: MSE; 1.60A {Archaeoglobus fulgidus} SCOP: a.4.5.5 | Back alignment and structure |
|---|
| >1zug_A Phage 434 CRO protein; gene regulating protein, transcription regulation; NMR {Phage 434} SCOP: a.35.1.2 PDB: 2cro_A 3cro_L* | Back alignment and structure |
|---|
| >2xi8_A Putative transcription regulator; HTH DNA-binding motif; HET: GOL; 1.21A {Enterococcus faecalis} PDB: 2gzu_A 1utx_A* 2xj3_A 2xiu_A | Back alignment and structure |
|---|
| >2qww_A Transcriptional regulator, MARR family; YP_013417.1, multiple antibiotic-resistance repressor (MARR) structural genomics; HET: MSE; 2.07A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >1r69_A Repressor protein CI; gene regulating protein; 2.00A {Phage 434} SCOP: a.35.1.2 PDB: 1pra_A 1per_L 1rpe_L* 2or1_L* 1r63_A 2r63_A 1sq8_A | Back alignment and structure |
|---|
| >3qq6_A HTH-type transcriptional regulator SINR; helix-turn-helix motif, biofilm, repressor, SINI; 1.90A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3oop_A LIN2960 protein; protein structure initiative, PSI-2, structural genomics, MI center for structural genomics, MCSG, unknown function; 1.78A {Listeria innocua} | Back alignment and structure |
|---|
| >4hbl_A Transcriptional regulator, MARR family; HTH, transcription factor, DNA binding; 2.50A {Staphylococcus epidermidis} | Back alignment and structure |
|---|
| >3kz3_A Repressor protein CI; five helix bundle, DNA-binding, transcription, transcription regulation; 1.64A {Enterobacteria phage lambda} | Back alignment and structure |
|---|
| >1on2_A Transcriptional regulator MNTR; helix-turn-helix, DNA-binding protein, metalloregulatory protein; 1.61A {Bacillus subtilis} SCOP: a.4.5.24 a.76.1.1 PDB: 2ev0_A 1on1_A 2ev5_A 2ev6_A* 2f5c_A 2f5d_A 2f5e_A 2f5f_A 2hyf_A* 2hyg_D 3r60_A* 3r61_A* | Back alignment and structure |
|---|
| >1sfu_A 34L protein; protein/Z-DNA complex, DNA binding protein/DNA complex; 2.00A {Yaba-like disease virus} SCOP: a.4.5.19 | Back alignment and structure |
|---|
| >2a61_A Transcriptional regulator TM0710; APC4350, MCSG, midwest center for structural genomics, PSI, protein structure initiative, MARR; 1.80A {Thermotoga maritima} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >4b8x_A SCO5413, possible MARR-transcriptional regulator; winged helix motif; HET: CME; 1.25A {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >1y7y_A C.AHDI; helix-turn-helix, DNA-binding protein, transcriptional regulator, transcription regulator; 1.69A {Aeromonas hydrophila} SCOP: a.35.1.3 | Back alignment and structure |
|---|
| >2r1j_L Repressor protein C2; protein-DNA complex, helix-turn-helix, DNA-binding, transcription, transcription regulation; 1.53A {Enterobacteria phage P22} SCOP: a.35.1.2 PDB: 3jxb_C 3jxc_L 3jxd_L | Back alignment and structure |
|---|
| >3f6w_A XRE-family like protein; helix-turn-helix, DNA binding protein, xenobiotic response E family of transcriptional regulators; HET: MSE BTB; 1.85A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >2b5a_A C.BCLI; helix-turn-helix motif, gene regulation; 1.54A {Bacillus caldolyticus} SCOP: a.35.1.3 | Back alignment and structure |
|---|
| >3f3x_A Transcriptional regulator, MARR family, putative; DNA binding protein, DNA-binding, transcription regulation; 1.90A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 485 | ||||
| d1ku2a2 | 180 | a.177.1.1 (A:93-272) Sigma factor SigA {Thermus aq | 6e-24 | |
| d1siga_ | 334 | a.177.1.1 (A:) Sigma70 {Escherichia coli [TaxId: 5 | 2e-22 | |
| d1ttya_ | 87 | a.4.13.2 (A:) Sigma70 (SigA, RpoD) {Thermotoga mar | 2e-15 | |
| d2p7vb1 | 68 | a.4.13.2 (B:546-613) Sigma70 (SigA, RpoD) {Escheri | 2e-14 | |
| d1rp3a3 | 87 | a.177.1.1 (A:0-86) Sigma factor sigma-28 (FliA) {A | 3e-14 | |
| d1ku3a_ | 61 | a.4.13.2 (A:) Sigma70 (SigA, RpoD) {Thermus aquati | 8e-13 | |
| d1rp3a2 | 71 | a.4.13.2 (A:164-234) Sigma factor sigma-28 (FliA) | 2e-06 | |
| d1l0oc_ | 57 | a.4.13.2 (C:) SigmaF {Bacillus stearothermophilus | 7e-05 |
| >d1ku2a2 a.177.1.1 (A:93-272) Sigma factor SigA {Thermus aquaticus [TaxId: 271]} Length = 180 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Sigma2 domain of RNA polymerase sigma factors superfamily: Sigma2 domain of RNA polymerase sigma factors family: Sigma2 domain of RNA polymerase sigma factors domain: Sigma factor SigA species: Thermus aquaticus [TaxId: 271]
Score = 96.4 bits (239), Expect = 6e-24
Identities = 53/177 (29%), Positives = 87/177 (49%), Gaps = 30/177 (16%)
Query: 193 LKGYVKGVVSEELLTHAEVVRLSKKIKTGLSLDDH------------------KLRLKER 234
++ Y+ + LLT E + L++K++ G+ K+ R
Sbjct: 4 VRQYLHEIGQVPLLTLEEEIDLARKVEEGMEAIKKLSEATGLDQELIREVVRAKILGTAR 63
Query: 235 LGCEPS---------MEQLAASLRISRPELQ---SILMECSLAREKLVMSNVRLVMSIAQ 282
+ P +E++ L+ EL+ I E AR+ L+ +N+RLV+SIA+
Sbjct: 64 IQKIPGLKEKPDPKTVEEVDGKLKSLPKELKRYLHIAREGEAARQHLIEANLRLVVSIAK 123
Query: 283 RYDNMGADMADLVQGGLIGLLRGIEKFDSSKGFKISTYVYWWIRQGVSRALVENSRT 339
+Y G DL+Q G GL+R +EKF+ + FK STY WWIRQ ++RA+ + +RT
Sbjct: 124 KYTGRGLSFLDLIQEGNQGLIRAVEKFEYKRRFKFSTYATWWIRQAINRAIADQART 180
|
| >d1siga_ a.177.1.1 (A:) Sigma70 {Escherichia coli [TaxId: 562]} Length = 334 | Back information, alignment and structure |
|---|
| >d1ttya_ a.4.13.2 (A:) Sigma70 (SigA, RpoD) {Thermotoga maritima [TaxId: 2336]} Length = 87 | Back information, alignment and structure |
|---|
| >d2p7vb1 a.4.13.2 (B:546-613) Sigma70 (SigA, RpoD) {Escherichia coli [TaxId: 562]} Length = 68 | Back information, alignment and structure |
|---|
| >d1rp3a3 a.177.1.1 (A:0-86) Sigma factor sigma-28 (FliA) {Aquifex aeolicus [TaxId: 63363]} Length = 87 | Back information, alignment and structure |
|---|
| >d1ku3a_ a.4.13.2 (A:) Sigma70 (SigA, RpoD) {Thermus aquaticus [TaxId: 271]} Length = 61 | Back information, alignment and structure |
|---|
| >d1rp3a2 a.4.13.2 (A:164-234) Sigma factor sigma-28 (FliA) {Aquifex aeolicus [TaxId: 63363]} Length = 71 | Back information, alignment and structure |
|---|
| >d1l0oc_ a.4.13.2 (C:) SigmaF {Bacillus stearothermophilus [TaxId: 1422]} Length = 57 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 485 | |||
| d1ku2a2 | 180 | Sigma factor SigA {Thermus aquaticus [TaxId: 271]} | 99.94 | |
| d1siga_ | 334 | Sigma70 {Escherichia coli [TaxId: 562]} | 99.76 | |
| d1rp3a3 | 87 | Sigma factor sigma-28 (FliA) {Aquifex aeolicus [Ta | 99.7 | |
| d2p7vb1 | 68 | Sigma70 (SigA, RpoD) {Escherichia coli [TaxId: 562 | 99.41 | |
| d1rp3a2 | 71 | Sigma factor sigma-28 (FliA) {Aquifex aeolicus [Ta | 99.39 | |
| d1ttya_ | 87 | Sigma70 (SigA, RpoD) {Thermotoga maritima [TaxId: | 99.39 | |
| d1ku3a_ | 61 | Sigma70 (SigA, RpoD) {Thermus aquaticus [TaxId: 27 | 99.33 | |
| d1or7a2 | 113 | SigmaE factor (RpoE) {Escherichia coli [TaxId: 562 | 99.3 | |
| d1or7a1 | 68 | SigmaE factor (RpoE) {Escherichia coli [TaxId: 562 | 99.24 | |
| d1xsva_ | 106 | Hypothetical protein SAV1236 {Staphylococcus aureu | 98.92 | |
| d1s7oa_ | 106 | Hypothetical protein SPy1201 {Streptococcus pyogen | 98.9 | |
| d1h3la_ | 75 | Sigma factor SigR {Streptomyces coelicolor a3(2) [ | 98.82 | |
| d1yioa1 | 70 | Response regulatory protein StyR, C-terminal domai | 98.39 | |
| d1a04a1 | 67 | Nitrate/nitrite response regulator (NarL) {Escheri | 98.2 | |
| d1l3la1 | 65 | Quorum-sensing transcription factor TraR, C-termin | 98.07 | |
| d1l0oc_ | 57 | SigmaF {Bacillus stearothermophilus [TaxId: 1422]} | 98.03 | |
| d1fsea_ | 67 | Germination protein GerE {Bacillus subtilis [TaxId | 98.02 | |
| d1p4wa_ | 87 | Transcriptional regulator RcsB {Erwinia amylovora | 97.75 | |
| d1ku2a1 | 60 | Sigma factor SigA {Thermus aquaticus [TaxId: 271]} | 97.54 | |
| d1rp3a1 | 77 | Sigma factor sigma-28 (FliA) {Aquifex aeolicus [Ta | 96.54 | |
| d1ijwc_ | 47 | HIN recombinase (DNA-binding domain) {Synthetic} | 95.45 | |
| d1l0oc_ | 57 | SigmaF {Bacillus stearothermophilus [TaxId: 1422]} | 95.02 | |
| d1jhfa1 | 71 | LexA repressor, N-terminal DNA-binding domain {Esc | 94.52 | |
| d1rp3a1 | 77 | Sigma factor sigma-28 (FliA) {Aquifex aeolicus [Ta | 94.39 | |
| d1gdta1 | 43 | gamma,delta resolvase (C-terminal domain) {Escheri | 93.99 | |
| d2cfxa1 | 63 | Transcriptional regulator LrpC {Bacillus subtilis | 93.21 | |
| d2cg4a1 | 63 | Regulatory protein AsnC {Escherichia coli [TaxId: | 93.19 | |
| d1i1ga1 | 60 | LprA {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 92.49 | |
| d1hlva1 | 66 | DNA-binding domain of centromere binding protein B | 92.18 | |
| d2cyya1 | 60 | Putative transcriptional regulator PH1519 {Archaeo | 91.68 | |
| d1k78a1 | 63 | Pax-5 {Human (Homo sapiens) [TaxId: 9606]} | 91.44 | |
| d1pdnc_ | 123 | Paired protein (prd) {Fruit fly (Drosophila melano | 91.0 | |
| d2jn6a1 | 89 | Uncharacterized protein Cgl2762 {Corynebacterium g | 90.91 | |
| d2o3fa1 | 83 | Putative transcriptional regulator YbbH {Bacillus | 89.45 | |
| d1ku2a1 | 60 | Sigma factor SigA {Thermus aquaticus [TaxId: 271]} | 89.39 | |
| d1biaa1 | 63 | Biotin repressor, N-terminal domain {Escherichia c | 89.35 | |
| d1yz8p1 | 60 | Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: | 88.85 | |
| d2ppxa1 | 62 | Uncharacterized protein Atu1735 {Agrobacterium tum | 88.8 | |
| d1uxda_ | 59 | Fructose repressor (FruR), N-terminal domain {Esch | 88.08 | |
| d2d1ha1 | 109 | Hypothetical transcriptional regulator ST1889 {Sul | 87.63 | |
| d2auwa1 | 67 | Hypothetical protein NE0471 C-terminal domain {Nit | 86.68 | |
| d1le8a_ | 53 | Mating type protein A1 Homeodomain {Baker's yeast | 86.63 | |
| d1r1ua_ | 94 | Metal-sensing transcriptional repressor CzrA {Stap | 86.55 | |
| d1ft9a1 | 80 | CO-sensing protein CooA, C-terminal domain {Rhodos | 86.37 | |
| d2isya1 | 63 | Iron-dependent regulator IdeR {Mycobacterium tuber | 86.31 | |
| d1ku9a_ | 151 | DNA-binding protein Mj223 {Archaeon Methanococcus | 86.3 | |
| d1jhga_ | 101 | Trp repressor, TrpR {Escherichia coli [TaxId: 562] | 86.04 | |
| d1stza1 | 87 | Heat-inducible transcription repressor HrcA, N-ter | 85.88 | |
| d1x2na1 | 62 | Homeobox protein pknox1 {Human (Homo sapiens) [Tax | 85.8 | |
| d1fjla_ | 65 | Paired protein {Fruit fly (Drosophila melanogaster | 85.71 | |
| d1ig7a_ | 58 | Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10 | 85.68 | |
| d2a6ca1 | 69 | HTH-motif protein NE1354 {Nitrosomonas europaea [T | 85.63 | |
| d2ecca1 | 76 | Homeobox-leucine zipper protein Homez {Human (Homo | 85.55 | |
| d1utxa_ | 66 | Putative transcription regulator CylR2 {Enterococc | 85.43 | |
| d3broa1 | 135 | Transcriptional regulator OEOE1854 {Oenococcus oen | 85.28 | |
| d1z05a1 | 71 | Transcriptional regulator VC2007 N-terminal domain | 84.98 | |
| d1r1ta_ | 98 | SmtB repressor {Cyanobacteria (Synechococcus), pcc | 84.98 | |
| d1zq3p1 | 67 | Homeotic bicoid protein {Fruit fly (Drosophila mel | 84.74 | |
| d2o38a1 | 89 | Hypothetical protein RPA3824 {Rhodopseudomonas pal | 84.58 | |
| d1qpza1 | 57 | Purine repressor (PurR), N-terminal domain {Escher | 84.29 | |
| d1j5ya1 | 65 | Putative transcriptional regulator TM1602, N-termi | 84.08 | |
| d1nr3a_ | 122 | DNA-binding protein Tfx {Archaeon Methanobacterium | 84.06 | |
| d1dpua_ | 69 | C-terminal domain of RPA32 {Human (Homo sapiens) [ | 84.01 | |
| d1zyba1 | 73 | Probable transcription regulator BT4300, C-termina | 83.76 | |
| d1i5za1 | 69 | Catabolite gene activator protein (CAP), C-termina | 83.76 | |
| d2croa_ | 65 | cro 434 {Bacteriophage 434 [TaxId: 10712]} | 83.59 | |
| d1vz0a1 | 93 | Putative partitioning protein ParB/Spo0J {Thermus | 83.55 | |
| d1r71a_ | 114 | Transcriptional repressor protein KorB DNA-binding | 83.47 | |
| d1y7ya1 | 69 | Restriction-modification controller protein C.AhdI | 83.38 | |
| d1r69a_ | 63 | 434 C1 repressor, DNA-binding domain {Bacteriophag | 83.31 | |
| d1au7a1 | 58 | Pit-1 POU homeodomain {Rat (Rattus norvegicus) [Ta | 83.22 | |
| d1ulya_ | 190 | Hypothetical protein PH1932 {Pyrococcus horikoshii | 83.16 | |
| d1e3oc1 | 57 | Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId | 82.93 | |
| d2cuea1 | 68 | Paired box protein pax6 {Human (Homo sapiens) [Tax | 82.82 | |
| d1jgga_ | 57 | Even-skipped homeodomain {Fruit fly (Drosophila me | 81.33 | |
| d1ub9a_ | 100 | Hypothetical protein PH1061 {Archaeon Pyrococcus h | 81.25 | |
| d3e5ua1 | 80 | Chlorophenol reduction protein CprK {Desulfitobact | 80.96 | |
| d1uhsa_ | 72 | Homeodomain-only protein, Hop {Mouse (Mus musculus | 80.95 | |
| d1x57a1 | 78 | Endothelial differentiation-related factor 1, EDF1 | 80.78 | |
| d1sfxa_ | 109 | Hypothetical protein AF2008 {Archaeoglobus fulgidu | 80.76 | |
| d2hsga1 | 57 | Glucose-resistance amylase regulator CcpA, N-termi | 80.72 | |
| d9anta_ | 56 | Antennapedia Homeodomain {Drosophila melanogaster | 80.48 | |
| d1pb6a1 | 72 | Hypothetical transcriptional regulator YcdC {Esche | 80.2 | |
| d2e1oa1 | 57 | Homeobox protein prh {Human (Homo sapiens) [TaxId: | 80.19 | |
| d1b0na2 | 68 | SinR repressor, DNA-binding domain {Bacillus subti | 80.06 |
| >d1ku2a2 a.177.1.1 (A:93-272) Sigma factor SigA {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Sigma2 domain of RNA polymerase sigma factors superfamily: Sigma2 domain of RNA polymerase sigma factors family: Sigma2 domain of RNA polymerase sigma factors domain: Sigma factor SigA species: Thermus aquaticus [TaxId: 271]
Probab=99.94 E-value=3.7e-28 Score=224.99 Aligned_cols=148 Identities=33% Similarity=0.581 Sum_probs=121.0
Q ss_pred hhHHHHHHhhccccCCCHHHHHHHHHHHHcCCcchhHHHHHHh------------------hhCCCCc---------hHH
Q 011454 191 NRLKGYVKGVVSEELLTHAEVVRLSKKIKTGLSLDDHKLRLKE------------------RLGCEPS---------MEQ 243 (485)
Q Consensus 191 ~~~~~yl~~i~~~~~Lt~eee~~L~~~ik~Gd~l~~~~~~l~~------------------~~g~~p~---------~~~ 243 (485)
|.++.||++|+++|+||++||++|+++|+.|..+.+....... ..++.|. ..+
T Consensus 2 DpVr~YLreig~v~LLT~EEEieLAr~Ie~g~~~~~~~~e~~~~~~~l~~e~~~~~~~~~~~~~~~~~~~e~~~~~~~~~ 81 (180)
T d1ku2a2 2 DPVRQYLHEIGQVPLLTLEEEIDLARKVEEGMEAIKKLSEATGLDQELIREVVRAKILGTARIQKIPGLKEKPDPKTVEE 81 (180)
T ss_dssp HHHHHHHHHHTTSCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHTTCSSCCCTTSCCSSCTTTHHH
T ss_pred CcHHHHHHHhcCcCCCCHHHHHHHHHHHHHHHHHHHHHHHhhhccHHHHHHHHHHHhhhHHHHhcchhhHHHhhHHHHHH
Confidence 5789999999999999999999999999988764433222210 1222222 233
Q ss_pred HHHHhhcC---hhHHHHhhhhhHHHHHHHHHHhHHHHHHHHHHhcCCCCcHHHHHHHHHHHHHHhHhcCCCCCCcchhhH
Q 011454 244 LAASLRIS---RPELQSILMECSLAREKLVMSNVRLVMSIAQRYDNMGADMADLVQGGLIGLLRGIEKFDSSKGFKISTY 320 (485)
Q Consensus 244 ~a~~~~~s---~~~L~~~l~~~~~A~e~Lie~yl~LV~sIA~ry~~~~~d~EDLiQEG~IgL~kAiekFDp~rG~rFsTY 320 (485)
+....... ..++.+....+..|+++||+.|+++|+++|++|.+.+.+++||+|||+|||++|+++|||++|++|+||
T Consensus 82 ~~~~~~~~~~el~~l~~~~~~~~~a~~~li~~~~~lv~~~a~~~~~~~~~~~dl~q~g~~gl~~a~~~fd~~~g~~f~ty 161 (180)
T d1ku2a2 82 VDGKLKSLPKELKRYLHIAREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGLIRAVEKFEYKRRFKFSTY 161 (180)
T ss_dssp HHHHHHSCCHHHHHHHHHHHHHHHHHHHHHHTTHHHHHHHHHTTCSSSSCHHHHHHHHHHHHHHHHHHCCGGGCSCHHHH
T ss_pred HHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcccCCCcCHHHHHHHHHHHHHHHHHHcCCCCCCCHHHH
Confidence 33333333 345566777899999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHHHHHHHHhhh
Q 011454 321 VYWWIRQGVSRALVENSR 338 (485)
Q Consensus 321 A~~~Ir~~I~~~I~~~~r 338 (485)
|+|||+++|.++|+++.|
T Consensus 162 a~~~i~~~i~~~~~~~~r 179 (180)
T d1ku2a2 162 ATWWIRQAINRAIADQAR 179 (180)
T ss_dssp HHHHHHHHHHHHHTTSCC
T ss_pred HHHHHHHHHHHHHHHhCC
Confidence 999999999999998875
|
| >d1siga_ a.177.1.1 (A:) Sigma70 {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1rp3a3 a.177.1.1 (A:0-86) Sigma factor sigma-28 (FliA) {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d2p7vb1 a.4.13.2 (B:546-613) Sigma70 (SigA, RpoD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1rp3a2 a.4.13.2 (A:164-234) Sigma factor sigma-28 (FliA) {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1ttya_ a.4.13.2 (A:) Sigma70 (SigA, RpoD) {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ku3a_ a.4.13.2 (A:) Sigma70 (SigA, RpoD) {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1or7a1 a.4.13.2 (A:120-187) SigmaE factor (RpoE) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xsva_ a.4.13.3 (A:) Hypothetical protein SAV1236 {Staphylococcus aureus, strain Mu50 / ATCC 700699 [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1s7oa_ a.4.13.3 (A:) Hypothetical protein SPy1201 {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1h3la_ a.177.1.1 (A:) Sigma factor SigR {Streptomyces coelicolor a3(2) [TaxId: 100226]} | Back information, alignment and structure |
|---|
| >d1yioa1 a.4.6.2 (A:131-200) Response regulatory protein StyR, C-terminal domain {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d1a04a1 a.4.6.2 (A:150-216) Nitrate/nitrite response regulator (NarL) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1l3la1 a.4.6.2 (A:170-234) Quorum-sensing transcription factor TraR, C-terminal domain {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1l0oc_ a.4.13.2 (C:) SigmaF {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1fsea_ a.4.6.2 (A:) Germination protein GerE {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1p4wa_ a.4.6.2 (A:) Transcriptional regulator RcsB {Erwinia amylovora [TaxId: 552]} | Back information, alignment and structure |
|---|
| >d1ku2a1 a.4.13.1 (A:273-332) Sigma factor SigA {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1rp3a1 a.4.13.1 (A:87-163) Sigma factor sigma-28 (FliA) {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1ijwc_ a.4.1.2 (C:) HIN recombinase (DNA-binding domain) {Synthetic} | Back information, alignment and structure |
|---|
| >d1l0oc_ a.4.13.2 (C:) SigmaF {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1jhfa1 a.4.5.2 (A:2-72) LexA repressor, N-terminal DNA-binding domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1rp3a1 a.4.13.1 (A:87-163) Sigma factor sigma-28 (FliA) {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1gdta1 a.4.1.2 (A:141-183) gamma,delta resolvase (C-terminal domain) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2cfxa1 a.4.5.32 (A:1-63) Transcriptional regulator LrpC {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2cg4a1 a.4.5.32 (A:4-66) Regulatory protein AsnC {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1i1ga1 a.4.5.32 (A:2-61) LprA {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1hlva1 a.4.1.7 (A:1-66) DNA-binding domain of centromere binding protein B (CENP-B) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cyya1 a.4.5.32 (A:5-64) Putative transcriptional regulator PH1519 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1k78a1 a.4.1.5 (A:19-81) Pax-5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pdnc_ a.4.1.5 (C:) Paired protein (prd) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2jn6a1 a.4.1.19 (A:1-89) Uncharacterized protein Cgl2762 {Corynebacterium glutamicum [TaxId: 1718]} | Back information, alignment and structure |
|---|
| >d2o3fa1 a.4.1.20 (A:1-83) Putative transcriptional regulator YbbH {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1ku2a1 a.4.13.1 (A:273-332) Sigma factor SigA {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1biaa1 a.4.5.1 (A:1-63) Biotin repressor, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ppxa1 a.35.1.3 (A:30-91) Uncharacterized protein Atu1735 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1uxda_ a.35.1.5 (A:) Fructose repressor (FruR), N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2d1ha1 a.4.5.50 (A:1-109) Hypothetical transcriptional regulator ST1889 {Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d2auwa1 a.35.1.10 (A:88-154) Hypothetical protein NE0471 C-terminal domain {Nitrosomonas europaea [TaxId: 915]} | Back information, alignment and structure |
|---|
| >d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1r1ua_ a.4.5.5 (A:) Metal-sensing transcriptional repressor CzrA {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1ft9a1 a.4.5.4 (A:134-213) CO-sensing protein CooA, C-terminal domain {Rhodospirillum rubrum [TaxId: 1085]} | Back information, alignment and structure |
|---|
| >d2isya1 a.4.5.24 (A:2-64) Iron-dependent regulator IdeR {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1ku9a_ a.4.5.36 (A:) DNA-binding protein Mj223 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1jhga_ a.4.12.1 (A:) Trp repressor, TrpR {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1stza1 a.4.5.51 (A:14-100) Heat-inducible transcription repressor HrcA, N-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2a6ca1 a.35.1.13 (A:1-69) HTH-motif protein NE1354 {Nitrosomonas europaea [TaxId: 915]} | Back information, alignment and structure |
|---|
| >d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1utxa_ a.35.1.3 (A:) Putative transcription regulator CylR2 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d3broa1 a.4.5.28 (A:3-137) Transcriptional regulator OEOE1854 {Oenococcus oeni [TaxId: 1247]} | Back information, alignment and structure |
|---|
| >d1z05a1 a.4.5.63 (A:10-80) Transcriptional regulator VC2007 N-terminal domain {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1r1ta_ a.4.5.5 (A:) SmtB repressor {Cyanobacteria (Synechococcus), pcc7942 [TaxId: 1129]} | Back information, alignment and structure |
|---|
| >d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2o38a1 a.35.1.13 (A:28-116) Hypothetical protein RPA3824 {Rhodopseudomonas palustris [TaxId: 1076]} | Back information, alignment and structure |
|---|
| >d1qpza1 a.35.1.5 (A:2-58) Purine repressor (PurR), N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1j5ya1 a.4.5.1 (A:3-67) Putative transcriptional regulator TM1602, N-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1nr3a_ d.236.1.1 (A:) DNA-binding protein Tfx {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1dpua_ a.4.5.16 (A:) C-terminal domain of RPA32 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zyba1 a.4.5.4 (A:148-220) Probable transcription regulator BT4300, C-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d1i5za1 a.4.5.4 (A:138-206) Catabolite gene activator protein (CAP), C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2croa_ a.35.1.2 (A:) cro 434 {Bacteriophage 434 [TaxId: 10712]} | Back information, alignment and structure |
|---|
| >d1vz0a1 a.4.14.1 (A:116-208) Putative partitioning protein ParB/Spo0J {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1r71a_ a.4.14.1 (A:) Transcriptional repressor protein KorB DNA-binding domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1y7ya1 a.35.1.3 (A:5-73) Restriction-modification controller protein C.AhdI {Aeromonas hydrophila [TaxId: 644]} | Back information, alignment and structure |
|---|
| >d1r69a_ a.35.1.2 (A:) 434 C1 repressor, DNA-binding domain {Bacteriophage 434 [TaxId: 10712]} | Back information, alignment and structure |
|---|
| >d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ulya_ a.4.5.58 (A:) Hypothetical protein PH1932 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1ub9a_ a.4.5.28 (A:) Hypothetical protein PH1061 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d3e5ua1 a.4.5.4 (A:148-227) Chlorophenol reduction protein CprK {Desulfitobacterium hafniense [TaxId: 49338]} | Back information, alignment and structure |
|---|
| >d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x57a1 a.35.1.12 (A:8-85) Endothelial differentiation-related factor 1, EDF1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sfxa_ a.4.5.50 (A:) Hypothetical protein AF2008 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2hsga1 a.35.1.5 (A:2-58) Glucose-resistance amylase regulator CcpA, N-terminal domain {Bacillus megaterium [TaxId: 1404]} | Back information, alignment and structure |
|---|
| >d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1pb6a1 a.4.1.9 (A:14-85) Hypothetical transcriptional regulator YcdC {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b0na2 a.35.1.3 (A:1-68) SinR repressor, DNA-binding domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|