Citrus Sinensis ID: 011454


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-----
MMATAAVIGLSAGKRLLSSSFYYSDISEKFSYINDLGSANSQVGSTKNVVAAKKSSNYNPSFPSSNRQTQPIKALKEHVDTNFASTAEPWAEPPNSIEEESSELDYSVEALLLLQKSMLEKQWNLSFERTVLTDSPSKKTHKKVPVTCSGVSARQRRLNSKKKILSQNKSILQQNGSKQLRSMISPELIQNRLKGYVKGVVSEELLTHAEVVRLSKKIKTGLSLDDHKLRLKERLGCEPSMEQLAASLRISRPELQSILMECSLAREKLVMSNVRLVMSIAQRYDNMGADMADLVQGGLIGLLRGIEKFDSSKGFKISTYVYWWIRQGVSRALVENSRTLRLPNHLHERLGLIRNAKLRLEEKGVTPSVDRIAEYLNMSQKKVRNATEVLAYIADNRVENNPWHGVDDWALKDEVNKLIIVTLGEREREIIRLYYGLDKECLTWEDISKRIGLSRERVRQVGLVALEKLKHAARKKKMEAMLVKH
ccccHHHHHcccccccHHccccccccHHHHHccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHccccccccccHHHHHHHcccccccccHHHHHHHHHHHHccccHHHHHHHHHHHHcccccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHccccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHcccccccccHHHHHHHHcccHHHHHHHHHHHHHHHHcHHHHHHHHHHHHcc
ccccHHHEEcccccHHHcccccccccccccccccccccccccccccccEEEEEcccccccccccccHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHcccccccccccccccHccHHHcccccccHHHHHcHHHHHHccccccccccccccccHHHHHccccccccHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHccHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHccccEccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHccccHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHccHHHccEEEEEEccccccccHHHHHHHHcccHHHHHHHHHHHHHHcccccHHHHHHHHHHcc
MMATAAVIGLSAGKRLLSSSFYYSDISEKFSYIndlgsansqvgsTKNVVAAkkssnynpsfpssnrqtqpiKALKEhvdtnfastaepwaeppnsieeesseLDYSVEALLLLQKSMLEKQWNLSFertvltdspskkthkkvpvtcsgvsARQRRLNSKKKILSQNKSILQQNGSkqlrsmisPELIQNRLKGYVKGVVSEELLTHAEVVRLSKKIktglslddHKLRLkerlgcepSMEQLAASLRISRPELQSILMECSLAREKLVMSNVRLVMSIAQRYDNMGADMADLVQGGLIGLLRGIekfdsskgfkisTYVYWWIRQGVSRALvensrtlrlpnhlhERLGLIRNAKLrleekgvtpsvDRIAEYLNMSQKKVRNATEVLAYIADnrvennpwhgvddwaLKDEVNKLIIVTLGEREREIIRLYYGldkecltweDISKRIGLSRERVRQVGLVALEKLKHAARKKKMEAMLVKH
MMATAAVIGLSAGKRLLSSSFYYSDISEKFSYINDLGSANSQVGSTKNVVAAKKssnynpsfpssnrqTQPIKALKEHVDTNFAstaepwaeppnSIEEESSELDYSVEALLLLQKSMLEKQWNLSFERtvltdspskkthkkvpvtcsgvsarqrrlnskkkilsqnksilqqngskqlrsMISPELIQNRLKGYVKGVVSEELLTHAEVVRlskkiktglslddhKLRLKERLGCEPSMEQLAASLRISRPELQSILMECSLAREKLVMSNVRLVMSIAQRYDNMGADMADLVQGGLIGLLRGiekfdsskgfkisTYVYWWIRQGVSRALVENSrtlrlpnhlherlglirnaklrleekgvtpsvdRIAEYLnmsqkkvrnATEVLAYIadnrvennpWHGVDDWALKDEVNKLIIvtlgererEIIRLYygldkecltwEDISkriglsrervrqVGLVALEKLKHAARKKKmeamlvkh
MMATAAVIGLSAGKRLLSSSFYYSDISEKFSYINDLGSANSQVGSTKNVVAAKKssnynpsfpssnRQTQPIKALKEHVDTNFASTAEPWAEPPNsieeesseLDYSVEALLLLQKSMLEKQWNLSFERTVLTDSPSKKTHKKVPVTCSGVSARQRRLNSKKKILSQNKSILQQNGSKQLRSMISPELIQNRLKGYVKGVVSEELLTHAEVVRLSKKIKTGLSLDDHKLRLKERLGCEPSMEQLAASLRISRPELQSILMECSLAREKLVMSNVRLVMSIAQRYDNMGADMADLVQGGLIGLLRGIEKFDSSKGFKISTYVYWWIRQGVSRALVENSRTLRLPNHLHERLGLIRNAKLRLEEKGVTPSVDRIAEYLNMSQKKVRNATEVLAYIADNRVENNPWHGVDDWALKDEVNKLIIVTLGEREREIIRLYYGLDKECLTWEDISKRIGLSRERVRQVGLVALEKLKHAARKKKMEAMLVKH
*****AVIGLSAGKRLLSSSFYYSDISEKFSYINDL*********************************************************************YSVEALLLLQKSMLEKQWNLSFERTVL******************************************************ELIQNRLKGYVKGVVSEELLTHAEVVRLSKKIKTGLSLDDHKLRLKERLGC**********LRISRPELQSILMECSLAREKLVMSNVRLVMSIAQRYDNMGADMADLVQGGLIGLLRGIEKFDSSKGFKISTYVYWWIRQGVSRALVENSRTLRLPNHLHERLGLIRNAKLRLEEKGVTPSVDRIAEYLNMSQKKVRNATEVLAYIADNRVENNPWHGVDDWALKDEVNKLIIVTLGEREREIIRLYYGLDKECLTWEDISKRIGLSRERVRQVGLVALEKL****************
****AAV*GLSAGKRLLSSSFYYSDISEK*****************************************************************************************************************************************************************NRLKGYVKGVVSEELLTHAEVVRLSKKIKTGLSLDDHKLRLKE*LGCEPSMEQLAASLRISRPELQSILMECSLAREKLVMSNVRLVMSIAQRYDNMGADMADLVQGGLIGLLRGIEKFDSSKGFKISTYVYWWIRQGVSRALVENSRTLRLPNHLHERLGLIRNAKLRLE**GVTPSVDRIAEYLNMSQKKVRNATEVLAYIADNRVENNPWHGVDDWALKDEVNKLIIVTLGEREREIIRLYYGLDKECLTWEDISKRIGLSRERVRQVGLVALEKLKHAARKKKMEAMLVK*
MMATAAVIGLSAGKRLLSSSFYYSDISEKFSYINDLGSANSQVGSTKNVVAAKKSSNY************PIKALKEHVDTNFASTAEPWAEPPNSIEEESSELDYSVEALLLLQKSMLEKQWNLSFERTVL*****************GVSARQRRLNSKKKILSQNKSILQQNGSKQLRSMISPELIQNRLKGYVKGVVSEELLTHAEVVRLSKKIKTGLSLDDHKLRLKERLGCEPSMEQLAASLRISRPELQSILMECSLAREKLVMSNVRLVMSIAQRYDNMGADMADLVQGGLIGLLRGIEKFDSSKGFKISTYVYWWIRQGVSRALVENSRTLRLPNHLHERLGLIRNAKLRLEEKGVTPSVDRIAEYLNMSQKKVRNATEVLAYIADNRVENNPWHGVDDWALKDEVNKLIIVTLGEREREIIRLYYGLDKECLTWEDISKRIGLSRERVRQVGLVALEKLKHAARKKKMEAMLVKH
*MATAAVIGLSAGKRLLSSSFYYSDISEKFSYINDLGSANSQVGSTKNVVAAKKSSNYNPS*****************************AE********SSELDYSVEALLLLQKSMLEKQWNLSFE***********************************************************LIQNRLKGYVKGVVSEELLTHAEVVRLSKKIKTGLSLDDHKLRLKERLGCEPSMEQLAASLRISRPELQSILMECSLAREKLVMSNVRLVMSIAQRYDNMGADMADLVQGGLIGLLRGIEKFDSSKGFKISTYVYWWIRQGVSRALVENSRTLRLPNHLHERLGLIRNAKLRLEEKGVTPSVDRIAEYLNMSQKKVRNATEVLAYIADNRVENNPWHGVDDWALKDEVNKLIIVTLGEREREIIRLYYGLDKECLTWEDISKRIGLSRERVRQVGLVALEKLKHAARKKKMEAML*KH
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMATAAVIGLSAGKRLLSSSFYYSDISEKFSYINDLGSANSQVGSTKNVVAAKKSSNYNPSFPSSNRQTQPIKALKEHVDTNFASTAEPWAEPPNSIEEESSELDYSVEALLLLQKSMLEKQWNLSFERTVLTDSPSKKTHKKVPVTCSGVSARQRRLNSKKKILSQNKSILQQNGSKQLRSMISPELIQNRLKGYVKGVVSEELLTHAEVVRLSKKIKTGLSLDDHKLRLKERLGCEPSMEQLAASLRISRPELQSILMECSLAREKLVMSNVRLVMSIAQRYDNMGADMADLVQGGLIGLLRGIEKFDSSKGFKISTYVYWWIRQGVSRALVENSRTLRLPNHLHERLGLIRNAKLRLEEKGVTPSVDRIAEYLNMSQKKVRNATEVLAYIADNRVENNPWHGVDDWALKDEVNKLIIVTLGEREREIIRLYYGLDKECLTWEDISKRIGLSRERVRQVGLVALEKLKHAARKKKMEAMLVKH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query485 2.2.26 [Sep-21-2011]
O24629502 RNA polymerase sigma fact yes no 0.962 0.930 0.684 0.0
P26683390 RNA polymerase sigma fact no no 0.585 0.728 0.345 2e-40
Q31ME3320 RNA polymerase sigma fact yes no 0.583 0.884 0.318 1e-39
O22056572 RNA polymerase sigma fact no no 0.674 0.571 0.321 3e-39
Q03065332 RNA polymerase sigma-B fa no no 0.564 0.825 0.319 4e-39
P38023399 RNA polymerase sigma fact no no 0.583 0.709 0.350 6e-39
P27785317 RNA polymerase sigma fact N/A no 0.562 0.861 0.335 1e-38
O33662371 RNA polymerase sigma fact yes no 0.439 0.574 0.363 5e-38
Q31QG5320 RNA polymerase sigma fact no no 0.575 0.871 0.336 7e-38
P18182396 RNA polymerase principal yes no 0.564 0.691 0.330 1e-37
>sp|O24629|SIGA_ARATH RNA polymerase sigma factor sigA OS=Arabidopsis thaliana GN=SIGA PE=1 SV=1 Back     alignment and function desciption
 Score =  688 bits (1775), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/519 (68%), Positives = 411/519 (79%), Gaps = 52/519 (10%)

Query: 2   MATAAVIGLSAGKRLLSSSFYYSDISEKFSYINDLGSANSQVGSTKNVVAAKKSSNYNPS 61
           MATAAVIGL+ GKRLLSSSFY+SD++EKF  +ND  S+   + STK+ + AKK+SNY+PS
Sbjct: 1   MATAAVIGLNTGKRLLSSSFYHSDVTEKFLSVNDHCSSQYHIASTKSGITAKKASNYSPS 60

Query: 62  FPSSNRQTQPIKALKEHVDTNFASTAEPWAEPPNSIEEESSE--------LDYSVEALLL 113
           FPSSNR TQ  KALKE VD   AST +PW   PN  ++E  E        + +SVEA+LL
Sbjct: 61  FPSSNRHTQSAKALKESVDV--ASTEKPWL--PNGTDKELEEECYDDDDLISHSVEAILL 116

Query: 114 LQKSMLEKQWNLSFERTVLTDSPSKKT--HKKVPV-TCSGVSARQRRLNSKKKI-LSQNK 169
           LQKSMLEK WNLSFE+ V ++ P K T   KK+PV TCSG+SARQRR+ +KKK  ++  K
Sbjct: 117 LQKSMLEKSWNLSFEKAVSSEYPGKGTIRKKKIPVITCSGISARQRRIGAKKKTNMTHVK 176

Query: 170 SILQQNGSKQLRSMISPELIQNRLKGYVKGVVSEELLTHAEVVRLSKKIKTGLSLDDHKL 229
           ++   +  KQ+R             GYVKGV+SE++L+H EVVRLSKKIK+GL LDDHK 
Sbjct: 177 AVSDVSSGKQVR-------------GYVKGVISEDVLSHVEVVRLSKKIKSGLRLDDHKS 223

Query: 230 RLKERLGCEPSMEQLAASLRISRPELQSILMECSLAREKLVMSNVRLVMSIAQRYDNMGA 289
           RLK+RLGCEPS EQLA SL+ISR ELQ+ LMEC LAREKL MSNVRLVMSIAQRYDN+GA
Sbjct: 224 RLKDRLGCEPSDEQLAVSLKISRAELQAWLMECHLAREKLAMSNVRLVMSIAQRYDNLGA 283

Query: 290 DMADLVQGGLIGLLRGIEKFDSSKGFKISTYVYWWIRQGVSRALVENSRTLRLPNHLHER 349
           +M+DLVQGGLIGLLRGIEKFDSSKGF+ISTYVYWWIRQGVSRALV+NSRTLRLP HLHER
Sbjct: 284 EMSDLVQGGLIGLLRGIEKFDSSKGFRISTYVYWWIRQGVSRALVDNSRTLRLPTHLHER 343

Query: 350 LGLIRNAKLRLEEKGVTPSVDRIAEYLNMSQKKVRNATEVL------------------- 390
           LGLIRNAKLRL+EKG+TPS+DRIAE LNMSQKKVRNATE +                   
Sbjct: 344 LGLIRNAKLRLQEKGITPSIDRIAESLNMSQKKVRNATEAVSKVFSLDRDAFPSLNGLPG 403

Query: 391 ----AYIADNRVENNPWHGVDDWALKDEVNKLIIVTLGEREREIIRLYYGLDKECLTWED 446
               +YIAD R+ENNPWHG DD ALK+EV+KLI  TLGERE+EIIRLYYGLDKECLTWED
Sbjct: 404 ETHHSYIADTRLENNPWHGYDDLALKEEVSKLISATLGEREKEIIRLYYGLDKECLTWED 463

Query: 447 ISKRIGLSRERVRQVGLVALEKLKHAARKKKMEAMLVKH 485
           ISKRIGLSRERVRQVGLVALEKLKHAARK+KMEAM++K+
Sbjct: 464 ISKRIGLSRERVRQVGLVALEKLKHAARKRKMEAMILKN 502




Essential protein. Sigma factors are initiation factors that promote the attachment of plastid-encoded RNA polymerase (PEP) to specific initiation sites and are then released. Controls the transcription of the psaA gene and thus modulates photosystem stoichiometry. Thereby maintains an harmonious electron flow and photosynthetic efficiency.
Arabidopsis thaliana (taxid: 3702)
>sp|P26683|RPOD_NOSS1 RNA polymerase sigma factor RpoD OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rpoD PE=3 SV=1 Back     alignment and function description
>sp|Q31ME3|RPOD2_SYNE7 RNA polymerase sigma factor rpoD2 OS=Synechococcus elongatus (strain PCC 7942) GN=rpoD2 PE=1 SV=1 Back     alignment and function description
>sp|O22056|SIGB_ARATH RNA polymerase sigma factor sigB OS=Arabidopsis thaliana GN=SIGB PE=2 SV=2 Back     alignment and function description
>sp|Q03065|RPSB_NOSS1 RNA polymerase sigma-B factor OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=sigB PE=3 SV=1 Back     alignment and function description
>sp|P38023|RPOD1_SYNE7 RNA polymerase sigma factor rpoD1 OS=Synechococcus elongatus (strain PCC 7942) GN=rpoD1 PE=3 SV=2 Back     alignment and function description
>sp|P27785|RPOD_STRAU RNA polymerase sigma factor RpoD OS=Streptomyces aureofaciens GN=rpoD PE=3 SV=1 Back     alignment and function description
>sp|O33662|RPOD_STRMU RNA polymerase sigma factor RpoD OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=rpoD PE=3 SV=1 Back     alignment and function description
>sp|Q31QG5|RPOD3_SYNE7 RNA polymerase sigma factor rpoD3 OS=Synechococcus elongatus (strain PCC 7942) GN=rpoD3 PE=3 SV=1 Back     alignment and function description
>sp|P18182|HRDA_STRCO RNA polymerase principal sigma factor HrdA OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=hrdA PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query485
255566078508 RNA polymerase sigma factor rpoD, putati 0.997 0.952 0.773 0.0
224146103509 predicted protein [Populus trichocarpa] 1.0 0.952 0.744 0.0
356543070503 PREDICTED: RNA polymerase sigma factor r 0.983 0.948 0.725 0.0
356531599503 PREDICTED: RNA polymerase sigma factor r 0.983 0.948 0.723 0.0
449468291508 PREDICTED: RNA polymerase sigma factor s 0.997 0.952 0.715 0.0
224124068499 predicted protein [Populus trichocarpa] 0.979 0.951 0.724 0.0
2565297502 RNA polymerase sigma subunit 1 [Arabidop 0.962 0.930 0.685 0.0
15217767502 sigma factor A [Arabidopsis thaliana] gi 0.962 0.930 0.684 0.0
11762220502 At1g64860 [Arabidopsis thaliana] 0.962 0.930 0.682 0.0
2398851502 plastid RNA polymerase sigma-subunit [Ar 0.962 0.930 0.682 0.0
>gi|255566078|ref|XP_002524027.1| RNA polymerase sigma factor rpoD, putative [Ricinus communis] gi|223536754|gb|EEF38395.1| RNA polymerase sigma factor rpoD, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  781 bits (2018), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/508 (77%), Positives = 434/508 (85%), Gaps = 24/508 (4%)

Query: 2   MATAAVIGLSAGKRLLSSSFYYSDISEKFSYINDLGSANSQVGSTKNVVAAKKSSNYNPS 61
           MATAAVIGLSAGKRLLSS+FYYSD++EK S  N+ G  + Q+ STK ++ AKKSSNY PS
Sbjct: 1   MATAAVIGLSAGKRLLSSTFYYSDLTEKLSSANEHGLTHYQITSTKTLIVAKKSSNYGPS 60

Query: 62  FPSSNRQTQPIKALKEHVDTNFA-STAEPWAEPPNSIEEESSELDYSVEALLLLQKSMLE 120
           FPSSNR TQ IKALKEHVDT  A STA    +  N +EEESS+LDYSVEALLLLQKSMLE
Sbjct: 61  FPSSNRNTQSIKALKEHVDTASAPSTAATQFKTFNDMEEESSDLDYSVEALLLLQKSMLE 120

Query: 121 KQWNLSFERTVLTDSPSKKTHKKVPVTCSGVSARQRRLNSKKKILSQNKSILQQNGSKQL 180
           KQWNLSFERT  +DSPS+K+ KK+PVTCSGVSARQRR+N ++K LSQ+K  +Q N  KQL
Sbjct: 121 KQWNLSFERTDSSDSPSRKSQKKIPVTCSGVSARQRRINIRRKNLSQSKFTVQANVFKQL 180

Query: 181 RSMISPELIQNRLKGYVKGVVSEELLTHAEVVRLSKKIKTGLSLDDHKLRLKERLGCEPS 240
           +S +SPEL+QNRLKGYVKGVVSEELL+HAEVVRLS+ IK GLSL+DHK RLKERLGC+PS
Sbjct: 181 KSAVSPELLQNRLKGYVKGVVSEELLSHAEVVRLSRIIKAGLSLEDHKSRLKERLGCDPS 240

Query: 241 MEQLAASLRISRPELQSILMECSLAREKLVMSNVRLVMSIAQRYDNMGADMADLVQGGLI 300
            EQ+A SL+ISR ELQS  + CSLAREKL MSNVRLVMSIAQRYDNMGA+MADLVQGGLI
Sbjct: 241 DEQVATSLKISRAELQSKSIACSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLVQGGLI 300

Query: 301 GLLRGIEKFDSSKGFKISTYVYWWIRQGVSRALVENSRTLRLPNHLHERLGLIRNAKLRL 360
           GLLRGIEKFDSSKGF+ISTYVYWWIRQGVSRALVENSRTLRLPNHLHERLGLIRNAK+RL
Sbjct: 301 GLLRGIEKFDSSKGFRISTYVYWWIRQGVSRALVENSRTLRLPNHLHERLGLIRNAKIRL 360

Query: 361 EEKGVTPSVDRIAEYLNMSQKKVRNATEVL-----------------------AYIADNR 397
           EEKGVTPS+DRIAE LN+SQKKVRNATE +                       +YIADN 
Sbjct: 361 EEKGVTPSIDRIAESLNISQKKVRNATEAVSKVFSLDREAFPSLNGLPGETHHSYIADNC 420

Query: 398 VENNPWHGVDDWALKDEVNKLIIVTLGEREREIIRLYYGLDKECLTWEDISKRIGLSRER 457
           +ENNPWHGVDDWALKDEVNKLI +TL ERE+EIIRLYYGLD E LTWEDISKRIGLSRER
Sbjct: 421 LENNPWHGVDDWALKDEVNKLINLTLQEREQEIIRLYYGLDNESLTWEDISKRIGLSRER 480

Query: 458 VRQVGLVALEKLKHAARKKKMEAMLVKH 485
           VRQVGLVALEKLKHAARKKK+EAMLVKH
Sbjct: 481 VRQVGLVALEKLKHAARKKKLEAMLVKH 508




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224146103|ref|XP_002325882.1| predicted protein [Populus trichocarpa] gi|222862757|gb|EEF00264.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356543070|ref|XP_003539986.1| PREDICTED: RNA polymerase sigma factor rpoD-like [Glycine max] Back     alignment and taxonomy information
>gi|356531599|ref|XP_003534364.1| PREDICTED: RNA polymerase sigma factor rpoD-like [Glycine max] Back     alignment and taxonomy information
>gi|449468291|ref|XP_004151855.1| PREDICTED: RNA polymerase sigma factor sigA-like [Cucumis sativus] gi|449514942|ref|XP_004164521.1| PREDICTED: RNA polymerase sigma factor sigA-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224124068|ref|XP_002319237.1| predicted protein [Populus trichocarpa] gi|222857613|gb|EEE95160.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|2565297|gb|AAB81958.1| RNA polymerase sigma subunit 1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|15217767|ref|NP_176666.1| sigma factor A [Arabidopsis thaliana] gi|75098242|sp|O24629.1|SIGA_ARATH RecName: Full=RNA polymerase sigma factor sigA; Short=Sigma factor A; Short=Sigma-A; AltName: Full=RNA polymerase sigma factor sig1; Short=Atsig1; Short=Sigma factor 1; AltName: Full=RNA polymerase sigma factor sig2; Short=Atsig2; Short=Sigma factor 2; AltName: Full=RNA polymerase sigma factor sigB; Short=Sigma factor B; Short=Sigma-B; Flags: Precursor gi|5042421|gb|AAD38260.1|AC006193_16 RNA polymerase sigma subunit 1 [Arabidopsis thaliana] gi|2353171|gb|AAB69384.1| sigma factor 1 [Arabidopsis thaliana] gi|2443408|dbj|BAA22421.1| SigA [Arabidopsis thaliana] gi|2558514|emb|CAA74640.1| plastid RNA polymerase sigma factor [Arabidopsis thaliana] gi|5478439|dbj|BAA82448.1| sigma factor SigA [Arabidopsis thaliana] gi|17064900|gb|AAL32604.1| RNA polymerase sigma subunit 1 [Arabidopsis thaliana] gi|20259916|gb|AAM13305.1| RNA polymerase sigma subunit 1 [Arabidopsis thaliana] gi|222423019|dbj|BAH19492.1| AT1G64860 [Arabidopsis thaliana] gi|332196177|gb|AEE34298.1| sigma factor A [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|11762220|gb|AAG40388.1|AF325036_1 At1g64860 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|2398851|dbj|BAA22214.1| plastid RNA polymerase sigma-subunit [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query485
TAIR|locus:2010871502 SIGA "AT1G64860" [Arabidopsis 0.777 0.750 0.649 3.4e-125
UNIPROTKB|O48655519 rsigA "Plastid RNA polymerase 0.785 0.734 0.478 8.2e-83
TAIR|locus:2025650572 SIG2 "AT1G08540" [Arabidopsis 0.472 0.400 0.357 6.6e-43
TAIR|locus:2057996547 SIGF "AT2G36990" [Arabidopsis 0.393 0.349 0.364 3.9e-39
TIGR_CMR|GSU_3089577 GSU_3089 "RNA polymerase sigma 0.389 0.327 0.356 7.2e-35
UNIPROTKB|P0A602528 rpoD "RNA polymerase sigma fac 0.371 0.340 0.365 8.4e-34
TIGR_CMR|CBU_1669352 CBU_1669 "RNA polymerase sigma 0.463 0.639 0.301 4.1e-32
TIGR_CMR|APH_0576627 APH_0576 "RNA polymerase sigma 0.453 0.350 0.306 1.1e-31
TIGR_CMR|CBU_1596698 CBU_1596 "RNA polymerase sigma 0.257 0.179 0.365 5.7e-31
TIGR_CMR|SPO_1750660 SPO_1750 "RNA polymerase sigma 0.265 0.195 0.4 7.5e-31
TAIR|locus:2010871 SIGA "AT1G64860" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1230 (438.0 bits), Expect = 3.4e-125, P = 3.4e-125
 Identities = 261/402 (64%), Positives = 306/402 (76%)

Query:     2 MATAAVIGLSAGKRLLSSSFYYSDISEKFSYINDLGSANSQVGSTKNVVAAKKXXXXXXX 61
             MATAAVIGL+ GKRLLSSSFY+SD++EKF  +ND  S+   + STK+ + AKK       
Sbjct:     1 MATAAVIGLNTGKRLLSSSFYHSDVTEKFLSVNDHCSSQYHIASTKSGITAKKASNYSPS 60

Query:    62 XXXXXRQTQPIKALKEHVDTNFASTAEPWA------EPPNXXXXXXXXLDYSVEALLLLQ 115
                  R TQ  KALKE VD   AST +PW       E           + +SVEA+LLLQ
Sbjct:    61 FPSSNRHTQSAKALKESVDV--ASTEKPWLPNGTDKELEEECYDDDDLISHSVEAILLLQ 118

Query:   116 KSMLEKQWNLSFERTVLTDSPSKKT--HKKVPV-TCSGVSARQRRLNSKKKI-LSQNKSI 171
             KSMLEK WNLSFE+ V ++ P K T   KK+PV TCSG+SARQRR+ +KKK  ++  K++
Sbjct:   119 KSMLEKSWNLSFEKAVSSEYPGKGTIRKKKIPVITCSGISARQRRIGAKKKTNMTHVKAV 178

Query:   172 LQQNGSKQLRSMISPELIQNRLKGYVKGVVSEELLTHAEVVRLSKKIKTGLSLDDHKLRL 231
                +  KQ+R             GYVKGV+SE++L+H EVVRLSKKIK+GL LDDHK RL
Sbjct:   179 SDVSSGKQVR-------------GYVKGVISEDVLSHVEVVRLSKKIKSGLRLDDHKSRL 225

Query:   232 KERLGCEPSMEQLAASLRISRPELQSILMECSLAREKLVMSNVRLVMSIAQRYDNMGADM 291
             K+RLGCEPS EQLA SL+ISR ELQ+ LMEC LAREKL MSNVRLVMSIAQRYDN+GA+M
Sbjct:   226 KDRLGCEPSDEQLAVSLKISRAELQAWLMECHLAREKLAMSNVRLVMSIAQRYDNLGAEM 285

Query:   292 ADLVQGGLIGLLRGIEKFDSSKGFKISTYVYWWIRQGVSRALVENSRTLRLPNHLHERLG 351
             +DLVQGGLIGLLRGIEKFDSSKGF+ISTYVYWWIRQGVSRALV+NSRTLRLP HLHERLG
Sbjct:   286 SDLVQGGLIGLLRGIEKFDSSKGFRISTYVYWWIRQGVSRALVDNSRTLRLPTHLHERLG 345

Query:   352 LIRNAKLRLEEKGVTPSVDRIAEYLNMSQKKVRNATEVLAYI 393
             LIRNAKLRL+EKG+TPS+DRIAE LNMSQKKVRNATE ++ +
Sbjct:   346 LIRNAKLRLQEKGITPSIDRIAESLNMSQKKVRNATEAVSKV 387


GO:0003677 "DNA binding" evidence=ISS
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0003899 "DNA-directed RNA polymerase activity" evidence=ISS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=ISS;IDA
GO:0009507 "chloroplast" evidence=IDA
GO:0071482 "cellular response to light stimulus" evidence=IEP
GO:0006352 "DNA-dependent transcription, initiation" evidence=IDA;TAS
GO:0005515 "protein binding" evidence=IPI
GO:0001053 "plastid sigma factor activity" evidence=IMP
GO:2001141 "regulation of RNA biosynthetic process" evidence=IMP
GO:0071461 "cellular response to redox state" evidence=IDA
GO:0080005 "photosystem stoichiometry adjustment" evidence=IDA
GO:0006833 "water transport" evidence=RCA
GO:0009651 "response to salt stress" evidence=RCA
GO:0009750 "response to fructose stimulus" evidence=RCA
GO:0016987 "sigma factor activity" evidence=ISS
UNIPROTKB|O48655 rsigA "Plastid RNA polymerase sigma factor" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2025650 SIG2 "AT1G08540" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2057996 SIGF "AT2G36990" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_3089 GSU_3089 "RNA polymerase sigma factor RpoD" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
UNIPROTKB|P0A602 rpoD "RNA polymerase sigma factor RpoD" [Mycobacterium tuberculosis (taxid:1773)] Back     alignment and assigned GO terms
TIGR_CMR|CBU_1669 CBU_1669 "RNA polymerase sigma factor RpoS" [Coxiella burnetii RSA 493 (taxid:227377)] Back     alignment and assigned GO terms
TIGR_CMR|APH_0576 APH_0576 "RNA polymerase sigma factor RpoD" [Anaplasma phagocytophilum HZ (taxid:212042)] Back     alignment and assigned GO terms
TIGR_CMR|CBU_1596 CBU_1596 "RNA polymerase sigma factor RpoD" [Coxiella burnetii RSA 493 (taxid:227377)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_1750 SPO_1750 "RNA polymerase sigma-70 factor RpoD" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O24629SIGA_ARATHNo assigned EC number0.68400.96280.9302yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
grail3.0065010301
hypothetical protein (510 aa)
(Populus trichocarpa)
Predicted Functional Partners:
gw1.XIV.2894.1
hypothetical protein (684 aa)
       0.431
fgenesh4_pg.C_LG_XVII000398
hypothetical protein (677 aa)
       0.430
eugene3.17410001
annotation not avaliable (472 aa)
       0.429
estExt_fgenesh4_pg.C_3210002
hypothetical protein (472 aa)
       0.426
gw1.321.23.1
annotation not avaliable (657 aa)
       0.420
eugene3.00001972
hypothetical protein (485 aa)
       0.411

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query485
TIGR02997298 TIGR02997, Sig70-cyanoRpoD, RNA polymerase sigma f 2e-73
PRK07405317 PRK07405, PRK07405, RNA polymerase sigma factor Si 1e-55
PRK07406373 PRK07406, PRK07406, RNA polymerase sigma factor Rp 3e-54
TIGR02393238 TIGR02393, RpoD_Cterm, RNA polymerase sigma factor 3e-54
COG0568342 COG0568, RpoD, DNA-directed RNA polymerase, sigma 5e-51
PRK07598415 PRK07598, PRK07598, RNA polymerase sigma factor Si 1e-48
PRK05949327 PRK05949, PRK05949, RNA polymerase sigma factor; V 3e-48
PRK07921324 PRK07921, PRK07921, RNA polymerase sigma factor Si 5e-47
TIGR02394285 TIGR02394, rpoS_proteo, RNA polymerase sigma facto 1e-43
PRK05901509 PRK05901, PRK05901, RNA polymerase sigma factor; P 1e-41
PRK09210367 PRK09210, PRK09210, RNA polymerase sigma factor Rp 9e-41
PRK05657325 PRK05657, PRK05657, RNA polymerase sigma factor Rp 2e-40
PRK05658619 PRK05658, PRK05658, RNA polymerase sigma factor Rp 1e-27
TIGR02980227 TIGR02980, SigBFG, RNA polymerase sigma-70 factor, 1e-24
COG1191247 COG1191, FliA, DNA-directed RNA polymerase special 3e-24
PRK05572252 PRK05572, PRK05572, sporulation sigma factor SigF; 7e-22
TIGR02392270 TIGR02392, rpoH_proteo, alternative sigma factor R 3e-21
PRK06596284 PRK06596, PRK06596, RNA polymerase factor sigma-32 4e-21
TIGR02885231 TIGR02885, spore_sigF, RNA polymerase sigma-F fact 1e-20
PRK07500289 PRK07500, rpoH2, RNA polymerase factor sigma-32; R 5e-20
PRK08215258 PRK08215, PRK08215, sporulation sigma factor SigG; 2e-18
pfam0454271 pfam04542, Sigma70_r2, Sigma-70 region 2 9e-18
TIGR02850254 TIGR02850, spore_sigG, RNA polymerase sigma-G fact 4e-17
PRK05803233 PRK05803, PRK05803, sporulation sigma factor SigK; 3e-15
TIGR02479224 TIGR02479, FliA_WhiG, RNA polymerase sigma factor, 7e-15
TIGR02941255 TIGR02941, Sigma_B, RNA polymerase sigma-B factor 2e-14
TIGR02846227 TIGR02846, spore_sigmaK, RNA polymerase sigma-K fa 7e-14
TIGR02937158 TIGR02937, sigma70-ECF, RNA polymerase sigma facto 2e-12
PRK08583257 PRK08583, PRK08583, RNA polymerase sigma factor Si 7e-12
PRK06288268 PRK06288, PRK06288, RNA polymerase sigma factor Wh 2e-10
TIGR02835234 TIGR02835, spore_sigmaE, RNA polymerase sigma-E fa 2e-09
PRK07670251 PRK07670, PRK07670, RNA polymerase sigma factor Si 2e-09
PRK07122264 PRK07122, PRK07122, RNA polymerase sigma factor Si 3e-09
PRK06986236 PRK06986, fliA, flagellar biosynthesis sigma facto 5e-09
pfam0454550 pfam04545, Sigma70_r4, Sigma-70, region 4 2e-08
PRK07408256 PRK07408, PRK07408, RNA polymerase sigma factor Si 6e-08
PRK05911257 PRK05911, PRK05911, RNA polymerase sigma factor si 5e-07
PRK08301234 PRK08301, PRK08301, sporulation sigma factor SigE; 7e-07
cd0617155 cd06171, Sigma70_r4, Sigma70, region (SR) 4 refers 9e-07
pfam0453978 pfam04539, Sigma70_r3, Sigma-70 region 3 4e-04
>gnl|CDD|234082 TIGR02997, Sig70-cyanoRpoD, RNA polymerase sigma factor, cyanobacterial RpoD-like family Back     alignment and domain information
 Score =  233 bits (596), Expect = 2e-73
 Identities = 110/287 (38%), Positives = 176/287 (61%), Gaps = 24/287 (8%)

Query: 205 LLTHAEVVRLSKKIKTGLSLDDHKLRLKERLGCEPSMEQLAASLRISRPELQSILMECSL 264
           LLT  E + L+++++  + L++ +  L+E+LG EPS E+ AA+  +S  EL+  L +   
Sbjct: 15  LLTPEEEIELARQVQQMMVLEELREELEEQLGREPSKEEWAAAAGLSEAELRQRLRQGQR 74

Query: 265 AREKLVMSNVRLVMSIAQRYDNMGADMADLVQGGLIGLLRGIEKFDSSKGFKISTYVYWW 324
           A+EK++ +N+RLV+S+A++Y N G ++ DL+Q G +GL R +EKFD ++G+K STY YWW
Sbjct: 75  AKEKMIKANLRLVVSVAKKYQNRGLELLDLIQEGSLGLERAVEKFDPTRGYKFSTYAYWW 134

Query: 325 IRQGVSRALVENSRTLRLPNHLHERLGLIRNAKLRL-EEKGVTPSVDRIAEYLNMSQKKV 383
           IRQG++RA+   SRT+RLP H+ E+L  I+  +  L ++ G TPS   IAE L +  ++V
Sbjct: 135 IRQGITRAIANQSRTIRLPIHITEKLNKIKKVQRELSQKLGRTPSEAEIAEALELEPEQV 194

Query: 384 RNA-------------------TEVLAYIADNRVENNPWHGVDDWALKDEVNKLIIVTLG 424
           R                     TE+   + D+    +P   V+  +L+ ++  L+   L 
Sbjct: 195 RELLQRARQPVSLDAPVGDEEDTELGDLLEDD--GESPEEQVERESLRQDLESLLA-ELT 251

Query: 425 EREREIIRLYYGLDKEC-LTWEDISKRIGLSRERVRQVGLVALEKLK 470
            RER+++RL +GLD    LT  +I +R+ LSRERVRQ+   AL KL+
Sbjct: 252 PRERQVLRLRFGLDGGEPLTLAEIGRRLNLSRERVRQIEAKALRKLR 298


This family includes a number of closely related sigma-70 (TIGR02937) factors in the cyanobacteria. All appear most closely related to the essential sigma-70 factor RpoD, and some score above trusted to the RpoD C-terminal domain model (TIGR02393). Length = 298

>gnl|CDD|180963 PRK07405, PRK07405, RNA polymerase sigma factor SigD; Validated Back     alignment and domain information
>gnl|CDD|236012 PRK07406, PRK07406, RNA polymerase sigma factor RpoD; Validated Back     alignment and domain information
>gnl|CDD|213709 TIGR02393, RpoD_Cterm, RNA polymerase sigma factor RpoD, C-terminal domain Back     alignment and domain information
>gnl|CDD|223642 COG0568, RpoD, DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) [Transcription] Back     alignment and domain information
>gnl|CDD|236067 PRK07598, PRK07598, RNA polymerase sigma factor SigC; Validated Back     alignment and domain information
>gnl|CDD|180321 PRK05949, PRK05949, RNA polymerase sigma factor; Validated Back     alignment and domain information
>gnl|CDD|181169 PRK07921, PRK07921, RNA polymerase sigma factor SigB; Reviewed Back     alignment and domain information
>gnl|CDD|131447 TIGR02394, rpoS_proteo, RNA polymerase sigma factor RpoS Back     alignment and domain information
>gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional Back     alignment and domain information
>gnl|CDD|236413 PRK09210, PRK09210, RNA polymerase sigma factor RpoD; Validated Back     alignment and domain information
>gnl|CDD|235548 PRK05657, PRK05657, RNA polymerase sigma factor RpoS; Validated Back     alignment and domain information
>gnl|CDD|235549 PRK05658, PRK05658, RNA polymerase sigma factor RpoD; Validated Back     alignment and domain information
>gnl|CDD|234078 TIGR02980, SigBFG, RNA polymerase sigma-70 factor, sigma-B/F/G subfamily Back     alignment and domain information
>gnl|CDD|224112 COG1191, FliA, DNA-directed RNA polymerase specialized sigma subunit [Transcription] Back     alignment and domain information
>gnl|CDD|180137 PRK05572, PRK05572, sporulation sigma factor SigF; Validated Back     alignment and domain information
>gnl|CDD|233844 TIGR02392, rpoH_proteo, alternative sigma factor RpoH Back     alignment and domain information
>gnl|CDD|235838 PRK06596, PRK06596, RNA polymerase factor sigma-32; Reviewed Back     alignment and domain information
>gnl|CDD|131931 TIGR02885, spore_sigF, RNA polymerase sigma-F factor Back     alignment and domain information
>gnl|CDD|236033 PRK07500, rpoH2, RNA polymerase factor sigma-32; Reviewed Back     alignment and domain information
>gnl|CDD|181296 PRK08215, PRK08215, sporulation sigma factor SigG; Reviewed Back     alignment and domain information
>gnl|CDD|218138 pfam04542, Sigma70_r2, Sigma-70 region 2 Back     alignment and domain information
>gnl|CDD|131897 TIGR02850, spore_sigG, RNA polymerase sigma-G factor Back     alignment and domain information
>gnl|CDD|180266 PRK05803, PRK05803, sporulation sigma factor SigK; Reviewed Back     alignment and domain information
>gnl|CDD|233885 TIGR02479, FliA_WhiG, RNA polymerase sigma factor, FliA/WhiG family Back     alignment and domain information
>gnl|CDD|131987 TIGR02941, Sigma_B, RNA polymerase sigma-B factor Back     alignment and domain information
>gnl|CDD|131893 TIGR02846, spore_sigmaK, RNA polymerase sigma-K factor Back     alignment and domain information
>gnl|CDD|234065 TIGR02937, sigma70-ECF, RNA polymerase sigma factor, sigma-70 family Back     alignment and domain information
>gnl|CDD|236306 PRK08583, PRK08583, RNA polymerase sigma factor SigB; Validated Back     alignment and domain information
>gnl|CDD|235770 PRK06288, PRK06288, RNA polymerase sigma factor WhiG; Reviewed Back     alignment and domain information
>gnl|CDD|131882 TIGR02835, spore_sigmaE, RNA polymerase sigma-E factor Back     alignment and domain information
>gnl|CDD|181075 PRK07670, PRK07670, RNA polymerase sigma factor SigD; Validated Back     alignment and domain information
>gnl|CDD|168831 PRK07122, PRK07122, RNA polymerase sigma factor SigF; Reviewed Back     alignment and domain information
>gnl|CDD|235901 PRK06986, fliA, flagellar biosynthesis sigma factor; Validated Back     alignment and domain information
>gnl|CDD|218139 pfam04545, Sigma70_r4, Sigma-70, region 4 Back     alignment and domain information
>gnl|CDD|180965 PRK07408, PRK07408, RNA polymerase sigma factor SigF; Reviewed Back     alignment and domain information
>gnl|CDD|235644 PRK05911, PRK05911, RNA polymerase sigma factor sigma-28; Reviewed Back     alignment and domain information
>gnl|CDD|236228 PRK08301, PRK08301, sporulation sigma factor SigE; Reviewed Back     alignment and domain information
>gnl|CDD|100119 cd06171, Sigma70_r4, Sigma70, region (SR) 4 refers to the most C-terminal of four conserved domains found in Escherichia coli (Ec) sigma70, the main housekeeping sigma, and related sigma-factors (SFs) Back     alignment and domain information
>gnl|CDD|146934 pfam04539, Sigma70_r3, Sigma-70 region 3 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 485
PRK07598415 RNA polymerase sigma factor SigC; Validated 100.0
PRK07406373 RNA polymerase sigma factor RpoD; Validated 100.0
PRK05949327 RNA polymerase sigma factor; Validated 100.0
TIGR02997298 Sig70-cyanoRpoD RNA polymerase sigma factor, cyano 100.0
PRK07405317 RNA polymerase sigma factor SigD; Validated 100.0
PRK05901509 RNA polymerase sigma factor; Provisional 100.0
PRK07921324 RNA polymerase sigma factor SigB; Reviewed 100.0
COG0568342 RpoD DNA-directed RNA polymerase, sigma subunit (s 100.0
PRK09210367 RNA polymerase sigma factor RpoD; Validated 100.0
PRK05658619 RNA polymerase sigma factor RpoD; Validated 100.0
PRK05657325 RNA polymerase sigma factor RpoS; Validated 100.0
PRK06596284 RNA polymerase factor sigma-32; Reviewed 100.0
TIGR02393238 RpoD_Cterm RNA polymerase sigma factor RpoD, C-ter 100.0
PRK07500289 rpoH2 RNA polymerase factor sigma-32; Reviewed 100.0
TIGR02392270 rpoH_proteo alternative sigma factor RpoH. A sigma 100.0
TIGR02394285 rpoS_proteo RNA polymerase sigma factor RpoS. A si 100.0
PRK07122264 RNA polymerase sigma factor SigF; Reviewed 100.0
COG1191247 FliA DNA-directed RNA polymerase specialized sigma 100.0
PRK07408256 RNA polymerase sigma factor SigF; Reviewed 100.0
TIGR02850254 spore_sigG RNA polymerase sigma-G factor. Members 100.0
PRK08215258 sporulation sigma factor SigG; Reviewed 100.0
TIGR02941255 Sigma_B RNA polymerase sigma-B factor. This sigma 100.0
PRK05911257 RNA polymerase sigma factor sigma-28; Reviewed 100.0
PRK06288268 RNA polymerase sigma factor WhiG; Reviewed 100.0
PRK08583257 RNA polymerase sigma factor SigB; Validated 100.0
TIGR02980227 SigBFG RNA polymerase sigma-70 factor, sigma-B/F/G 100.0
TIGR02885231 spore_sigF RNA polymerase sigma-F factor. Members 100.0
PRK07670251 RNA polymerase sigma factor SigD; Validated 100.0
PRK05572252 sporulation sigma factor SigF; Validated 100.0
TIGR02479224 FliA_WhiG RNA polymerase sigma factor, FliA/WhiG f 99.97
PRK06986236 fliA flagellar biosynthesis sigma factor; Validate 99.97
PRK12427231 flagellar biosynthesis sigma factor; Provisional 99.97
PRK05803233 sporulation sigma factor SigK; Reviewed 99.95
TIGR02846227 spore_sigmaK RNA polymerase sigma-K factor. The sp 99.93
PRK08301234 sporulation sigma factor SigE; Reviewed 99.93
PRK09648189 RNA polymerase sigma factor SigD; Reviewed 99.91
TIGR02835234 spore_sigmaE RNA polymerase sigma-E factor. Member 99.91
PRK09646194 RNA polymerase sigma factor SigK; Reviewed 99.9
PRK05602186 RNA polymerase sigma factor; Reviewed 99.9
PRK12513194 RNA polymerase sigma factor; Provisional 99.9
TIGR02952170 Sig70_famx2 RNA polymerase sigma-70 factor, TIGR02 99.9
PRK08295208 RNA polymerase factor sigma-70; Validated 99.89
PRK12519194 RNA polymerase sigma factor; Provisional 99.89
PRK06759154 RNA polymerase factor sigma-70; Validated 99.89
PRK11923193 algU RNA polymerase sigma factor AlgU; Provisional 99.89
PRK11922231 RNA polymerase sigma factor; Provisional 99.89
PRK12524196 RNA polymerase sigma factor; Provisional 99.89
PRK12514179 RNA polymerase sigma factor; Provisional 99.89
PRK12537182 RNA polymerase sigma factor; Provisional 99.88
PRK12534187 RNA polymerase sigma factor; Provisional 99.88
PRK12538233 RNA polymerase sigma factor; Provisional 99.88
PRK13919186 putative RNA polymerase sigma E protein; Provision 99.88
PRK12526206 RNA polymerase sigma factor; Provisional 99.88
TIGR02948187 SigW_bacill RNA polymerase sigma-W factor. This si 99.88
PRK09652182 RNA polymerase sigma factor RpoE; Provisional 99.88
TIGR02859198 spore_sigH RNA polymerase sigma-H factor. Members 99.87
PRK12531194 RNA polymerase sigma factor; Provisional 99.87
PRK06811189 RNA polymerase factor sigma-70; Validated 99.87
TIGR02939190 RpoE_Sigma70 RNA polymerase sigma factor RpoE. A s 99.87
PRK12542185 RNA polymerase sigma factor; Provisional 99.87
PRK09640188 RNA polymerase sigma factor SigX; Reviewed 99.87
PRK09641187 RNA polymerase sigma factor SigW; Provisional 99.87
PRK09643192 RNA polymerase sigma factor SigM; Reviewed 99.87
PRK11924179 RNA polymerase sigma factor; Provisional 99.86
PRK12515189 RNA polymerase sigma factor; Provisional 99.86
TIGR02954169 Sig70_famx3 RNA polymerase sigma-70 factor, TIGR02 99.86
PRK12543179 RNA polymerase sigma factor; Provisional 99.86
PRK09638176 RNA polymerase sigma factor SigY; Reviewed 99.86
PRK12536181 RNA polymerase sigma factor; Provisional 99.86
PRK09645173 RNA polymerase sigma factor SigL; Provisional 99.86
PRK12512184 RNA polymerase sigma factor; Provisional 99.86
PRK09649185 RNA polymerase sigma factor SigC; Reviewed 99.86
TIGR03001244 Sig-70_gmx1 RNA polymerase sigma-70 factor, Myxoco 99.86
TIGR02999183 Sig-70_X6 RNA polymerase sigma factor, TIGR02999 f 99.86
PRK12539184 RNA polymerase sigma factor; Provisional 99.85
PRK09415179 RNA polymerase factor sigma C; Reviewed 99.85
TIGR02985161 Sig70_bacteroi1 RNA polymerase sigma-70 factor, Ba 99.85
TIGR02989159 Sig-70_gvs1 RNA polymerase sigma-70 factor, Rhodop 99.85
TIGR02937158 sigma70-ECF RNA polymerase sigma factor, sigma-70 99.85
PRK12518175 RNA polymerase sigma factor; Provisional 99.85
PRK12520191 RNA polymerase sigma factor; Provisional 99.85
PRK12522173 RNA polymerase sigma factor; Provisional 99.84
PRK12516187 RNA polymerase sigma factor; Provisional 99.84
PRK09642160 RNA polymerase sigma factor SigW; Reviewed 99.84
PRK12535196 RNA polymerase sigma factor; Provisional 99.84
TIGR02983162 SigE-fam_strep RNA polymerase sigma-70 factor, sig 99.84
TIGR02984189 Sig-70_plancto1 RNA polymerase sigma-70 factor, Pl 99.84
PRK12547164 RNA polymerase sigma factor; Provisional 99.84
COG1595182 RpoE DNA-directed RNA polymerase specialized sigma 99.83
PRK09644165 RNA polymerase sigma factor SigM; Provisional 99.83
TIGR02947193 SigH_actino RNA polymerase sigma-70 factor, TIGR02 99.83
PRK12523172 RNA polymerase sigma factor; Reviewed 99.83
PRK12533216 RNA polymerase sigma factor; Provisional 99.83
PRK12529178 RNA polymerase sigma factor; Provisional 99.83
PRK09647203 RNA polymerase sigma factor SigE; Reviewed 99.82
PRK09639166 RNA polymerase sigma factor SigX; Provisional 99.82
PRK12528161 RNA polymerase sigma factor; Provisional 99.81
PRK12541161 RNA polymerase sigma factor; Provisional 99.81
TIGR02943188 Sig70_famx1 RNA polymerase sigma-70 factor, TIGR02 99.81
PRK08241 339 RNA polymerase factor sigma-70; Validated 99.81
PRK12540182 RNA polymerase sigma factor; Provisional 99.81
PRK12532195 RNA polymerase sigma factor; Provisional 99.8
PRK12545201 RNA polymerase sigma factor; Provisional 99.8
PRK09637181 RNA polymerase sigma factor SigZ; Provisional 99.8
PRK12530189 RNA polymerase sigma factor; Provisional 99.8
PRK12544206 RNA polymerase sigma factor; Provisional 99.8
TIGR02950154 SigM_subfam RNA polymerase sigma factor, SigM fami 99.79
PRK12517188 RNA polymerase sigma factor; Provisional 99.79
PRK07037163 extracytoplasmic-function sigma-70 factor; Validat 99.79
TIGR02960 324 SigX5 RNA polymerase sigma-70 factor, TIGR02960 fa 99.79
PRK09651172 RNA polymerase sigma factor FecI; Provisional 99.79
PRK12527159 RNA polymerase sigma factor; Reviewed 99.79
TIGR02959170 SigZ RNA polymerase sigma factor, SigZ family. Thi 99.79
PRK12546188 RNA polymerase sigma factor; Provisional 99.78
PRK12511182 RNA polymerase sigma factor; Provisional 99.77
TIGR02895218 spore_sigI RNA polymerase sigma-I factor. Members 99.77
PRK12525168 RNA polymerase sigma factor; Provisional 99.76
PRK06704228 RNA polymerase factor sigma-70; Validated 99.72
PRK09047161 RNA polymerase factor sigma-70; Validated 99.7
PRK09636 293 RNA polymerase sigma factor SigJ; Provisional 99.69
TIGR02957 281 SigX4 RNA polymerase sigma-70 factor, TIGR02957 fa 99.67
PRK09635 290 sigI RNA polymerase sigma factor SigI; Provisional 99.66
PRK09191 261 two-component response regulator; Provisional 99.6
TIGR03209142 P21_Cbot clostridium toxin-associated regulator Bo 99.56
PRK08311237 putative RNA polymerase sigma factor SigI; Reviewe 99.55
PF07638185 Sigma70_ECF: ECF sigma factor 99.52
PF0454271 Sigma70_r2: Sigma-70 region 2 ; InterPro: IPR00762 99.26
PF0454550 Sigma70_r4: Sigma-70, region 4; InterPro: IPR00763 99.18
PF0828154 Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013 98.96
PRK06930170 positive control sigma-like factor; Validated 98.71
PRK00118104 putative DNA-binding protein; Validated 98.61
cd0617155 Sigma70_r4 Sigma70, region (SR) 4 refers to the mo 98.39
TIGR00721137 tfx DNA-binding protein, Tfx family. Tfx from Meth 98.28
PRK03975141 tfx putative transcriptional regulator; Provisiona 98.24
PRK04217110 hypothetical protein; Provisional 98.24
PF04297101 UPF0122: Putative helix-turn-helix protein, YlxM / 98.21
smart0042158 HTH_LUXR helix_turn_helix, Lux Regulon. lux regulo 97.93
PF0019658 GerE: Bacterial regulatory proteins, luxR family; 97.85
TIGR01636134 phage_rinA phage transcriptional activator, RinA f 97.85
cd0617057 LuxR_C_like C-terminal DNA-binding domain of LuxR- 97.8
PF07374100 DUF1492: Protein of unknown function (DUF1492); In 97.79
TIGR0387973 near_KaiC_dom probable regulatory domain. This mod 97.72
PF0496753 HTH_10: HTH DNA binding domain; InterPro: IPR00705 97.71
PRK15411207 rcsA colanic acid capsular biosynthesis activation 97.59
PRK11475207 DNA-binding transcriptional activator BglJ; Provis 97.56
PF0014037 Sigma70_r1_2: Sigma-70 factor, region 1.2; InterPr 97.55
PRK15201198 fimbriae regulatory protein FimW; Provisional 97.54
PRK10840216 transcriptional regulator RcsB; Provisional 97.52
TIGR0132194 TrpR trp operon repressor, proteobacterial. This m 97.49
PRK13719217 conjugal transfer transcriptional regulator TraJ; 97.48
COG2197211 CitB Response regulator containing a CheY-like rec 97.48
PF1393644 HTH_38: Helix-turn-helix domain; PDB: 2W48_A. 97.41
COG4566202 TtrR Response regulator [Signal transduction mecha 97.39
TIGR03541232 reg_near_HchA LuxR family transcriptional regulato 97.38
TIGR03020247 EpsA transcriptional regulator EpsA. Proteins in t 97.36
PRK10100216 DNA-binding transcriptional regulator CsgD; Provis 97.36
PRK10188240 DNA-binding transcriptional activator SdiA; Provis 97.3
PF02001106 DUF134: Protein of unknown function DUF134; InterP 97.29
PRK13870234 transcriptional regulator TraR; Provisional 97.27
COG277165 CsgD DNA-binding HTH domain-containing proteins [T 97.24
PRK09483217 response regulator; Provisional 97.14
COG4941 415 Predicted RNA polymerase sigma factor containing a 97.11
COG2739105 Uncharacterized protein conserved in bacteria [Fun 97.09
PRK15369211 two component system sensor kinase SsrB; Provision 97.03
COG3413215 Predicted DNA binding protein [General function pr 96.89
PRK10651216 transcriptional regulator NarL; Provisional 96.82
PF0453978 Sigma70_r3: Sigma-70 region 3; InterPro: IPR007624 96.72
PRK09390202 fixJ response regulator FixJ; Provisional 96.71
PRK15320251 transcriptional activator SprB; Provisional 96.67
COG134299 Predicted DNA-binding proteins [General function p 96.54
PRK0138199 Trp operon repressor; Provisional 96.52
TIGR01637132 phage_arpU phage transcriptional regulator, ArpU f 96.34
COG1356143 tfx Transcriptional regulator [DNA replication, re 96.34
PRK10403215 transcriptional regulator NarP; Provisional 96.34
PF1264565 HTH_16: Helix-turn-helix domain; InterPro: IPR0247 96.16
PRK10360196 DNA-binding transcriptional activator UhpA; Provis 96.16
PRK09935210 transcriptional regulator FimZ; Provisional 96.15
PRK04841903 transcriptional regulator MalT; Provisional 96.12
PRK13558665 bacterio-opsin activator; Provisional 96.01
PRK09958204 DNA-binding transcriptional activator EvgA; Provis 95.95
PF1361353 HTH_Tnp_4: Helix-turn-helix of DDE superfamily end 95.79
PF1338450 HTH_23: Homeodomain-like domain; PDB: 2X48_C. 95.71
PRK05658 619 RNA polymerase sigma factor RpoD; Validated 95.58
PRK15418 318 transcriptional regulator LsrR; Provisional 95.55
PF1341248 HTH_24: Winged helix-turn-helix DNA-binding; PDB: 95.33
TIGR0253188 yecD_yerC TrpR-related protein YerC/YecD. This mod 95.29
PF0279645 HTH_7: Helix-turn-helix domain of resolvase; Inter 95.19
cd0056942 HTH_Hin_like Helix-turn-helix domain of Hin and re 94.9
PF05263130 DUF722: Protein of unknown function (DUF722); Inte 94.69
PF0605658 Terminase_5: Putative ATPase subunit of terminase 94.3
PF0032532 Crp: Bacterial regulatory proteins, crp family; In 94.23
PF06530125 Phage_antitermQ: Phage antitermination protein Q; 94.16
COG2909894 MalT ATP-dependent transcriptional regulator [Tran 93.89
PF0172665 LexA_DNA_bind: LexA DNA binding domain; InterPro: 93.89
PF1340442 HTH_AsnC-type: AsnC-type helix-turn-helix domain; 93.79
PRK10430239 DNA-binding transcriptional activator DcuR; Provis 93.63
PF0453978 Sigma70_r3: Sigma-70 region 3; InterPro: IPR007624 93.51
PF1351852 HTH_28: Helix-turn-helix domain 93.5
PF1066860 Phage_terminase: Phage terminase small subunit; In 93.4
COG2390 321 DeoR Transcriptional regulator, contains sigma fac 93.39
smart00351125 PAX Paired Box domain. 93.07
PF09862113 DUF2089: Protein of unknown function (DUF2089); In 92.71
PF1280262 MarR_2: MarR family; PDB: 3ECO_B 2QWW_B 3KP6_B 3KP 92.44
PF0421853 CENP-B_N: CENP-B N-terminal DNA-binding domain; In 92.21
PF0102247 HTH_5: Bacterial regulatory protein, arsR family; 92.01
PF0137187 Trp_repressor: Trp repressor protein; InterPro: IP 91.89
PF1284061 HTH_20: Helix-turn-helix domain; PDB: 1ULY_A 2CWE_ 91.72
PF1373055 HTH_36: Helix-turn-helix domain 91.41
PHA0067578 hypothetical protein 91.21
PHA0259183 hypothetical protein; Provisional 91.16
cd00131128 PAX Paired Box domain 91.1
PF1374480 HTH_37: Helix-turn-helix domain; PDB: 2A6C_B 2O38_ 90.48
PF0827955 HTH_11: HTH domain; InterPro: IPR013196 Winged hel 89.95
PF13022142 HTH_Tnp_1_2: Helix-turn-helix of insertion element 89.91
smart0055068 Zalpha Z-DNA-binding domain in adenosine deaminase 89.9
PF0141877 HTH_6: Helix-turn-helix domain, rpiR family; Inter 89.76
PF0132560 Fe_dep_repress: Iron dependent repressor, N-termin 89.62
COG3415138 Transposase and inactivated derivatives [DNA repli 89.39
PF1354252 HTH_Tnp_ISL3: Helix-turn-helix domain of transposa 89.2
TIGR02395429 rpoN_sigma RNA polymerase sigma-54 factor. A sigma 89.03
PRK11083228 DNA-binding response regulator CreB; Provisional 88.79
PF0035646 LacI: Bacterial regulatory proteins, lacI family; 88.72
PF01710119 HTH_Tnp_IS630: Transposase; InterPro: IPR002622 Tr 88.57
PRK11179153 DNA-binding transcriptional regulator AsnC; Provis 88.5
PF0344478 HrcA_DNA-bdg: Winged helix-turn-helix transcriptio 88.15
PRK10046225 dpiA two-component response regulator DpiA; Provis 88.13
PRK10336219 DNA-binding transcriptional regulator QseB; Provis 88.0
PF0265085 HTH_WhiA: WhiA C-terminal HTH domain; InterPro: IP 87.9
PRK09413121 IS2 repressor TnpA; Reviewed 87.86
TIGR0161095 phage_O_Nterm phage replication protein O, N-termi 87.84
PF0104759 MarR: MarR family; InterPro: IPR000835 The MarR-ty 87.61
PRK05932455 RNA polymerase factor sigma-54; Reviewed 87.53
smart00344108 HTH_ASNC helix_turn_helix ASNC type. AsnC: an auto 87.45
PRK11169164 leucine-responsive transcriptional regulator; Prov 87.19
PRK10710240 DNA-binding transcriptional regulator BaeR; Provis 87.04
COG2973103 TrpR Trp operon repressor [Transcription] 87.03
PRK13413200 mpi multiple promoter invertase; Provisional 86.89
PHA02547179 55 RNA polymerase sigma factor; Provisional 86.79
PF13551112 HTH_29: Winged helix-turn helix 86.24
PF1272851 HTH_17: Helix-turn-helix domain 85.84
PF13551112 HTH_29: Winged helix-turn helix 85.39
TIGR02154226 PhoB phosphate regulon transcriptional regulatory 85.35
cd0476249 HTH_MerR-trunc Helix-Turn-Helix DNA binding domain 85.26
PRK15479221 transcriptional regulatory protein TctD; Provision 85.25
TIGR03787227 marine_sort_RR proteobacterial dedicated sortase s 85.18
PF1346368 HTH_27: Winged helix DNA-binding domain; PDB: 3GFL 85.11
PF1142750 HTH_Tnp_Tc3_1: Tc3 transposase; PDB: 1U78_A 1TC3_C 85.05
COG2522119 Predicted transcriptional regulator [General funct 84.93
COG1191247 FliA DNA-directed RNA polymerase specialized sigma 84.86
PF0004657 Homeobox: Homeobox domain not present here.; Inter 84.56
PF08822 165 DUF1804: Protein of unknown function (DUF1804); In 84.4
TIGR0176449 excise DNA binding domain, excisionase family. An 83.69
PF1301185 LZ_Tnp_IS481: leucine-zipper of insertion element 83.67
COG1522154 Lrp Transcriptional regulators [Transcription] 83.61
PF0152776 HTH_Tnp_1: Transposase; InterPro: IPR002514 Transp 83.48
CHL00148240 orf27 Ycf27; Reviewed 83.26
PRK07408256 RNA polymerase sigma factor SigF; Reviewed 83.19
PRK12423 202 LexA repressor; Provisional 83.06
PF0197868 TrmB: Sugar-specific transcriptional regulator Trm 82.81
PF0138155 HTH_3: Helix-turn-helix; InterPro: IPR001387 This 82.72
PF0822057 HTH_DeoR: DeoR-like helix-turn-helix domain; Inter 82.41
PRK09210367 RNA polymerase sigma factor RpoD; Validated 82.35
cd0476149 HTH_MerR-SF Helix-Turn-Helix DNA binding domain of 82.26
KOG0484125 consensus Transcription factor PHOX2/ARIX, contain 81.95
PHA0197667 helix-turn-helix protein 81.89
PF0295442 HTH_8: Bacterial regulatory protein, Fis family; I 81.64
TIGR02393238 RpoD_Cterm RNA polymerase sigma factor RpoD, C-ter 81.2
PRK1408265 hypothetical protein; Provisional 80.92
PRK05911257 RNA polymerase sigma factor sigma-28; Reviewed 80.75
PHA0054282 putative Cro-like protein 80.63
COG0856 203 Orotate phosphoribosyltransferase homologs [Nucleo 80.38
smart0042053 HTH_DEOR helix_turn_helix, Deoxyribose operon repr 80.24
TIGR0012269 birA_repr_reg BirA biotin operon repressor domain. 80.1
>PRK07598 RNA polymerase sigma factor SigC; Validated Back     alignment and domain information
Probab=100.00  E-value=1.4e-51  Score=430.43  Aligned_cols=290  Identities=36%  Similarity=0.637  Sum_probs=264.2

Q ss_pred             hhHHHHHHhhccccCCCHHHHHHHHHHHHcCCc--------------------chhHHHHHHhhhCCCCchHHHHHHhh-
Q 011454          191 NRLKGYVKGVVSEELLTHAEVVRLSKKIKTGLS--------------------LDDHKLRLKERLGCEPSMEQLAASLR-  249 (485)
Q Consensus       191 ~~~~~yl~~i~~~~~Lt~eee~~L~~~ik~Gd~--------------------l~~~~~~l~~~~g~~p~~~~~a~~~~-  249 (485)
                      |.++.||++|++.|+||++||++|+++++.+-.                    |+..+.+|++.+|++|+..+||.++| 
T Consensus        60 d~v~~yl~~igr~~lL~~~eEv~l~~~vq~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~l~~~~g~~pt~~ewa~~~~~  139 (415)
T PRK07598         60 DLVRLYLQEIGRVRLLGRDEEVSEAQKVQRYMKLIVLANAAKEGDEVIKPYLRLIEVRERLTSELGHRPSLERWAKTADI  139 (415)
T ss_pred             ChHHHHHHhcccccCCCHHHHHHHHHHHHHHHHHhhhhhhhhcccchhhhHHHHHHHHHHHHHHhCCCCCHHHHHHHhCC
Confidence            688999999999999999999999999999988                    88899999999999999999995555 


Q ss_pred             ---------------------cChhHHHHhhhhhHHHHHHHHHHhHHHHHHHHHHhcCCCCcHHHHHHHHHHHHHHhHhc
Q 011454          250 ---------------------ISRPELQSILMECSLAREKLVMSNVRLVMSIAQRYDNMGADMADLVQGGLIGLLRGIEK  308 (485)
Q Consensus       250 ---------------------~s~~~L~~~l~~~~~A~e~Lie~yl~LV~sIA~ry~~~~~d~EDLiQEG~IgL~kAiek  308 (485)
                                           ++.++|++.+..|..|+++||..|+++|+++|++|.+++.+++||+|||++|||+|+++
T Consensus       140 ~~~~l~~~l~~~~~~~~~~~~l~~~eL~~~l~~G~~A~e~LI~~nlrLVvsiAkky~~~g~~~eDLiQEG~iGL~ravek  219 (415)
T PRK07598        140 SLADLKPTLAEGKRRWAEIAKLTVEELEQIQKQGLRAKEHMIKANLRLVVSVAKKYQNRGLELLDLVQEGTLGLERAVEK  219 (415)
T ss_pred             cHHHHHHhhhhhhhhhhhhccCCHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHccCCCCHHHHHHHHHHHHHHHHHH
Confidence                                 55566666667888999999999999999999999999999999999999999999999


Q ss_pred             CCCCCCcchhhHHHHHHHHHHHHHHHHhhhhccccccHHHHHHHHHHHHHHHH-HcCCCCCHHHHHHHhCCCHHHHHHHH
Q 011454          309 FDSSKGFKISTYVYWWIRQGVSRALVENSRTLRLPNHLHERLGLIRNAKLRLE-EKGVTPSVDRIAEYLNMSQKKVRNAT  387 (485)
Q Consensus       309 FDp~rG~rFsTYA~~~Ir~~I~~~I~~~~r~irip~~~~~~~~kirka~~~L~-~~gr~ps~eEIae~L~is~eev~~~l  387 (485)
                      |||.+|++|+||++||||++|.+++.++.+++++|.++.+.+++++++...+. .+|+.|+.++||+.+|++++++++++
T Consensus       220 FDp~rG~rFSTYa~wwIRqaI~r~i~~~srtIrlP~~i~e~l~~lrk~~r~L~~~lgR~pt~~EiA~~l~is~~~vr~~l  299 (415)
T PRK07598        220 FDPTKGYRFSTYAYWWIRQGITRAIATQSRTIRLPVHITEKLNKIKKAQRKISQEKGRTPTIEDIAQELEMTPTQVREVL  299 (415)
T ss_pred             cCcccCCCHHHHHHHHHHHHHHHHHHHcCCceehhHHHHHHHHHHHHHHHHHHHHhCCCCCHHHHHHHhCCCHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999998884 78999999999999999999999987


Q ss_pred             HHH-------------------HhhhcccCCCCCcchHHHHHHHHHHHHHHHhhCCHHHHHHHhhHhcc-CCCCCCHHHH
Q 011454          388 EVL-------------------AYIADNRVENNPWHGVDDWALKDEVNKLIIVTLGEREREIIRLYYGL-DKECLTWEDI  447 (485)
Q Consensus       388 ~~~-------------------~~l~D~~~e~~pee~~e~~el~e~L~~~L~~~Lp~rER~VI~LryGL-~~eg~S~eEI  447 (485)
                      ...                   +++++.  ...|++.+....+...|..+| +.|||+||.||.|+||| +++++|++||
T Consensus       300 ~~~~~~~SLd~~vg~~~d~~l~d~l~~~--~~~pee~~~~~~l~~~L~~~L-~~L~~reR~VI~LRygl~d~~~~Tl~EI  376 (415)
T PRK07598        300 LRVPRSVSLETKVGKDKDTELGDLLETD--DISPEEMLMRESLQRDLQHLL-ADLTSRERDVIRMRFGLADGHTYSLAEI  376 (415)
T ss_pred             HHccCCcccccccCCCccccHHHhccCC--CCCHHHHHHHHHHHHHHHHHH-HhCCHHHHHHHHHHHhcCCCCCCCHHHH
Confidence            653                   122211  235667777778888999999 89999999999999998 4578999999


Q ss_pred             HHHHCCCHHHHHHHHHHHHHHHHHHHHhhhHHHhhh
Q 011454          448 SKRIGLSRERVRQVGLVALEKLKHAARKKKMEAMLV  483 (485)
Q Consensus       448 Ae~LgIS~~tVrqi~~rALkKLRk~L~~~~l~~~l~  483 (485)
                      |+.||||+++|++++++|+++||+.-....++.|+.
T Consensus       377 A~~LGvS~erVRqie~rAl~KLR~~~~~~~l~~y~~  412 (415)
T PRK07598        377 GRALDLSRERVRQIESKALQKLRQPKRRNRIRDYLE  412 (415)
T ss_pred             HHHHCcCHHHHHHHHHHHHHHHhchhHHHHHHHHHH
Confidence            999999999999999999999999988889999985



>PRK07406 RNA polymerase sigma factor RpoD; Validated Back     alignment and domain information
>PRK05949 RNA polymerase sigma factor; Validated Back     alignment and domain information
>TIGR02997 Sig70-cyanoRpoD RNA polymerase sigma factor, cyanobacterial RpoD-like family Back     alignment and domain information
>PRK07405 RNA polymerase sigma factor SigD; Validated Back     alignment and domain information
>PRK05901 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK07921 RNA polymerase sigma factor SigB; Reviewed Back     alignment and domain information
>COG0568 RpoD DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) [Transcription] Back     alignment and domain information
>PRK09210 RNA polymerase sigma factor RpoD; Validated Back     alignment and domain information
>PRK05658 RNA polymerase sigma factor RpoD; Validated Back     alignment and domain information
>PRK05657 RNA polymerase sigma factor RpoS; Validated Back     alignment and domain information
>PRK06596 RNA polymerase factor sigma-32; Reviewed Back     alignment and domain information
>TIGR02393 RpoD_Cterm RNA polymerase sigma factor RpoD, C-terminal domain Back     alignment and domain information
>PRK07500 rpoH2 RNA polymerase factor sigma-32; Reviewed Back     alignment and domain information
>TIGR02392 rpoH_proteo alternative sigma factor RpoH Back     alignment and domain information
>TIGR02394 rpoS_proteo RNA polymerase sigma factor RpoS Back     alignment and domain information
>PRK07122 RNA polymerase sigma factor SigF; Reviewed Back     alignment and domain information
>COG1191 FliA DNA-directed RNA polymerase specialized sigma subunit [Transcription] Back     alignment and domain information
>PRK07408 RNA polymerase sigma factor SigF; Reviewed Back     alignment and domain information
>TIGR02850 spore_sigG RNA polymerase sigma-G factor Back     alignment and domain information
>PRK08215 sporulation sigma factor SigG; Reviewed Back     alignment and domain information
>TIGR02941 Sigma_B RNA polymerase sigma-B factor Back     alignment and domain information
>PRK05911 RNA polymerase sigma factor sigma-28; Reviewed Back     alignment and domain information
>PRK06288 RNA polymerase sigma factor WhiG; Reviewed Back     alignment and domain information
>PRK08583 RNA polymerase sigma factor SigB; Validated Back     alignment and domain information
>TIGR02980 SigBFG RNA polymerase sigma-70 factor, sigma-B/F/G subfamily Back     alignment and domain information
>TIGR02885 spore_sigF RNA polymerase sigma-F factor Back     alignment and domain information
>PRK07670 RNA polymerase sigma factor SigD; Validated Back     alignment and domain information
>PRK05572 sporulation sigma factor SigF; Validated Back     alignment and domain information
>TIGR02479 FliA_WhiG RNA polymerase sigma factor, FliA/WhiG family Back     alignment and domain information
>PRK06986 fliA flagellar biosynthesis sigma factor; Validated Back     alignment and domain information
>PRK12427 flagellar biosynthesis sigma factor; Provisional Back     alignment and domain information
>PRK05803 sporulation sigma factor SigK; Reviewed Back     alignment and domain information
>TIGR02846 spore_sigmaK RNA polymerase sigma-K factor Back     alignment and domain information
>PRK08301 sporulation sigma factor SigE; Reviewed Back     alignment and domain information
>PRK09648 RNA polymerase sigma factor SigD; Reviewed Back     alignment and domain information
>TIGR02835 spore_sigmaE RNA polymerase sigma-E factor Back     alignment and domain information
>PRK09646 RNA polymerase sigma factor SigK; Reviewed Back     alignment and domain information
>PRK05602 RNA polymerase sigma factor; Reviewed Back     alignment and domain information
>PRK12513 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>TIGR02952 Sig70_famx2 RNA polymerase sigma-70 factor, TIGR02952 family Back     alignment and domain information
>PRK08295 RNA polymerase factor sigma-70; Validated Back     alignment and domain information
>PRK12519 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK06759 RNA polymerase factor sigma-70; Validated Back     alignment and domain information
>PRK11923 algU RNA polymerase sigma factor AlgU; Provisional Back     alignment and domain information
>PRK11922 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12524 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12514 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12537 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12534 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12538 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK13919 putative RNA polymerase sigma E protein; Provisional Back     alignment and domain information
>PRK12526 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>TIGR02948 SigW_bacill RNA polymerase sigma-W factor Back     alignment and domain information
>PRK09652 RNA polymerase sigma factor RpoE; Provisional Back     alignment and domain information
>TIGR02859 spore_sigH RNA polymerase sigma-H factor Back     alignment and domain information
>PRK12531 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK06811 RNA polymerase factor sigma-70; Validated Back     alignment and domain information
>TIGR02939 RpoE_Sigma70 RNA polymerase sigma factor RpoE Back     alignment and domain information
>PRK12542 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK09640 RNA polymerase sigma factor SigX; Reviewed Back     alignment and domain information
>PRK09641 RNA polymerase sigma factor SigW; Provisional Back     alignment and domain information
>PRK09643 RNA polymerase sigma factor SigM; Reviewed Back     alignment and domain information
>PRK11924 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12515 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>TIGR02954 Sig70_famx3 RNA polymerase sigma-70 factor, TIGR02954 family Back     alignment and domain information
>PRK12543 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK09638 RNA polymerase sigma factor SigY; Reviewed Back     alignment and domain information
>PRK12536 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK09645 RNA polymerase sigma factor SigL; Provisional Back     alignment and domain information
>PRK12512 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK09649 RNA polymerase sigma factor SigC; Reviewed Back     alignment and domain information
>TIGR03001 Sig-70_gmx1 RNA polymerase sigma-70 factor, Myxococcales family 1 Back     alignment and domain information
>TIGR02999 Sig-70_X6 RNA polymerase sigma factor, TIGR02999 family Back     alignment and domain information
>PRK12539 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK09415 RNA polymerase factor sigma C; Reviewed Back     alignment and domain information
>TIGR02985 Sig70_bacteroi1 RNA polymerase sigma-70 factor, Bacteroides expansion family 1 Back     alignment and domain information
>TIGR02989 Sig-70_gvs1 RNA polymerase sigma-70 factor, Rhodopirellula/Verrucomicrobium family Back     alignment and domain information
>TIGR02937 sigma70-ECF RNA polymerase sigma factor, sigma-70 family Back     alignment and domain information
>PRK12518 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12520 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12522 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12516 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK09642 RNA polymerase sigma factor SigW; Reviewed Back     alignment and domain information
>PRK12535 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>TIGR02983 SigE-fam_strep RNA polymerase sigma-70 factor, sigma-E family Back     alignment and domain information
>TIGR02984 Sig-70_plancto1 RNA polymerase sigma-70 factor, Planctomycetaceae-specific subfamily 1 Back     alignment and domain information
>PRK12547 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>COG1595 RpoE DNA-directed RNA polymerase specialized sigma subunit, sigma24 homolog [Transcription] Back     alignment and domain information
>PRK09644 RNA polymerase sigma factor SigM; Provisional Back     alignment and domain information
>TIGR02947 SigH_actino RNA polymerase sigma-70 factor, TIGR02947 family Back     alignment and domain information
>PRK12523 RNA polymerase sigma factor; Reviewed Back     alignment and domain information
>PRK12533 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12529 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK09647 RNA polymerase sigma factor SigE; Reviewed Back     alignment and domain information
>PRK09639 RNA polymerase sigma factor SigX; Provisional Back     alignment and domain information
>PRK12528 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12541 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>TIGR02943 Sig70_famx1 RNA polymerase sigma-70 factor, TIGR02943 family Back     alignment and domain information
>PRK08241 RNA polymerase factor sigma-70; Validated Back     alignment and domain information
>PRK12540 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12532 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12545 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK09637 RNA polymerase sigma factor SigZ; Provisional Back     alignment and domain information
>PRK12530 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12544 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>TIGR02950 SigM_subfam RNA polymerase sigma factor, SigM family Back     alignment and domain information
>PRK12517 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK07037 extracytoplasmic-function sigma-70 factor; Validated Back     alignment and domain information
>TIGR02960 SigX5 RNA polymerase sigma-70 factor, TIGR02960 family Back     alignment and domain information
>PRK09651 RNA polymerase sigma factor FecI; Provisional Back     alignment and domain information
>PRK12527 RNA polymerase sigma factor; Reviewed Back     alignment and domain information
>TIGR02959 SigZ RNA polymerase sigma factor, SigZ family Back     alignment and domain information
>PRK12546 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12511 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>TIGR02895 spore_sigI RNA polymerase sigma-I factor Back     alignment and domain information
>PRK12525 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK06704 RNA polymerase factor sigma-70; Validated Back     alignment and domain information
>PRK09047 RNA polymerase factor sigma-70; Validated Back     alignment and domain information
>PRK09636 RNA polymerase sigma factor SigJ; Provisional Back     alignment and domain information
>TIGR02957 SigX4 RNA polymerase sigma-70 factor, TIGR02957 family Back     alignment and domain information
>PRK09635 sigI RNA polymerase sigma factor SigI; Provisional Back     alignment and domain information
>PRK09191 two-component response regulator; Provisional Back     alignment and domain information
>TIGR03209 P21_Cbot clostridium toxin-associated regulator BotR Back     alignment and domain information
>PRK08311 putative RNA polymerase sigma factor SigI; Reviewed Back     alignment and domain information
>PF07638 Sigma70_ECF: ECF sigma factor Back     alignment and domain information
>PF04542 Sigma70_r2: Sigma-70 region 2 ; InterPro: IPR007627 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>PF04545 Sigma70_r4: Sigma-70, region 4; InterPro: IPR007630 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>PF08281 Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013249 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>PRK06930 positive control sigma-like factor; Validated Back     alignment and domain information
>PRK00118 putative DNA-binding protein; Validated Back     alignment and domain information
>cd06171 Sigma70_r4 Sigma70, region (SR) 4 refers to the most C-terminal of four conserved domains found in Escherichia coli (Ec) sigma70, the main housekeeping sigma, and related sigma-factors (SFs) Back     alignment and domain information
>TIGR00721 tfx DNA-binding protein, Tfx family Back     alignment and domain information
>PRK03975 tfx putative transcriptional regulator; Provisional Back     alignment and domain information
>PRK04217 hypothetical protein; Provisional Back     alignment and domain information
>PF04297 UPF0122: Putative helix-turn-helix protein, YlxM / p13 like; InterPro: IPR007394 Members of this family are predicted to contain a helix-turn-helix motif, for example residues 37-55 in Mycoplasma mycoides p13 (O05290 from SWISSPROT) Back     alignment and domain information
>smart00421 HTH_LUXR helix_turn_helix, Lux Regulon Back     alignment and domain information
>PF00196 GerE: Bacterial regulatory proteins, luxR family; InterPro: IPR000792 This domain is a DNA-binding, helix-turn-helix (HTH) domain of about 65 amino acids, present in transcription regulators of the LuxR/FixJ family of response regulators Back     alignment and domain information
>TIGR01636 phage_rinA phage transcriptional activator, RinA family Back     alignment and domain information
>cd06170 LuxR_C_like C-terminal DNA-binding domain of LuxR-like proteins Back     alignment and domain information
>PF07374 DUF1492: Protein of unknown function (DUF1492); InterPro: IPR010861 This entry is represented by Streptococcus phage 7201, Orf19 Back     alignment and domain information
>TIGR03879 near_KaiC_dom probable regulatory domain Back     alignment and domain information
>PF04967 HTH_10: HTH DNA binding domain; InterPro: IPR007050 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif Back     alignment and domain information
>PRK15411 rcsA colanic acid capsular biosynthesis activation protein A; Provisional Back     alignment and domain information
>PRK11475 DNA-binding transcriptional activator BglJ; Provisional Back     alignment and domain information
>PF00140 Sigma70_r1_2: Sigma-70 factor, region 1 Back     alignment and domain information
>PRK15201 fimbriae regulatory protein FimW; Provisional Back     alignment and domain information
>PRK10840 transcriptional regulator RcsB; Provisional Back     alignment and domain information
>TIGR01321 TrpR trp operon repressor, proteobacterial Back     alignment and domain information
>PRK13719 conjugal transfer transcriptional regulator TraJ; Provisional Back     alignment and domain information
>COG2197 CitB Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>PF13936 HTH_38: Helix-turn-helix domain; PDB: 2W48_A Back     alignment and domain information
>COG4566 TtrR Response regulator [Signal transduction mechanisms] Back     alignment and domain information
>TIGR03541 reg_near_HchA LuxR family transcriptional regulatory, chaperone HchA-associated Back     alignment and domain information
>TIGR03020 EpsA transcriptional regulator EpsA Back     alignment and domain information
>PRK10100 DNA-binding transcriptional regulator CsgD; Provisional Back     alignment and domain information
>PRK10188 DNA-binding transcriptional activator SdiA; Provisional Back     alignment and domain information
>PF02001 DUF134: Protein of unknown function DUF134; InterPro: IPR002852 The bacterial and archaeal proteins in this family have no known function Back     alignment and domain information
>PRK13870 transcriptional regulator TraR; Provisional Back     alignment and domain information
>COG2771 CsgD DNA-binding HTH domain-containing proteins [Transcription] Back     alignment and domain information
>PRK09483 response regulator; Provisional Back     alignment and domain information
>COG4941 Predicted RNA polymerase sigma factor containing a TPR repeat domain [Transcription] Back     alignment and domain information
>COG2739 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK15369 two component system sensor kinase SsrB; Provisional Back     alignment and domain information
>COG3413 Predicted DNA binding protein [General function prediction only] Back     alignment and domain information
>PRK10651 transcriptional regulator NarL; Provisional Back     alignment and domain information
>PF04539 Sigma70_r3: Sigma-70 region 3; InterPro: IPR007624 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>PRK09390 fixJ response regulator FixJ; Provisional Back     alignment and domain information
>PRK15320 transcriptional activator SprB; Provisional Back     alignment and domain information
>COG1342 Predicted DNA-binding proteins [General function prediction only] Back     alignment and domain information
>PRK01381 Trp operon repressor; Provisional Back     alignment and domain information
>TIGR01637 phage_arpU phage transcriptional regulator, ArpU family Back     alignment and domain information
>COG1356 tfx Transcriptional regulator [DNA replication, recombination and repair] Back     alignment and domain information
>PRK10403 transcriptional regulator NarP; Provisional Back     alignment and domain information
>PF12645 HTH_16: Helix-turn-helix domain; InterPro: IPR024760 This domain appears to be a helix-turn-helix domain, suggesting a transcriptional regulatory protein Back     alignment and domain information
>PRK10360 DNA-binding transcriptional activator UhpA; Provisional Back     alignment and domain information
>PRK09935 transcriptional regulator FimZ; Provisional Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PRK13558 bacterio-opsin activator; Provisional Back     alignment and domain information
>PRK09958 DNA-binding transcriptional activator EvgA; Provisional Back     alignment and domain information
>PF13613 HTH_Tnp_4: Helix-turn-helix of DDE superfamily endonuclease Back     alignment and domain information
>PF13384 HTH_23: Homeodomain-like domain; PDB: 2X48_C Back     alignment and domain information
>PRK05658 RNA polymerase sigma factor RpoD; Validated Back     alignment and domain information
>PRK15418 transcriptional regulator LsrR; Provisional Back     alignment and domain information
>PF13412 HTH_24: Winged helix-turn-helix DNA-binding; PDB: 1I1G_B 2IA0_B 3I4P_A 2GQQ_A 2L4A_A 2CFX_B 2DBB_B 2EFO_A 2EFQ_A 2PN6_A Back     alignment and domain information
>TIGR02531 yecD_yerC TrpR-related protein YerC/YecD Back     alignment and domain information
>PF02796 HTH_7: Helix-turn-helix domain of resolvase; InterPro: IPR006120 Site-specific recombination plays an important role in DNA rearrangement in prokaryotic organisms Back     alignment and domain information
>cd00569 HTH_Hin_like Helix-turn-helix domain of Hin and related proteins, a family of DNA-binding domains unique to bacteria and represented by the Hin protein of Salmonella Back     alignment and domain information
>PF05263 DUF722: Protein of unknown function (DUF722); InterPro: IPR007927 This entry is represented by Bacteriophage bIL285, Orf38 Back     alignment and domain information
>PF06056 Terminase_5: Putative ATPase subunit of terminase (gpP-like); InterPro: IPR010332 This family of proteins are annotated as ATPase subunits of phage terminase after [] Back     alignment and domain information
>PF00325 Crp: Bacterial regulatory proteins, crp family; InterPro: IPR001808 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif Back     alignment and domain information
>PF06530 Phage_antitermQ: Phage antitermination protein Q; InterPro: IPR010534 This entry is represented by Bacteriophage 933W, GpQ Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PF01726 LexA_DNA_bind: LexA DNA binding domain; InterPro: IPR006199 This is the DNA binding domain of the LexA SOS regulon repressor which prevents expression of DNA repair proteins in bacteria Back     alignment and domain information
>PF13404 HTH_AsnC-type: AsnC-type helix-turn-helix domain; PDB: 2ZNY_E 2ZNZ_G 1RI7_A 2CYY_A 2E1C_A 2VC1_B 2QZ8_A 2W29_C 2IVM_B 2VBX_B Back     alignment and domain information
>PRK10430 DNA-binding transcriptional activator DcuR; Provisional Back     alignment and domain information
>PF04539 Sigma70_r3: Sigma-70 region 3; InterPro: IPR007624 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>PF13518 HTH_28: Helix-turn-helix domain Back     alignment and domain information
>PF10668 Phage_terminase: Phage terminase small subunit; InterPro: IPR018925 This entry describes the terminase small subunit from Enterococcus phage phiFL1A, related proteins in other bacteriophage, and prophage regions of bacterial genomes Back     alignment and domain information
>COG2390 DeoR Transcriptional regulator, contains sigma factor-related N-terminal domain [Transcription] Back     alignment and domain information
>smart00351 PAX Paired Box domain Back     alignment and domain information
>PF09862 DUF2089: Protein of unknown function (DUF2089); InterPro: IPR018658 This family consists of various hypothetical prokaryotic proteins Back     alignment and domain information
>PF12802 MarR_2: MarR family; PDB: 3ECO_B 2QWW_B 3KP6_B 3KP4_B 3KP2_A 3KP5_A 3KP3_B 3KP7_A 3NQO_B 3K0L_B Back     alignment and domain information
>PF04218 CENP-B_N: CENP-B N-terminal DNA-binding domain; InterPro: IPR006695 Centromere Protein B (CENP-B) is a DNA-binding protein localized to the centromere Back     alignment and domain information
>PF01022 HTH_5: Bacterial regulatory protein, arsR family; InterPro: IPR001845 Bacterial transcription regulatory proteins that bind DNA via a helix-turn-helix (HTH) motif can be grouped into families on the basis of sequence similarities Back     alignment and domain information
>PF01371 Trp_repressor: Trp repressor protein; InterPro: IPR000831 The Trp repressor (TrpR) binds to at least five operators in the Escherichia coli genome, repressing gene expression Back     alignment and domain information
>PF12840 HTH_20: Helix-turn-helix domain; PDB: 1ULY_A 2CWE_A 1Y0U_B 2QUF_B 2QLZ_C 2OQG_B 2ZKZ_C 3PQK_A 3PQJ_D 3F6O_B Back     alignment and domain information
>PF13730 HTH_36: Helix-turn-helix domain Back     alignment and domain information
>PHA00675 hypothetical protein Back     alignment and domain information
>PHA02591 hypothetical protein; Provisional Back     alignment and domain information
>cd00131 PAX Paired Box domain Back     alignment and domain information
>PF13744 HTH_37: Helix-turn-helix domain; PDB: 2A6C_B 2O38_A Back     alignment and domain information
>PF08279 HTH_11: HTH domain; InterPro: IPR013196 Winged helix DNA-binding proteins share a related winged helix-turn-helix DNA-binding motif, where the "wings", or loops, are small beta-sheets Back     alignment and domain information
>PF13022 HTH_Tnp_1_2: Helix-turn-helix of insertion element transposase; PDB: 2AO9_I Back     alignment and domain information
>smart00550 Zalpha Z-DNA-binding domain in adenosine deaminases Back     alignment and domain information
>PF01418 HTH_6: Helix-turn-helix domain, rpiR family; InterPro: IPR000281 This domain contains a helix-turn-helix motif [] Back     alignment and domain information
>PF01325 Fe_dep_repress: Iron dependent repressor, N-terminal DNA binding domain; InterPro: IPR022687 The DtxR-type HTH domain is a DNA-binding, winged helix-turn-helix (wHTH) domain of about 65 residues present in metalloregulators of the DtxR/MntR family Back     alignment and domain information
>COG3415 Transposase and inactivated derivatives [DNA replication, recombination, and repair] Back     alignment and domain information
>PF13542 HTH_Tnp_ISL3: Helix-turn-helix domain of transposase family ISL3 Back     alignment and domain information
>TIGR02395 rpoN_sigma RNA polymerase sigma-54 factor Back     alignment and domain information
>PRK11083 DNA-binding response regulator CreB; Provisional Back     alignment and domain information
>PF00356 LacI: Bacterial regulatory proteins, lacI family; InterPro: IPR000843 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif Back     alignment and domain information
>PF01710 HTH_Tnp_IS630: Transposase; InterPro: IPR002622 Transposase proteins are necessary for efficient DNA transposition Back     alignment and domain information
>PRK11179 DNA-binding transcriptional regulator AsnC; Provisional Back     alignment and domain information
>PF03444 HrcA_DNA-bdg: Winged helix-turn-helix transcription repressor, HrcA DNA-binding; InterPro: IPR005104 Prokaryotic cells have a defence mechanism against a sudden heat-shock stress Back     alignment and domain information
>PRK10046 dpiA two-component response regulator DpiA; Provisional Back     alignment and domain information
>PRK10336 DNA-binding transcriptional regulator QseB; Provisional Back     alignment and domain information
>PF02650 HTH_WhiA: WhiA C-terminal HTH domain; InterPro: IPR023054 This domain is found at the C terminus of the sporulation regulator WhiA Back     alignment and domain information
>PRK09413 IS2 repressor TnpA; Reviewed Back     alignment and domain information
>TIGR01610 phage_O_Nterm phage replication protein O, N-terminal domain Back     alignment and domain information
>PF01047 MarR: MarR family; InterPro: IPR000835 The MarR-type HTH domain is a DNA-binding, winged helix-turn-helix (wHTH) domain of about 135 amino acids present in transcription regulators of the MarR/SlyA family, involved in the development of antibiotic resistance Back     alignment and domain information
>PRK05932 RNA polymerase factor sigma-54; Reviewed Back     alignment and domain information
>smart00344 HTH_ASNC helix_turn_helix ASNC type Back     alignment and domain information
>PRK11169 leucine-responsive transcriptional regulator; Provisional Back     alignment and domain information
>PRK10710 DNA-binding transcriptional regulator BaeR; Provisional Back     alignment and domain information
>COG2973 TrpR Trp operon repressor [Transcription] Back     alignment and domain information
>PRK13413 mpi multiple promoter invertase; Provisional Back     alignment and domain information
>PHA02547 55 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PF13551 HTH_29: Winged helix-turn helix Back     alignment and domain information
>PF12728 HTH_17: Helix-turn-helix domain Back     alignment and domain information
>PF13551 HTH_29: Winged helix-turn helix Back     alignment and domain information
>TIGR02154 PhoB phosphate regulon transcriptional regulatory protein PhoB Back     alignment and domain information
>cd04762 HTH_MerR-trunc Helix-Turn-Helix DNA binding domain of truncated MerR-like proteins Back     alignment and domain information
>PRK15479 transcriptional regulatory protein TctD; Provisional Back     alignment and domain information
>TIGR03787 marine_sort_RR proteobacterial dedicated sortase system response regulator Back     alignment and domain information
>PF13463 HTH_27: Winged helix DNA-binding domain; PDB: 3GFL_A 2YR2_B 3GFM_A 3GFJ_A 3GF2_A 3GEZ_A 2GXG_A 3GFI_A 2EB7_A Back     alignment and domain information
>PF11427 HTH_Tnp_Tc3_1: Tc3 transposase; PDB: 1U78_A 1TC3_C Back     alignment and domain information
>COG2522 Predicted transcriptional regulator [General function prediction only] Back     alignment and domain information
>COG1191 FliA DNA-directed RNA polymerase specialized sigma subunit [Transcription] Back     alignment and domain information
>PF00046 Homeobox: Homeobox domain not present here Back     alignment and domain information
>PF08822 DUF1804: Protein of unknown function (DUF1804); InterPro: IPR014926 This entry is represented by Bacteriophage D3112, Orf24 Back     alignment and domain information
>TIGR01764 excise DNA binding domain, excisionase family Back     alignment and domain information
>PF13011 LZ_Tnp_IS481: leucine-zipper of insertion element IS481 Back     alignment and domain information
>COG1522 Lrp Transcriptional regulators [Transcription] Back     alignment and domain information
>PF01527 HTH_Tnp_1: Transposase; InterPro: IPR002514 Transposase proteins are necessary for efficient DNA transposition Back     alignment and domain information
>CHL00148 orf27 Ycf27; Reviewed Back     alignment and domain information
>PRK07408 RNA polymerase sigma factor SigF; Reviewed Back     alignment and domain information
>PRK12423 LexA repressor; Provisional Back     alignment and domain information
>PF01978 TrmB: Sugar-specific transcriptional regulator TrmB; InterPro: IPR002831 TrmB, is a protein of 38,800 apparent molecular weight, that is involved in the maltose-specific regulation of the trehalose/maltose ABC transport operon in Thermococcus litoralis Back     alignment and domain information
>PF01381 HTH_3: Helix-turn-helix; InterPro: IPR001387 This is large family of DNA binding helix-turn helix proteins that include a bacterial plasmid copy control protein, bacterial methylases, various bacteriophage transcription control proteins and a vegetative specific protein from Dictyostelium discoideum (Slime mould) Back     alignment and domain information
>PF08220 HTH_DeoR: DeoR-like helix-turn-helix domain; InterPro: IPR001034 The deoR-type HTH domain is a DNA-binding, helix-turn-helix (HTH) domain of about 50-60 amino acids present in transcription regulators of the deoR family, involved in sugar catabolism Back     alignment and domain information
>PRK09210 RNA polymerase sigma factor RpoD; Validated Back     alignment and domain information
>cd04761 HTH_MerR-SF Helix-Turn-Helix DNA binding domain of transcription regulators from the MerR superfamily Back     alignment and domain information
>KOG0484 consensus Transcription factor PHOX2/ARIX, contains HOX domain [Transcription] Back     alignment and domain information
>PHA01976 helix-turn-helix protein Back     alignment and domain information
>PF02954 HTH_8: Bacterial regulatory protein, Fis family; InterPro: IPR002197 The Factor for Inversion Stimulation (FIS) protein is a regulator of bacterial functions, and binds specifically to weakly related DNA sequences [,] Back     alignment and domain information
>TIGR02393 RpoD_Cterm RNA polymerase sigma factor RpoD, C-terminal domain Back     alignment and domain information
>PRK14082 hypothetical protein; Provisional Back     alignment and domain information
>PRK05911 RNA polymerase sigma factor sigma-28; Reviewed Back     alignment and domain information
>PHA00542 putative Cro-like protein Back     alignment and domain information
>COG0856 Orotate phosphoribosyltransferase homologs [Nucleotide transport and metabolism] Back     alignment and domain information
>smart00420 HTH_DEOR helix_turn_helix, Deoxyribose operon repressor Back     alignment and domain information
>TIGR00122 birA_repr_reg BirA biotin operon repressor domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query485
4igc_X613 X-ray Crystal Structure Of Escherichia Coli Sigma70 1e-32
3iyd_F613 Three-Dimensional Em Structure Of An Intact Activat 2e-32
1l9u_H332 Thermus Aquaticus Rna Polymerase Holoenzyme At 4 A 4e-30
1l9z_H438 Thermus Aquaticus Rna Polymerase HoloenzymeFORK-Jun 7e-30
3dxj_F423 Crystal Structure Of Thermus Thermophilus Rna Polym 1e-29
1iw7_F423 Crystal Structure Of The Rna Polymerase Holoenzyme 1e-29
4g7h_F443 Crystal Structure Of Thermus Thermophilus Transcrip 1e-29
3ugo_A245 Crystal Structure Of Rna-Polymerase Sigma Subunit D 2e-23
1ku2_A241 Crystal Structure Of Thermus Aquaticus Rna Polymera 3e-23
1l0o_C243 Crystal Structure Of The Bacillus Stearothermophilu 4e-18
3les_A179 2f5 Epitope Scaffold Es2 Length = 179 6e-17
1sig_A339 Crystal Structure Of A Sigma70 Subunit Fragment Fro 6e-17
4g6d_A73 G1 Orf67 / Staphyloccus Aureus Sigmaa Domain 4 Comp 6e-07
1tty_A87 Solution Structure Of Sigma A Region 4 From Thermot 5e-06
1tlh_B81 T4 Asia Bound To Sigma70 Region 4 Length = 81 6e-05
2p7v_B68 Crystal Structure Of The Escherichia Coli Regulator 1e-04
1rp3_A239 Cocrystal Structure Of The Flagellar SigmaANTI-Sigm 1e-04
3t72_q99 Phob(E)-Sigma70(4)-(Rnap-Betha-Flap-Tip-Helix)-Dna 2e-04
4g94_A62 G1 Orf67 / Staphyloccus Aureus Sigmaa Domain 4 Comp 2e-04
>pdb|4IGC|X Chain X, X-ray Crystal Structure Of Escherichia Coli Sigma70 Holoenzyme Length = 613 Back     alignment and structure

Iteration: 1

Score = 137 bits (345), Expect = 1e-32, Method: Compositional matrix adjust. Identities = 75/239 (31%), Positives = 138/239 (57%), Gaps = 23/239 (9%) Query: 265 AREKLVMSNVRLVMSIAQRYDNMGADMADLVQGGLIGLLRGIEKFDSSKGFKISTYVYWW 324 A++++V +N+RLV+SIA++Y N G DL+Q G IGL++ ++KF+ +G+K STY WW Sbjct: 375 AKKEMVEANLRLVISIAKKYTNRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWW 434 Query: 325 IRQGVSRALVENSRTLRLPNHLHERLG-LIRNAKLRLEEKGVTPSVDRIAEYLNMSQKKV 383 IRQ ++R++ + +RT+R+P H+ E + L R ++ L+E G P+ + +AE + M + K+ Sbjct: 435 IRQAITRSIADQARTIRIPVHMIETINKLNRISRQMLQEMGREPTPEELAERMLMPEDKI 494 Query: 384 RNATEVLA-------------------YIADNRVENNPWHGVDDWALKDEVNKLIIVTLG 424 R ++ +I D +E P +L+ + ++ L Sbjct: 495 RKVLKIAKEPISMETPIGDDEDSHLGDFIEDTTLE-LPLDSATTESLRAATHD-VLAGLT 552 Query: 425 EREREIIRLYYGLDKEC-LTWEDISKRIGLSRERVRQVGLVALEKLKHAARKKKMEAML 482 RE +++R+ +G+D T E++ K+ ++RER+RQ+ AL KL+H +R + + + L Sbjct: 553 AREAKVLRMRFGIDMNTDYTLEEVGKQFDVTRERIRQIEAKALRKLRHPSRSEVLRSFL 611
>pdb|3IYD|F Chain F, Three-Dimensional Em Structure Of An Intact Activator-Dependent Transcription Initiation Complex Length = 613 Back     alignment and structure
>pdb|1L9U|H Chain H, Thermus Aquaticus Rna Polymerase Holoenzyme At 4 A Resolution Length = 332 Back     alignment and structure
>pdb|1L9Z|H Chain H, Thermus Aquaticus Rna Polymerase HoloenzymeFORK-Junction Promoter Dna Complex At 6.5 A Resolution Length = 438 Back     alignment and structure
>pdb|3DXJ|F Chain F, Crystal Structure Of Thermus Thermophilus Rna Polymerase Holoenzyme In Complex With The Antibiotic Myxopyronin Length = 423 Back     alignment and structure
>pdb|1IW7|F Chain F, Crystal Structure Of The Rna Polymerase Holoenzyme From Thermus Thermophilus At 2.6a Resolution Length = 423 Back     alignment and structure
>pdb|4G7H|F Chain F, Crystal Structure Of Thermus Thermophilus Transcription Initiation Complex Length = 443 Back     alignment and structure
>pdb|3UGO|A Chain A, Crystal Structure Of Rna-Polymerase Sigma Subunit Domain 2 Complexed With -10 Promoter Element Ssdna Oligo (Tacaat) Length = 245 Back     alignment and structure
>pdb|1KU2|A Chain A, Crystal Structure Of Thermus Aquaticus Rna Polymerase Sigma Subunit Fragment Containing Regions 1.2 To 3.1 Length = 241 Back     alignment and structure
>pdb|1L0O|C Chain C, Crystal Structure Of The Bacillus Stearothermophilus Anti- Sigma Factor Spoiiab With The Sporulation Sigma Factor Sigmaf Length = 243 Back     alignment and structure
>pdb|3LES|A Chain A, 2f5 Epitope Scaffold Es2 Length = 179 Back     alignment and structure
>pdb|1SIG|A Chain A, Crystal Structure Of A Sigma70 Subunit Fragment From Escherichia Coli Rna Polymerase Length = 339 Back     alignment and structure
>pdb|4G6D|A Chain A, G1 Orf67 / Staphyloccus Aureus Sigmaa Domain 4 Complex Length = 73 Back     alignment and structure
>pdb|1TTY|A Chain A, Solution Structure Of Sigma A Region 4 From Thermotoga Maritima Length = 87 Back     alignment and structure
>pdb|1TLH|B Chain B, T4 Asia Bound To Sigma70 Region 4 Length = 81 Back     alignment and structure
>pdb|2P7V|B Chain B, Crystal Structure Of The Escherichia Coli Regulator Of Sigma 70, Rsd, In Complex With Sigma 70 Domain 4 Length = 68 Back     alignment and structure
>pdb|1RP3|A Chain A, Cocrystal Structure Of The Flagellar SigmaANTI-Sigma Complex, Sigma-28FLGM Length = 239 Back     alignment and structure
>pdb|3T72|QQ Chain q, Phob(E)-Sigma70(4)-(Rnap-Betha-Flap-Tip-Helix)-Dna Transcription Activation Sub-Complex Length = 99 Back     alignment and structure
>pdb|4G94|A Chain A, G1 Orf67 / Staphyloccus Aureus Sigmaa Domain 4 Complex Length = 62 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query485
1l0o_C243 Sigma factor; bergerat fold, helix-turn-helix, pro 4e-45
3iyd_F613 RNA polymerase sigma factor RPOD; transcription, i 1e-43
2a6h_F423 RNA polymerase sigma factor RPOD; RNA polymerase h 2e-43
1l9z_H438 Sigma factor SIGA; helix-turn-helix, coiled-coil, 4e-42
1rp3_A239 RNA polymerase sigma factor sigma-28 (FLIA); trans 1e-37
3ugo_A245 RNA polymerase sigma factor; protein-DNA complex, 2e-32
1sig_A339 Sigma70, RNA polymerase primary sigma factor; RNA 7e-20
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-11
1tty_A87 Sigma-A, RNA polymerase sigma factor RPOD; helix-t 1e-11
3t72_q99 RNA polymerase sigma factor RPOD, DNA-directed RN 3e-11
2p7v_B68 Sigma-70, RNA polymerase sigma factor RPOD; RSD, r 9e-11
3mzy_A164 RNA polymerase sigma-H factor; PSI, MCSG, structur 2e-10
1ku3_A73 Sigma factor SIGA; helix-turn-helix, transcription 7e-09
>1l0o_C Sigma factor; bergerat fold, helix-turn-helix, protein binding; HET: ADP; 2.90A {Geobacillus stearothermophilus} SCOP: a.4.13.2 Length = 243 Back     alignment and structure
 Score =  156 bits (398), Expect = 4e-45
 Identities = 69/224 (30%), Positives = 111/224 (49%), Gaps = 27/224 (12%)

Query: 265 AREKLVMSNVRLVMSIAQRYDNMGADMADLVQGGLIGLLRGIEKFDSSKGFKISTYVYWW 324
           AR++++  N+RLV S+ QR+ N G +  DL Q G IGLL+ ++KFD S   K STY    
Sbjct: 29  ARDEIIEKNMRLVWSVVQRFLNRGYEADDLFQIGCIGLLKSVDKFDLSYDVKFSTYAVPM 88

Query: 325 IRQGVSRALVENSRTLRLPNHLHERLGLIRNAKLRL-EEKGVTPSVDRIAEYLNMSQKKV 383
           I   + R L ++  T+++   L E    IR AK  L + +G  P+V  IA++L +S + V
Sbjct: 89  IIGEIQRFLRDDG-TVKVSRSLKEMGNKIRKAKDELSKTRGRAPTVTEIADHLGISPEDV 147

Query: 384 RNATEVL-----------------AYIADNRVENNPWHGVDDWALKDEVNKLIIVTLGER 426
             A E +                   + D   + +     D  ALK       I  L ER
Sbjct: 148 VLAQEAVRLPTSIHETVYENDGDPITLLDQIADADEASWFDKIALKK-----AIEELDER 202

Query: 427 EREIIRLYYGLDKECLTWEDISKRIGLSRERVRQVGLVALEKLK 470
           ER I+ L Y  D+   T  +++ R+G+S+ ++ ++    L+ +K
Sbjct: 203 ERLIVYLRYYKDQ---TQSEVASRLGISQVQMSRLEKKILQHIK 243


>3iyd_F RNA polymerase sigma factor RPOD; transcription, initiation, class I, activator, RNA polymeras holoenzyme, sigma70, open complex, CAP, CRP; HET: DNA CMP; 19.80A {Escherichia coli k-12} Length = 613 Back     alignment and structure
>2a6h_F RNA polymerase sigma factor RPOD; RNA polymerase holoenzyme, streptolydigin, antibiotic, transcription regulation; HET: STD; 2.40A {Thermus thermophilus} SCOP: a.4.13.1 a.4.13.2 a.177.1.1 PDB: 1smy_F* 1zyr_F* 1iw7_F* 2a69_F* 2a6e_F 2a68_F* 2be5_F* 2cw0_F 3eql_F* 3dxj_F* 1l9u_H Length = 423 Back     alignment and structure
>1l9z_H Sigma factor SIGA; helix-turn-helix, coiled-coil, transcription/DNA complex; 6.50A {Thermus aquaticus} SCOP: i.8.1.1 Length = 438 Back     alignment and structure
>1rp3_A RNA polymerase sigma factor sigma-28 (FLIA); transcription; 2.30A {Aquifex aeolicus} SCOP: a.4.13.1 a.4.13.2 a.177.1.1 PDB: 1sc5_A Length = 239 Back     alignment and structure
>3ugo_A RNA polymerase sigma factor; protein-DNA complex, bacterial promoter opening, G-quartet, quadruplex, DNA binding; 2.10A {Thermus aquaticus} PDB: 3ugp_A 1ku2_A 3lev_A* 3les_A* Length = 245 Back     alignment and structure
>1sig_A Sigma70, RNA polymerase primary sigma factor; RNA polymerase sigma factor, transcription regulation; 2.60A {Escherichia coli} SCOP: a.177.1.1 Length = 339 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1tty_A Sigma-A, RNA polymerase sigma factor RPOD; helix-turn-helix, transcription; NMR {Thermotoga maritima} SCOP: a.4.13.2 Length = 87 Back     alignment and structure
>3t72_q RNA polymerase sigma factor RPOD, DNA-directed RN polymerase subunit beta; winged-helix motif, transcription activation, DNA-binding; 4.33A {Escherichia coli} PDB: 1tlh_B Length = 99 Back     alignment and structure
>2p7v_B Sigma-70, RNA polymerase sigma factor RPOD; RSD, regulator of sigma 70, sigma 70 domain 4, transcription, regulation, helix-turn-helix; 2.60A {Escherichia coli} SCOP: a.4.13.2 Length = 68 Back     alignment and structure
>3mzy_A RNA polymerase sigma-H factor; PSI, MCSG, structural genomics, midwest center for structura genomics, protein structure initiative; 2.50A {Fusobacterium nucleatum subsp} Length = 164 Back     alignment and structure
>1ku3_A Sigma factor SIGA; helix-turn-helix, transcription; 1.80A {Thermus aquaticus} SCOP: a.4.13.2 PDB: 1ku7_A 1rio_H 3n97_A* Length = 73 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query485
1l9z_H438 Sigma factor SIGA; helix-turn-helix, coiled-coil, 100.0
2a6h_F423 RNA polymerase sigma factor RPOD; RNA polymerase h 100.0
3iyd_F613 RNA polymerase sigma factor RPOD; transcription, i 100.0
1rp3_A239 RNA polymerase sigma factor sigma-28 (FLIA); trans 99.96
3ugo_A245 RNA polymerase sigma factor; protein-DNA complex, 99.96
1l0o_C243 Sigma factor; bergerat fold, helix-turn-helix, pro 99.95
1or7_A194 Sigma-24, RNA polymerase sigma-E factor; regulatio 99.91
2q1z_A184 RPOE, ECF SIGE; ECF sigma factor, cupin fold, zinc 99.89
3mzy_A164 RNA polymerase sigma-H factor; PSI, MCSG, structur 99.84
2lfw_A157 PHYR sigma-like domain; signal transduction, respo 99.77
3n0r_A 286 Response regulator; sigma factor, receiver, two-co 99.65
1sig_A339 Sigma70, RNA polymerase primary sigma factor; RNA 99.62
3t72_q99 RNA polymerase sigma factor RPOD, DNA-directed RN 99.44
3hug_A92 RNA polymerase sigma factor; ECF sigma factor, zin 99.3
2p7v_B68 Sigma-70, RNA polymerase sigma factor RPOD; RSD, r 99.2
1tty_A87 Sigma-A, RNA polymerase sigma factor RPOD; helix-t 99.16
2o7g_A112 Probable RNA polymerase sigma-C factor; sigma fact 99.14
1ku3_A73 Sigma factor SIGA; helix-turn-helix, transcription 99.06
2o8x_A70 Probable RNA polymerase sigma-C factor; promoter r 99.02
1h3l_A87 RNA polymerase sigma factor; transcription, DNA-bi 98.99
1xsv_A113 Hypothetical UPF0122 protein SAV1236; helix-turn-h 98.91
1s7o_A113 Hypothetical UPF0122 protein SPY1201/SPYM3_0842/SP 98.76
3clo_A258 Transcriptional regulator; NP_811094.1, bacterial 98.73
3c57_A95 Two component transcriptional regulatory protein; 98.56
2rnj_A91 Response regulator protein VRAR; HTH LUXR-type dom 98.55
1x3u_A79 Transcriptional regulatory protein FIXJ; helix-tur 98.53
1jhg_A101 Trp operon repressor; complex (regulatory protein- 98.5
1je8_A82 Nitrate/nitrite response regulator protein NARL; p 98.43
1fse_A74 GERE; helix-turn-helix DNA-binding protein transcr 98.23
3ulq_B90 Transcriptional regulatory protein COMA; tetratric 98.16
1p4w_A99 RCSB; solution structure, DNA binding domain, DNA 98.06
2jpc_A61 SSRB; DNA binding protein, structural genomics, PS 98.04
2q0o_A236 Probable transcriptional activator protein TRAR; h 97.64
1l3l_A234 Transcriptional activator protein TRAR; helix-turn 97.62
3szt_A237 QCSR, quorum-sensing control repressor; quorum sen 97.51
3qp6_A265 CVIR transcriptional regulator; quorum sensing, ag 97.37
1tc3_C51 Protein (TC3 transposase); DNA binding, helix-turn 97.28
2w7n_A101 TRFB transcriptional repressor protein; INCP, plas 97.12
2x48_A55 CAG38821; archeal virus, viral protein; 2.60A {Sul 96.84
1yio_A208 Response regulatory protein; transcription regulat 96.77
1a04_A215 Nitrate/nitrite response regulator protein NARL; s 96.65
3c3w_A225 Two component transcriptional regulatory protein; 96.45
3klo_A225 Transcriptional regulator VPST; REC domain, HTH do 95.92
3p7n_A258 Sensor histidine kinase; LOV domain, light-activat 95.14
1jko_C52 HIN recombinase, DNA-invertase HIN; water-mediated 94.64
1p2f_A220 Response regulator; DRRB, OMPR/PHOB, transcription 94.59
3kor_A119 Possible Trp repressor; putative DNA-binding Trp r 94.55
2gwr_A238 DNA-binding response regulator MTRA; two-component 94.33
2oqr_A230 Sensory transduction protein REGX3; response regul 94.26
1kgs_A225 DRRD, DNA binding response regulator D; DNA-bindin 93.8
1ys7_A233 Transcriptional regulatory protein PRRA; response 93.59
1zx4_A 192 P1 PARB, plasmid partition PAR B protein, PARB; tr 93.09
1u78_A141 TC3 transposase, transposable element TC3 transpos 93.0
1pdn_C128 Protein (PRD paired); protein-DNA complex, double 92.99
3q9s_A249 DNA-binding response regulator; DNA binding protei 92.32
2hqr_A223 Putative transcriptional regulator; phosporylation 92.3
3ugo_A245 RNA polymerase sigma factor; protein-DNA complex, 92.03
1k78_A149 Paired box protein PAX5; paired domain, ETS domain 91.83
2elh_A87 CG11849-PA, LD40883P; structural genomics, NPPSFA, 91.46
1qgp_A77 Protein (double stranded RNA adenosine deaminase); 91.14
1oyi_A82 Double-stranded RNA-binding protein; (alpha+beta) 90.84
3r0j_A250 Possible two component system response transcript 90.51
3frw_A107 Putative Trp repressor protein; structural genomic 90.2
1qbj_A81 Protein (double-stranded RNA specific adenosine D 90.11
2glo_A59 Brinker CG9653-PA; protein-DNA complex, helix-turn 90.0
3k2z_A 196 LEXA repressor; winged helix-turn-helix, SOS syste 89.94
2w48_A 315 Sorbitol operon regulator; SORC, activator, repres 89.74
3r0a_A123 Putative transcriptional regulator; structural gen 89.56
2lkp_A119 Transcriptional regulator, ARSR family; symmetric 89.54
2heo_A67 Z-DNA binding protein 1; protein DLM1-Z-DNA comple 89.45
2jn6_A97 Protein CGL2762, transposase; GFT PSI-2, protein s 89.45
2cfx_A144 HTH-type transcriptional regulator LRPC; transcrip 89.13
2o3f_A111 Putative HTH-type transcriptional regulator YBBH; 89.05
1uxc_A65 FRUR (1-57), fructose repressor; DNA-binding prote 89.04
3iyd_F 613 RNA polymerase sigma factor RPOD; transcription, i 89.02
2k27_A159 Paired box protein PAX-8; paired domain, solution 88.32
2d1h_A109 ST1889, 109AA long hypothetical transcriptional re 88.31
1r1u_A106 CZRA, repressor protein; zinc, DNA binding, transc 88.27
2w25_A150 Probable transcriptional regulatory protein; trans 87.92
3tgn_A146 ADC operon repressor ADCR; helix-turn-helix, trans 87.89
2cyy_A151 Putative HTH-type transcriptional regulator PH151; 87.85
2p5v_A162 Transcriptional regulator, LRP/ASNC family; NMB057 87.52
2dbb_A151 Putative HTH-type transcriptional regulator PH006; 87.39
1sfx_A109 Conserved hypothetical protein AF2008; structural 87.37
2cg4_A152 Regulatory protein ASNC; DNA binding, FFRP, LRP fa 87.36
2pn6_A150 ST1022, 150AA long hypothetical transcriptional re 87.29
3pqk_A102 Biofilm growth-associated repressor; helix-turn-he 87.25
2zkz_A99 Transcriptional repressor PAGR; protein-DNA, HTH m 87.16
3iwf_A107 Transcription regulator RPIR family; transcription 87.15
3i4p_A 162 Transcriptional regulator, ASNC family; PSI, struc 86.99
3jth_A98 Transcription activator HLYU; transcription factor 86.92
3nqo_A189 MARR-family transcriptional regulator; structural 86.83
1i1g_A141 Transcriptional regulator LRPA; helix-turn-helix, 86.69
1u78_A141 TC3 transposase, transposable element TC3 transpos 86.13
3ech_A142 MEXR, multidrug resistance operon repressor; winge 85.97
2l0k_A93 Stage III sporulation protein D; SPOIIID, solution 85.87
2e1c_A171 Putative HTH-type transcriptional regulator PH151; 85.78
3cuo_A99 Uncharacterized HTH-type transcriptional regulato; 85.74
3eco_A139 MEPR; mutlidrug efflux pump regulator winged helix 85.68
1r1t_A122 Transcriptional repressor SMTB; zinc, transcriptio 85.66
2dk5_A91 DNA-directed RNA polymerase III 39 kDa polypeptide 85.46
3bro_A141 Transcriptional regulator; helix_TURN_helix, multi 85.31
2kko_A108 Possible transcriptional regulatory protein (possi 84.82
2ia0_A171 Putative HTH-type transcriptional regulator PF086; 84.59
2gxg_A146 146AA long hypothetical transcriptional regulator; 84.57
2x4h_A139 Hypothetical protein SSO2273; transcription; 2.30A 84.56
2oqg_A114 Possible transcriptional regulator, ARSR family P; 84.32
2fu4_A83 Ferric uptake regulation protein; DNA binding doma 84.19
1ku9_A152 Hypothetical protein MJ223; putative transcription 83.95
1q1h_A110 TFE, transcription factor E, TFE; TFIIE, transcrip 83.84
3bdd_A142 Regulatory protein MARR; putative multiple antibio 83.77
2fa5_A162 Transcriptional regulator MARR/EMRR family; multip 83.54
1uly_A 192 Hypothetical protein PH1932; helix-turn-helix, str 83.54
1jhf_A 202 LEXA repressor; LEXA SOS repressor, hydrolase; 1.8 83.4
3bpv_A138 Transcriptional regulator; MARR, DNA binding, tran 83.29
3hsr_A140 HTH-type transcriptional regulator SARZ; helix-tur 82.83
3cdh_A155 Transcriptional regulator, MARR family; helix-turn 82.8
2a6c_A83 Helix-turn-helix motif; putative transcriptional r 82.67
1hlv_A131 CENP-B, major centromere autoantigen B; helix-turn 82.49
2nnn_A140 Probable transcriptional regulator; structural gen 82.29
2htj_A81 P fimbrial regulatory protein KS71A; winged helix- 82.29
3o9x_A133 Uncharacterized HTH-type transcriptional regulato; 82.27
3nrv_A148 Putative transcriptional regulator (MARR/EMRR FAM; 82.24
1jgs_A138 Multiple antibiotic resistance protein MARR; trans 82.07
1y0u_A96 Arsenical resistance operon repressor, putative; s 81.83
1zug_A71 Phage 434 CRO protein; gene regulating protein, tr 81.75
2xi8_A66 Putative transcription regulator; HTH DNA-binding 81.71
2qww_A154 Transcriptional regulator, MARR family; YP_013417. 81.68
1r69_A69 Repressor protein CI; gene regulating protein; 2.0 81.62
3qq6_A78 HTH-type transcriptional regulator SINR; helix-tur 81.43
3oop_A143 LIN2960 protein; protein structure initiative, PSI 81.22
4hbl_A149 Transcriptional regulator, MARR family; HTH, trans 81.2
3kz3_A80 Repressor protein CI; five helix bundle, DNA-bindi 81.16
1on2_A142 Transcriptional regulator MNTR; helix-turn-helix, 81.1
1sfu_A75 34L protein; protein/Z-DNA complex, DNA binding pr 80.8
2a61_A145 Transcriptional regulator TM0710; APC4350, MCSG, m 80.65
4b8x_A147 SCO5413, possible MARR-transcriptional regulator; 80.58
1y7y_A74 C.AHDI; helix-turn-helix, DNA-binding protein, tra 80.46
2r1j_L68 Repressor protein C2; protein-DNA complex, helix-t 80.16
3t76_A88 VANU, transcriptional regulator vanug; structural 80.16
3f6w_A83 XRE-family like protein; helix-turn-helix, DNA bin 80.11
2b5a_A77 C.BCLI; helix-turn-helix motif, gene regulation; 1 80.06
3f3x_A144 Transcriptional regulator, MARR family, putative; 80.02
>1l9z_H Sigma factor SIGA; helix-turn-helix, coiled-coil, transcription/DNA complex; 6.50A {Thermus aquaticus} SCOP: i.8.1.1 Back     alignment and structure
Probab=100.00  E-value=2e-44  Score=379.75  Aligned_cols=291  Identities=32%  Similarity=0.533  Sum_probs=249.7

Q ss_pred             hhHHHHHHhhccccCCCHHHHHHHHHHHHcCCcchhHHH------------------HHHhhhCCCCchHHHHH------
Q 011454          191 NRLKGYVKGVVSEELLTHAEVVRLSKKIKTGLSLDDHKL------------------RLKERLGCEPSMEQLAA------  246 (485)
Q Consensus       191 ~~~~~yl~~i~~~~~Lt~eee~~L~~~ik~Gd~l~~~~~------------------~l~~~~g~~p~~~~~a~------  246 (485)
                      +.++.||++|+++|+||++||++|+++++.|..+++...                  +.....++.|+..+|+.      
T Consensus        94 d~~~~Yl~ei~~~pLLt~eEE~~La~~i~~g~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  173 (438)
T 1l9z_H           94 DPVRQYLHEIGQVPLLTLEEEIDLARKVEEGMEAIKKLSEATGLDQELIREVVRAKILGTARIQKIPGLKEKPDPKTVEE  173 (438)
T ss_pred             ChHHHHHHHhccCCCCCHHHHHHHHHHHHHhhhHHHHHHhhhccchhhhhhhhhhhhhhcccccccccccccccchhhhh
Confidence            578889999999999999999999999999965433211                  11224567788777642      


Q ss_pred             ------HhhcChhHHHHhhhhhHHHHHHHHHHhHHHHHHHHHHhcCCCCcHHHHHHHHHHHHHHhHhcCCCCCCcchhhH
Q 011454          247 ------SLRISRPELQSILMECSLAREKLVMSNVRLVMSIAQRYDNMGADMADLVQGGLIGLLRGIEKFDSSKGFKISTY  320 (485)
Q Consensus       247 ------~~~~s~~~L~~~l~~~~~A~e~Lie~yl~LV~sIA~ry~~~~~d~EDLiQEG~IgL~kAiekFDp~rG~rFsTY  320 (485)
                            ..+++..+|.+.+.++..|+++||..|+++|+++|++|.+++.+++||+||||||||+|+++|||.+|++|+||
T Consensus       174 ~~~~~~~~~~~~~eLi~~~~~d~~A~~~Li~~nlrlVv~iA~ry~~~g~~aeDLIQEg~IgL~kAvekFDp~kG~rFsTY  253 (438)
T 1l9z_H          174 VDGKLKSLPKELKRYLHIAREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGLIRAVEKFEYKRRFKFSTY  253 (438)
T ss_pred             hhhhhhcccchHHHHHHHHhcCHHHHHHHHHHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHHHHHHhcCcccCCChHHH
Confidence                  23566788999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHhhhhccccccHHHHHHHHHHHHHHHH-HcCCCCCHHHHHHHhC--CCHHHHHHHHHHH-------
Q 011454          321 VYWWIRQGVSRALVENSRTLRLPNHLHERLGLIRNAKLRLE-EKGVTPSVDRIAEYLN--MSQKKVRNATEVL-------  390 (485)
Q Consensus       321 A~~~Ir~~I~~~I~~~~r~irip~~~~~~~~kirka~~~L~-~~gr~ps~eEIae~L~--is~eev~~~l~~~-------  390 (485)
                      ++||||+.|.++|+++++.+++|.++...++++++..+.+. ..|+.|+.++||+.+|  ++.++|..++...       
T Consensus       254 A~~wIR~~I~~~i~~~~R~irlp~~~~~~l~~lrr~~r~l~~~lgr~pt~eeiA~~l~~~v~~e~V~~~~~~~~~~~SLd  333 (438)
T 1l9z_H          254 ATWWIRQAINRAIADQARTIRIPVHMVETINKLSRTARQLQQELGREPSYEEIAEAMGPGWDAKRVEETLKIAQEPVSLE  333 (438)
T ss_pred             HHHHHHHHHHHHHHHhcchhccchHHHHHHHHHHHHHHHHHHHhCCCCCHHHHHHHhCCCCCHHHHHHHHHhcccccccc
Confidence            99999999999999999999999999999999998888774 6899999999999999  9999998775432       


Q ss_pred             ------------HhhhcccCCCCCcchHHHHHHHHHHHHHHHhhCCHHHHHHHhhHhccC-CCCCCHHHHHHHHCCCHHH
Q 011454          391 ------------AYIADNRVENNPWHGVDDWALKDEVNKLIIVTLGEREREIIRLYYGLD-KECLTWEDISKRIGLSRER  457 (485)
Q Consensus       391 ------------~~l~D~~~e~~pee~~e~~el~e~L~~~L~~~Lp~rER~VI~LryGL~-~eg~S~eEIAe~LgIS~~t  457 (485)
                                  +++++.. ..+|++.+...+....|..+| +.||+++|.||.++|||+ .+++|++|||+.||||++|
T Consensus       334 ~~~~~d~d~~l~d~l~d~~-~~~pee~~~~~~~~~~L~~aL-~~L~ereR~VI~LRygL~~~e~~TleEIAe~LgIS~er  411 (438)
T 1l9z_H          334 TPIGDEKDSFYGDFIPDEN-LPSPVEAAAQSLLSEELEKAL-SKLSEREAMVLKLRKGLIDGREHTLEEVGAYFGVTRER  411 (438)
T ss_pred             cccccccchhhhhhhcccc-cCCHHHHHHHHHHHHHHHHHH-HhCCHHHHHHHHHHHhccCCCCCCHHHHHHHHCcCHHH
Confidence                        0111111 124566666777888999999 899999999999999884 5799999999999999999


Q ss_pred             HHHHHHHHHHHHH-HHHHhhhHHHhhh
Q 011454          458 VRQVGLVALEKLK-HAARKKKMEAMLV  483 (485)
Q Consensus       458 Vrqi~~rALkKLR-k~L~~~~l~~~l~  483 (485)
                      |+|++++|+++|| +.+....++.|+.
T Consensus       412 VRqi~~RAlkKLR~~~~~~~~l~~yl~  438 (438)
T 1l9z_H          412 IRQIENKALRKLKYHESRTRKLRDFLE  438 (438)
T ss_pred             HHHHHHHHHHHHHHhHhhHHHHHHhhC
Confidence            9999999999999 8888888999873



>2a6h_F RNA polymerase sigma factor RPOD; RNA polymerase holoenzyme, streptolydigin, antibiotic, transcription regulation; HET: STD; 2.40A {Thermus thermophilus} SCOP: a.4.13.1 a.4.13.2 a.177.1.1 PDB: 1smy_F* 1zyr_F* 1iw7_F* 2a69_F* 2a6e_F 2a68_F* 2be5_F* 2cw0_F 3eql_F* 3dxj_F* 1l9u_H Back     alignment and structure
>3iyd_F RNA polymerase sigma factor RPOD; transcription, initiation, class I, activator, RNA polymeras holoenzyme, sigma70, open complex, CAP, CRP; HET: DNA CMP; 19.80A {Escherichia coli k-12} Back     alignment and structure
>1rp3_A RNA polymerase sigma factor sigma-28 (FLIA); transcription; 2.30A {Aquifex aeolicus} SCOP: a.4.13.1 a.4.13.2 a.177.1.1 PDB: 1sc5_A Back     alignment and structure
>3ugo_A RNA polymerase sigma factor; protein-DNA complex, bacterial promoter opening, G-quartet, quadruplex, DNA binding; 2.10A {Thermus aquaticus} PDB: 3ugp_A 4gor_A 1ku2_A 3lev_A* 3les_A* Back     alignment and structure
>1l0o_C Sigma factor; bergerat fold, helix-turn-helix, protein binding; HET: ADP; 2.90A {Geobacillus stearothermophilus} SCOP: a.4.13.2 Back     alignment and structure
>1or7_A Sigma-24, RNA polymerase sigma-E factor; regulation, DNA-binding, transmembrane, transcription; 2.00A {Escherichia coli} SCOP: a.4.13.2 a.177.1.1 PDB: 2h27_A Back     alignment and structure
>3mzy_A RNA polymerase sigma-H factor; PSI, MCSG, structural genomics, midwest center for structura genomics, protein structure initiative; 2.50A {Fusobacterium nucleatum subsp} Back     alignment and structure
>2lfw_A PHYR sigma-like domain; signal transduction, response regulator, sigma factor mimicr sigma factor, general stress response, signaling protein; NMR {Sphingomonas SP} Back     alignment and structure
>3n0r_A Response regulator; sigma factor, receiver, two-component SI transduction, signaling protein; HET: MSE GOL; 1.25A {Caulobacter vibrioides} PDB: 3t0y_A Back     alignment and structure
>1sig_A Sigma70, RNA polymerase primary sigma factor; RNA polymerase sigma factor, transcription regulation; 2.60A {Escherichia coli} SCOP: a.177.1.1 Back     alignment and structure
>3t72_q RNA polymerase sigma factor RPOD, DNA-directed RN polymerase subunit beta; winged-helix motif, transcription activation, DNA-binding; 4.33A {Escherichia coli} PDB: 1tlh_B Back     alignment and structure
>3hug_A RNA polymerase sigma factor; ECF sigma factor, zinc binding anti-sigma factor, oxidative transcription regulation; 2.35A {Mycobacterium tuberculosis} Back     alignment and structure
>2p7v_B Sigma-70, RNA polymerase sigma factor RPOD; RSD, regulator of sigma 70, sigma 70 domain 4, transcription, regulation, helix-turn-helix; 2.60A {Escherichia coli} SCOP: a.4.13.2 Back     alignment and structure
>1tty_A Sigma-A, RNA polymerase sigma factor RPOD; helix-turn-helix, transcription; NMR {Thermotoga maritima} SCOP: a.4.13.2 Back     alignment and structure
>2o7g_A Probable RNA polymerase sigma-C factor; sigma factor, transcription regulation, -10 element recognit domain, transcription; 2.70A {Mycobacterium tuberculosis} Back     alignment and structure
>1ku3_A Sigma factor SIGA; helix-turn-helix, transcription; 1.80A {Thermus aquaticus} SCOP: a.4.13.2 PDB: 1ku7_A 1rio_H 3n97_A* Back     alignment and structure
>2o8x_A Probable RNA polymerase sigma-C factor; promoter recognition, transcription regulation, helix-turn-H motif, transcription; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1h3l_A RNA polymerase sigma factor; transcription, DNA-binding, transcription regulation; 2.37A {Streptomyces coelicolor A3} SCOP: a.177.1.1 Back     alignment and structure
>1xsv_A Hypothetical UPF0122 protein SAV1236; helix-turn-helix, putative DNA-binding protein, signal recognition particle, unknown function; 1.70A {Staphylococcus aureus subsp} SCOP: a.4.13.3 Back     alignment and structure
>1s7o_A Hypothetical UPF0122 protein SPY1201/SPYM3_0842/SPS1042/SPYM18_1152; putative DNA binding protein, structural genomics; 2.31A {Streptococcus pyogenes serotype M3} SCOP: a.4.13.3 Back     alignment and structure
>3clo_A Transcriptional regulator; NP_811094.1, bacterial regulatory proteins, LUXR family, structural genomics; 2.04A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3c57_A Two component transcriptional regulatory protein; response regulator, two-component regulatory system, DNA-BIN protein; 1.70A {Mycobacterium tuberculosis} PDB: 1zlk_A 1zlj_A Back     alignment and structure
>2rnj_A Response regulator protein VRAR; HTH LUXR-type domain, DNA binding domain, activator, antibiotic resistance, cytoplasm, DNA-binding; NMR {Staphylococcus aureus} Back     alignment and structure
>1x3u_A Transcriptional regulatory protein FIXJ; helix-turn-helix; NMR {Sinorhizobium meliloti} Back     alignment and structure
>1jhg_A Trp operon repressor; complex (regulatory protein-peptide), DNA-binding regulatory complex (regulatory protein-peptide) complex; HET: TRP; 1.30A {Escherichia coli} SCOP: a.4.12.1 PDB: 1co0_A* 1mi7_R 1p6z_R 1wrp_R* 1zt9_A* 2oz9_R* 3ssw_R 3wrp_A 1rcs_A* 1wrs_R* 1wrt_R 2xdi_A 3ssx_R* 1trr_A* 1tro_A* Back     alignment and structure
>1je8_A Nitrate/nitrite response regulator protein NARL; protein-DNA complex, two-component response regulator, helix-turn-helix, DNA bending; 2.12A {Escherichia coli} SCOP: a.4.6.2 PDB: 1zg1_A 1zg5_A Back     alignment and structure
>1fse_A GERE; helix-turn-helix DNA-binding protein transcriptional regulat transcription; 2.05A {Bacillus subtilis} SCOP: a.4.6.2 Back     alignment and structure
>3ulq_B Transcriptional regulatory protein COMA; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} PDB: 2krf_A Back     alignment and structure
>1p4w_A RCSB; solution structure, DNA binding domain, DNA binding protein; NMR {Erwinia amylovora} SCOP: a.4.6.2 Back     alignment and structure
>2jpc_A SSRB; DNA binding protein, structural genomics, PSI-2, protein structure initiative; NMR {Salmonella typhimurium} Back     alignment and structure
>2q0o_A Probable transcriptional activator protein TRAR; helix-turn-helix, two-helix coiled coil; HET: LAE; 2.00A {Rhizobium SP} Back     alignment and structure
>1l3l_A Transcriptional activator protein TRAR; helix-turn-helix DNA binding motif, alpha/beta/alpha sandwich; HET: LAE; 1.66A {Agrobacterium tumefaciens} SCOP: a.4.6.2 d.110.5.1 PDB: 1h0m_A* Back     alignment and structure
>3szt_A QCSR, quorum-sensing control repressor; quorum sensing acyl-homoserine lactone, helix-turn-helix, transcription factor, 3-OXO-C12 HSL; HET: OHN; 2.55A {Pseudomonas aeruginosa} Back     alignment and structure
>3qp6_A CVIR transcriptional regulator; quorum sensing, agonist, antagonist, LUXR, acylated homoseri lactone, transcription factor; HET: HL6; 2.00A {Chromobacterium violaceum} PDB: 3qp5_A* Back     alignment and structure
>1tc3_C Protein (TC3 transposase); DNA binding, helix-turn-helix, TC1/mariner family, complex (transposase/DNA), DNA binding protein/DNA complex; HET: DNA; 2.45A {Caenorhabditis elegans} SCOP: a.4.1.2 Back     alignment and structure
>2w7n_A TRFB transcriptional repressor protein; INCP, plasmid, repressor, DNA-binding, transcription/DNA; HET: BRU; 1.85A {Escherichia coli} Back     alignment and structure
>2x48_A CAG38821; archeal virus, viral protein; 2.60A {Sulfolobus islandicus rod-shaped virusorganism_taxid} Back     alignment and structure
>1yio_A Response regulatory protein; transcription regulation, DNA binding protein; 2.20A {Pseudomonas fluorescens} SCOP: a.4.6.2 c.23.1.1 PDB: 1zn2_A Back     alignment and structure
>1a04_A Nitrate/nitrite response regulator protein NARL; signal transduction protein, response regulators, two- component systems; 2.20A {Escherichia coli} SCOP: a.4.6.2 c.23.1.1 PDB: 1rnl_A Back     alignment and structure
>3c3w_A Two component transcriptional regulatory protein; response regulator, two-component regulatory system, DNA-BIN protein; 2.20A {Mycobacterium tuberculosis} Back     alignment and structure
>3klo_A Transcriptional regulator VPST; REC domain, HTH domain, DNA-binding, transcription regulation; HET: C2E TAR; 2.80A {Vibrio cholerae} PDB: 3kln_A* Back     alignment and structure
>3p7n_A Sensor histidine kinase; LOV domain, light-activated transcription factor, DNA bindin; HET: FMN; 2.10A {Erythrobacter litoralis} Back     alignment and structure
>1jko_C HIN recombinase, DNA-invertase HIN; water-mediated recognition, protein-DNA complex, A10G mutant, DNA binding protein/DNA complex; 2.24A {Synthetic} SCOP: a.4.1.2 PDB: 1ijw_C* 1jj6_C* 1jj8_C* 1hcr_A 1jkp_C 1jkq_C 1jkr_C Back     alignment and structure
>1p2f_A Response regulator; DRRB, OMPR/PHOB, transcription; HET: MSE; 1.80A {Thermotoga maritima} SCOP: a.4.6.1 c.23.1.1 PDB: 3nns_A* Back     alignment and structure
>3kor_A Possible Trp repressor; putative DNA-binding Trp repressor, TRPR like protein, struc genomics, transcription; 1.60A {Staphylococcus aureus} Back     alignment and structure
>2gwr_A DNA-binding response regulator MTRA; two-component regulatory system, transcription regulation, phosphorylation, OMPR family; 2.10A {Mycobacterium tuberculosis} PDB: 3nhz_A Back     alignment and structure
>2oqr_A Sensory transduction protein REGX3; response regulator, winged-helix-turn-helix, DNA-binding, 3D swapping, two component system; 2.03A {Mycobacterium tuberculosis H37RV} Back     alignment and structure
>1kgs_A DRRD, DNA binding response regulator D; DNA-binding protein, ALPH-beta sandwich, winged-helix, helix helix, DNA binding protein; HET: DNA MSE; 1.50A {Thermotoga maritima} SCOP: a.4.6.1 c.23.1.1 PDB: 3nnn_A* Back     alignment and structure
>1ys7_A Transcriptional regulatory protein PRRA; response regulator, DNA binding domain, phosphorylation; 1.58A {Mycobacterium tuberculosis} SCOP: a.4.6.1 c.23.1.1 PDB: 1ys6_A Back     alignment and structure
>1zx4_A P1 PARB, plasmid partition PAR B protein, PARB; translation; HET: CIT; 2.98A {Enterobacteria phage P1} PDB: 2ntz_A Back     alignment and structure
>1u78_A TC3 transposase, transposable element TC3 transposase; transposon DNA, bipartite DNA-binding, HTH- motif, DNA binding protein/DNA complex; 2.69A {Caenorhabditis elegans} SCOP: a.4.1.2 a.4.1.2 Back     alignment and structure
>1pdn_C Protein (PRD paired); protein-DNA complex, double helix, PAX, paired domain, DNA-binding protein, gene regulation/DNA complex; HET: DNA; 2.50A {Drosophila melanogaster} SCOP: a.4.1.5 Back     alignment and structure
>3q9s_A DNA-binding response regulator; DNA binding protein; 2.40A {Deinococcus radiodurans} Back     alignment and structure
>2hqr_A Putative transcriptional regulator; phosporylation-independent response regulator, H. pylori, SY dimer, signaling protein; NMR {Helicobacter pylori} Back     alignment and structure
>3ugo_A RNA polymerase sigma factor; protein-DNA complex, bacterial promoter opening, G-quartet, quadruplex, DNA binding; 2.10A {Thermus aquaticus} PDB: 3ugp_A 4gor_A 1ku2_A 3lev_A* 3les_A* Back     alignment and structure
>1k78_A Paired box protein PAX5; paired domain, ETS domain, transcription factor, transcription/DNA complex; 2.25A {Homo sapiens} SCOP: a.4.1.5 a.4.1.5 PDB: 1mdm_A 6pax_A Back     alignment and structure
>2elh_A CG11849-PA, LD40883P; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Drosophila melanogaster} Back     alignment and structure
>1qgp_A Protein (double stranded RNA adenosine deaminase); Z-alpha-Z-DNA binding domain, RNA-editing, Z-DNA recognition, ADAR1, helix- turn-helix; NMR {Homo sapiens} SCOP: a.4.5.19 Back     alignment and structure
>1oyi_A Double-stranded RNA-binding protein; (alpha+beta) helix-turn-helix, viral protein; NMR {Vaccinia virus} SCOP: a.4.5.19 Back     alignment and structure
>3r0j_A Possible two component system response transcript positive regulator PHOP; beta-alpha fold, winged helix-turn-helix; 2.50A {Mycobacterium tuberculosis} Back     alignment and structure
>3frw_A Putative Trp repressor protein; structural genomics, APC21159, PSI-2, P structure initiative; 2.05A {Ruminococcus obeum atcc 29174} PDB: 3g1c_A Back     alignment and structure
>1qbj_A Protein (double-stranded RNA specific adenosine D (ADAR1)); protein-Z-DNA complex, hydrolase-DNA complex; HET: DNA; 2.10A {Homo sapiens} SCOP: a.4.5.19 PDB: 3f21_A* 3f22_A* 3f23_A* 3irr_A* 3irq_D* 2gxb_A 2acj_A 2l54_A Back     alignment and structure
>2glo_A Brinker CG9653-PA; protein-DNA complex, helix-turn-helix motif, transcription/DNA complex; NMR {Drosophila melanogaster} Back     alignment and structure
>3k2z_A LEXA repressor; winged helix-turn-helix, SOS system, autoca cleavage, DNA damage, DNA repair, DNA replication, DNA-BIND hydrolase; 1.37A {Thermotoga maritima} Back     alignment and structure
>2w48_A Sorbitol operon regulator; SORC, activator, repressor, DNA-binding, transcription, transcription regulator, transcription regulation; 3.20A {Klebsiella pneumoniae} Back     alignment and structure
>3r0a_A Putative transcriptional regulator; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.31A {Methanosarcina mazei} Back     alignment and structure
>2lkp_A Transcriptional regulator, ARSR family; symmetric homodimer, NI(II) binding protein, DNA binding Pro transcription regulator; NMR {Mycobacterium tuberculosis} Back     alignment and structure
>2heo_A Z-DNA binding protein 1; protein DLM1-Z-DNA complex, immune system-DNA complex; 1.70A {Mus musculus} PDB: 1j75_A Back     alignment and structure
>2jn6_A Protein CGL2762, transposase; GFT PSI-2, protein structure, structural genomics, protein structure initiative; NMR {Corynebacterium glutamicum} SCOP: a.4.1.19 Back     alignment and structure
>2cfx_A HTH-type transcriptional regulator LRPC; transcriptional regulation, DNA binding, FFRP; 2.4A {Bacillus subtilis} SCOP: a.4.5.32 d.58.4.2 Back     alignment and structure
>2o3f_A Putative HTH-type transcriptional regulator YBBH; APC85504, putative transcriptional regulator YBBH; HET: MLY; 1.75A {Bacillus subtilis} SCOP: a.4.1.20 Back     alignment and structure
>1uxc_A FRUR (1-57), fructose repressor; DNA-binding protein, LACI family, transc regulation; NMR {Escherichia coli} SCOP: a.35.1.5 PDB: 1uxd_A Back     alignment and structure
>3iyd_F RNA polymerase sigma factor RPOD; transcription, initiation, class I, activator, RNA polymeras holoenzyme, sigma70, open complex, CAP, CRP; HET: DNA CMP; 19.80A {Escherichia coli k-12} Back     alignment and structure
>2k27_A Paired box protein PAX-8; paired domain, solution structure, triple frequency, 3D NMR, induced FIT, alternative splicing, developmental protein; NMR {Homo sapiens} Back     alignment and structure
>2d1h_A ST1889, 109AA long hypothetical transcriptional regulator; helix-turn-helix, intermolecular and intramolecular S-S bond structural genomics; 2.05A {Sulfolobus tokodaii} SCOP: a.4.5.50 Back     alignment and structure
>1r1u_A CZRA, repressor protein; zinc, DNA binding, transcriptional regulation, winged HTH protein, transcription repressor; 2.00A {Staphylococcus aureus} SCOP: a.4.5.5 PDB: 1r1v_A 2kjb_A 2kjc_A Back     alignment and structure
>2w25_A Probable transcriptional regulatory protein; transcription regulation, mutant, RV3291C, Glu104Ala, DNA-binding; 2.15A {Mycobacterium tuberculosis} PDB: 2vbw_A* 2vbx_A* 2vby_A* 2vbz_A* 2vc0_A 2vc1_A 2w24_A 2ivm_A 2w29_A 2qz8_A Back     alignment and structure
>3tgn_A ADC operon repressor ADCR; helix-turn-helix, transcriptional regulator, transcription; 2.00A {Streptococcus pneumoniae} Back     alignment and structure
>2cyy_A Putative HTH-type transcriptional regulator PH151; structural genomics, pyrococcus horikosii OT3, NPPSFA; HET: MSE GLN; 1.80A {Pyrococcus horikoshii} SCOP: a.4.5.32 d.58.4.2 Back     alignment and structure
>2p5v_A Transcriptional regulator, LRP/ASNC family; NMB0573, structu genomics; 1.99A {Neisseria meningitidis} PDB: 2p6s_A 2p6t_A Back     alignment and structure
>2dbb_A Putative HTH-type transcriptional regulator PH006; ASNC family, helix-turn-helix (HTH) domain, structural genom NPPSFA; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>1sfx_A Conserved hypothetical protein AF2008; structural genomics, HTH MOT protein structure initiative, midwest center for structural genomics; 1.55A {Archaeoglobus fulgidus} SCOP: a.4.5.50 Back     alignment and structure
>2cg4_A Regulatory protein ASNC; DNA binding, FFRP, LRP family, transcription, DNA- binding, transcription regulation; 2.4A {Escherichia coli} SCOP: a.4.5.32 d.58.4.2 Back     alignment and structure
>2pn6_A ST1022, 150AA long hypothetical transcriptional regulator; LRP/ASNC family Gln binding, structural genomics, NPPSFA; HET: GLN; 1.44A {Sulfolobus tokodaii} PDB: 2efn_A* 2e7x_A* 2e7w_A* 2yx4_A* 2efq_A* 2pmh_A* 2yx7_A* 2efp_A* 2efo_A* Back     alignment and structure
>3pqk_A Biofilm growth-associated repressor; helix-turn-helix motif, winged-helix fold, transcriptional R DNA binding, transcription; 2.09A {Xylella fastidiosa} PDB: 3pqj_A Back     alignment and structure
>2zkz_A Transcriptional repressor PAGR; protein-DNA, HTH motif, dimer, DN binding, transcription regulation; 2.00A {Bacillus anthracis} Back     alignment and structure
>3iwf_A Transcription regulator RPIR family; transcriptional, N-terminal, PSI, MCSG, structural genomics, midwest center structural genomics; 1.40A {Staphylococcus epidermidis} Back     alignment and structure
>3i4p_A Transcriptional regulator, ASNC family; PSI, structural genom protein structure initiative, midwest center for structural genomics; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>3jth_A Transcription activator HLYU; transcription factor, RTXA, DNA-binding, transcription regulation; 2.00A {Vibrio vulnificus} Back     alignment and structure
>3nqo_A MARR-family transcriptional regulator; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE PG4; 2.20A {Clostridium difficile} Back     alignment and structure
>1i1g_A Transcriptional regulator LRPA; helix-turn-helix, LRP/ASNC family; 2.90A {Pyrococcus furiosus} SCOP: a.4.5.32 d.58.4.2 Back     alignment and structure
>1u78_A TC3 transposase, transposable element TC3 transposase; transposon DNA, bipartite DNA-binding, HTH- motif, DNA binding protein/DNA complex; 2.69A {Caenorhabditis elegans} SCOP: a.4.1.2 a.4.1.2 Back     alignment and structure
>3ech_A MEXR, multidrug resistance operon repressor; winged helix, helix-turn-helix, protein-peptide complex; 1.80A {Pseudomonas aeruginosa} SCOP: a.4.5.28 PDB: 1lnw_A 3mex_A Back     alignment and structure
>2l0k_A Stage III sporulation protein D; SPOIIID, solution structure, DNA binding, bacillus subti transcription factor, transcription; NMR {Bacillus subtilis} Back     alignment and structure
>3cuo_A Uncharacterized HTH-type transcriptional regulato; DNA-binding transcriptional regulator, structural genomics, MCSG; 2.00A {Escherichia coli K12} Back     alignment and structure
>3eco_A MEPR; mutlidrug efflux pump regulator winged helix-turn-helix motif, DNA-binding, transcription, transcription regulation; 2.40A {Staphylococcus aureus} SCOP: a.4.5.0 Back     alignment and structure
>1r1t_A Transcriptional repressor SMTB; zinc, transcriptional regulation, winged HTH protein, DNA binding, transcription repressor; 1.70A {Synechococcus elongatus pcc 7942} SCOP: a.4.5.5 PDB: 1r23_A 1smt_A 1r22_A Back     alignment and structure
>2dk5_A DNA-directed RNA polymerase III 39 kDa polypeptide; structural genomics, winged helix domain, NPPSFA; NMR {Homo sapiens} SCOP: a.4.5.85 Back     alignment and structure
>3bro_A Transcriptional regulator; helix_TURN_helix, multiple antibiotic resistance protein (MA structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.04A {Oenococcus oeni} SCOP: a.4.5.28 Back     alignment and structure
>2kko_A Possible transcriptional regulatory protein (possibly ARSR-family); NESG, DNA-binding, transcription regulation, WHTH, homodimer; NMR {Mycobacterium bovis} PDB: 3gw2_A Back     alignment and structure
>2ia0_A Putative HTH-type transcriptional regulator PF086; ASNC, PSI, structural genomics, southeast collaboratory for structural genomics; 2.37A {Pyrococcus furiosus} Back     alignment and structure
>2gxg_A 146AA long hypothetical transcriptional regulator; winged helix; 1.45A {Sulfolobus tokodaii} PDB: 2eb7_A 2yr2_A 3gez_A 3gf2_A* 3gfi_A 3gfm_A 3gfj_A 3gfl_A Back     alignment and structure
>2x4h_A Hypothetical protein SSO2273; transcription; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2oqg_A Possible transcriptional regulator, ARSR family P; winged-helix-turn-helix, structural genomics, PSI-2, protein structure initiative; 1.54A {Rhodococcus SP} Back     alignment and structure
>2fu4_A Ferric uptake regulation protein; DNA binding domain, helix-turn-helix, DNA binding protein; 1.80A {Escherichia coli} Back     alignment and structure
>1ku9_A Hypothetical protein MJ223; putative transcription factor, homodimeric winged-helix fold, structural genomics, PSI; 2.80A {Methanocaldococcus jannaschii} SCOP: a.4.5.36 Back     alignment and structure
>1q1h_A TFE, transcription factor E, TFE; TFIIE, transcription initiation, preinitiation complex, RNA polymerase II, transcription bubble; 2.90A {Sulfolobus solfataricus} SCOP: a.4.5.41 Back     alignment and structure
>3bdd_A Regulatory protein MARR; putative multiple antibiotic-resistance repressor, structura genomics, joint center for structural genomics, JCSG; 2.20A {Streptococcus suis} Back     alignment and structure
>2fa5_A Transcriptional regulator MARR/EMRR family; multiple antibiotics resistance repressor, XCC structural genomics, X-RAY diffraction; 1.80A {Xanthomonas campestris} Back     alignment and structure
>1uly_A Hypothetical protein PH1932; helix-turn-helix, structural genomics, DNA binding protein; 2.50A {Pyrococcus horikoshii} SCOP: a.4.5.58 PDB: 2cwe_A Back     alignment and structure
>1jhf_A LEXA repressor; LEXA SOS repressor, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.2 b.87.1.1 PDB: 1jhh_A 3jso_A* 3jsp_A* 3k3r_E* 1jhc_A 1jhe_A 1lea_A 1leb_A Back     alignment and structure
>3bpv_A Transcriptional regulator; MARR, DNA binding, transcription factor, winged helix motif, DNA-binding; 1.40A {Methanobacterium thermoautotrophicum} PDB: 3bpx_A* Back     alignment and structure
>3hsr_A HTH-type transcriptional regulator SARZ; helix-turn-helix, cysteine disulfide, MARR-family transcript regulator, DNA-binding; 1.90A {Staphylococcus aureus subsp} PDB: 3hse_A 3hrm_A 4gxo_A Back     alignment and structure
>3cdh_A Transcriptional regulator, MARR family; helix-turn-hleix, structura genomics, PSI-2, protein structure initiative; 2.69A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>2a6c_A Helix-turn-helix motif; putative transcriptional regulator, structural genomics, JOI for structural genomics, JCSG; HET: CIT; 1.90A {Nitrosomonas europaea} SCOP: a.35.1.13 Back     alignment and structure
>1hlv_A CENP-B, major centromere autoantigen B; helix-turn-helix, protein-DNA complex, riken structural genomics/proteomics initiative, RSGI; 2.50A {Homo sapiens} SCOP: a.4.1.7 a.4.1.7 PDB: 1bw6_A Back     alignment and structure
>2nnn_A Probable transcriptional regulator; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.40A {Pseudomonas aeruginosa} Back     alignment and structure
>2htj_A P fimbrial regulatory protein KS71A; winged helix-turn-helix, PAP PILI, transcription activator; NMR {Escherichia coli} SCOP: a.4.5.73 Back     alignment and structure
>3o9x_A Uncharacterized HTH-type transcriptional regulato; HTH-XRE DNA binding motif, transcriptional regulator, bacter antitoxin, Zn binding protein, transcription regulator-DNA; HET: DNA; 2.10A {Escherichia coli} PDB: 3gn5_A* 3gn5_B* 2kz8_A Back     alignment and structure
>3nrv_A Putative transcriptional regulator (MARR/EMRR FAM; PSI-2, protein structure initiati structural genomics; HET: MSE; 2.00A {Acinetobacter SP} Back     alignment and structure
>1jgs_A Multiple antibiotic resistance protein MARR; transcription regulation, DNA-binding, repressor, transcription; HET: SAL; 2.30A {Escherichia coli} SCOP: a.4.5.28 Back     alignment and structure
>1y0u_A Arsenical resistance operon repressor, putative; structural genomics, protein structure initiative, PSI; HET: MSE; 1.60A {Archaeoglobus fulgidus} SCOP: a.4.5.5 Back     alignment and structure
>1zug_A Phage 434 CRO protein; gene regulating protein, transcription regulation; NMR {Phage 434} SCOP: a.35.1.2 PDB: 2cro_A 3cro_L* Back     alignment and structure
>2xi8_A Putative transcription regulator; HTH DNA-binding motif; HET: GOL; 1.21A {Enterococcus faecalis} PDB: 2gzu_A 1utx_A* 2xj3_A 2xiu_A Back     alignment and structure
>2qww_A Transcriptional regulator, MARR family; YP_013417.1, multiple antibiotic-resistance repressor (MARR) structural genomics; HET: MSE; 2.07A {Listeria monocytogenes str} Back     alignment and structure
>1r69_A Repressor protein CI; gene regulating protein; 2.00A {Phage 434} SCOP: a.35.1.2 PDB: 1pra_A 1per_L 1rpe_L* 2or1_L* 1r63_A 2r63_A 1sq8_A Back     alignment and structure
>3qq6_A HTH-type transcriptional regulator SINR; helix-turn-helix motif, biofilm, repressor, SINI; 1.90A {Bacillus subtilis} Back     alignment and structure
>3oop_A LIN2960 protein; protein structure initiative, PSI-2, structural genomics, MI center for structural genomics, MCSG, unknown function; 1.78A {Listeria innocua} Back     alignment and structure
>4hbl_A Transcriptional regulator, MARR family; HTH, transcription factor, DNA binding; 2.50A {Staphylococcus epidermidis} Back     alignment and structure
>3kz3_A Repressor protein CI; five helix bundle, DNA-binding, transcription, transcription regulation; 1.64A {Enterobacteria phage lambda} Back     alignment and structure
>1on2_A Transcriptional regulator MNTR; helix-turn-helix, DNA-binding protein, metalloregulatory protein; 1.61A {Bacillus subtilis} SCOP: a.4.5.24 a.76.1.1 PDB: 2ev0_A 1on1_A 2ev5_A 2ev6_A* 2f5c_A 2f5d_A 2f5e_A 2f5f_A 2hyf_A* 2hyg_D 3r60_A* 3r61_A* Back     alignment and structure
>1sfu_A 34L protein; protein/Z-DNA complex, DNA binding protein/DNA complex; 2.00A {Yaba-like disease virus} SCOP: a.4.5.19 Back     alignment and structure
>2a61_A Transcriptional regulator TM0710; APC4350, MCSG, midwest center for structural genomics, PSI, protein structure initiative, MARR; 1.80A {Thermotoga maritima} SCOP: a.4.5.28 Back     alignment and structure
>4b8x_A SCO5413, possible MARR-transcriptional regulator; winged helix motif; HET: CME; 1.25A {Streptomyces coelicolor} Back     alignment and structure
>1y7y_A C.AHDI; helix-turn-helix, DNA-binding protein, transcriptional regulator, transcription regulator; 1.69A {Aeromonas hydrophila} SCOP: a.35.1.3 Back     alignment and structure
>2r1j_L Repressor protein C2; protein-DNA complex, helix-turn-helix, DNA-binding, transcription, transcription regulation; 1.53A {Enterobacteria phage P22} SCOP: a.35.1.2 PDB: 3jxb_C 3jxc_L 3jxd_L Back     alignment and structure
>3f6w_A XRE-family like protein; helix-turn-helix, DNA binding protein, xenobiotic response E family of transcriptional regulators; HET: MSE BTB; 1.85A {Pseudomonas syringae PV} Back     alignment and structure
>2b5a_A C.BCLI; helix-turn-helix motif, gene regulation; 1.54A {Bacillus caldolyticus} SCOP: a.35.1.3 Back     alignment and structure
>3f3x_A Transcriptional regulator, MARR family, putative; DNA binding protein, DNA-binding, transcription regulation; 1.90A {Sulfolobus solfataricus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 485
d1ku2a2180 a.177.1.1 (A:93-272) Sigma factor SigA {Thermus aq 6e-24
d1siga_334 a.177.1.1 (A:) Sigma70 {Escherichia coli [TaxId: 5 2e-22
d1ttya_87 a.4.13.2 (A:) Sigma70 (SigA, RpoD) {Thermotoga mar 2e-15
d2p7vb168 a.4.13.2 (B:546-613) Sigma70 (SigA, RpoD) {Escheri 2e-14
d1rp3a387 a.177.1.1 (A:0-86) Sigma factor sigma-28 (FliA) {A 3e-14
d1ku3a_61 a.4.13.2 (A:) Sigma70 (SigA, RpoD) {Thermus aquati 8e-13
d1rp3a271 a.4.13.2 (A:164-234) Sigma factor sigma-28 (FliA) 2e-06
d1l0oc_57 a.4.13.2 (C:) SigmaF {Bacillus stearothermophilus 7e-05
>d1ku2a2 a.177.1.1 (A:93-272) Sigma factor SigA {Thermus aquaticus [TaxId: 271]} Length = 180 Back     information, alignment and structure

class: All alpha proteins
fold: Sigma2 domain of RNA polymerase sigma factors
superfamily: Sigma2 domain of RNA polymerase sigma factors
family: Sigma2 domain of RNA polymerase sigma factors
domain: Sigma factor SigA
species: Thermus aquaticus [TaxId: 271]
 Score = 96.4 bits (239), Expect = 6e-24
 Identities = 53/177 (29%), Positives = 87/177 (49%), Gaps = 30/177 (16%)

Query: 193 LKGYVKGVVSEELLTHAEVVRLSKKIKTGLSLDDH------------------KLRLKER 234
           ++ Y+  +    LLT  E + L++K++ G+                       K+    R
Sbjct: 4   VRQYLHEIGQVPLLTLEEEIDLARKVEEGMEAIKKLSEATGLDQELIREVVRAKILGTAR 63

Query: 235 LGCEPS---------MEQLAASLRISRPELQ---SILMECSLAREKLVMSNVRLVMSIAQ 282
           +   P          +E++   L+    EL+    I  E   AR+ L+ +N+RLV+SIA+
Sbjct: 64  IQKIPGLKEKPDPKTVEEVDGKLKSLPKELKRYLHIAREGEAARQHLIEANLRLVVSIAK 123

Query: 283 RYDNMGADMADLVQGGLIGLLRGIEKFDSSKGFKISTYVYWWIRQGVSRALVENSRT 339
           +Y   G    DL+Q G  GL+R +EKF+  + FK STY  WWIRQ ++RA+ + +RT
Sbjct: 124 KYTGRGLSFLDLIQEGNQGLIRAVEKFEYKRRFKFSTYATWWIRQAINRAIADQART 180


>d1siga_ a.177.1.1 (A:) Sigma70 {Escherichia coli [TaxId: 562]} Length = 334 Back     information, alignment and structure
>d1ttya_ a.4.13.2 (A:) Sigma70 (SigA, RpoD) {Thermotoga maritima [TaxId: 2336]} Length = 87 Back     information, alignment and structure
>d2p7vb1 a.4.13.2 (B:546-613) Sigma70 (SigA, RpoD) {Escherichia coli [TaxId: 562]} Length = 68 Back     information, alignment and structure
>d1rp3a3 a.177.1.1 (A:0-86) Sigma factor sigma-28 (FliA) {Aquifex aeolicus [TaxId: 63363]} Length = 87 Back     information, alignment and structure
>d1ku3a_ a.4.13.2 (A:) Sigma70 (SigA, RpoD) {Thermus aquaticus [TaxId: 271]} Length = 61 Back     information, alignment and structure
>d1rp3a2 a.4.13.2 (A:164-234) Sigma factor sigma-28 (FliA) {Aquifex aeolicus [TaxId: 63363]} Length = 71 Back     information, alignment and structure
>d1l0oc_ a.4.13.2 (C:) SigmaF {Bacillus stearothermophilus [TaxId: 1422]} Length = 57 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query485
d1ku2a2180 Sigma factor SigA {Thermus aquaticus [TaxId: 271]} 99.94
d1siga_334 Sigma70 {Escherichia coli [TaxId: 562]} 99.76
d1rp3a387 Sigma factor sigma-28 (FliA) {Aquifex aeolicus [Ta 99.7
d2p7vb168 Sigma70 (SigA, RpoD) {Escherichia coli [TaxId: 562 99.41
d1rp3a271 Sigma factor sigma-28 (FliA) {Aquifex aeolicus [Ta 99.39
d1ttya_87 Sigma70 (SigA, RpoD) {Thermotoga maritima [TaxId: 99.39
d1ku3a_61 Sigma70 (SigA, RpoD) {Thermus aquaticus [TaxId: 27 99.33
d1or7a2113 SigmaE factor (RpoE) {Escherichia coli [TaxId: 562 99.3
d1or7a168 SigmaE factor (RpoE) {Escherichia coli [TaxId: 562 99.24
d1xsva_106 Hypothetical protein SAV1236 {Staphylococcus aureu 98.92
d1s7oa_106 Hypothetical protein SPy1201 {Streptococcus pyogen 98.9
d1h3la_75 Sigma factor SigR {Streptomyces coelicolor a3(2) [ 98.82
d1yioa170 Response regulatory protein StyR, C-terminal domai 98.39
d1a04a167 Nitrate/nitrite response regulator (NarL) {Escheri 98.2
d1l3la165 Quorum-sensing transcription factor TraR, C-termin 98.07
d1l0oc_57 SigmaF {Bacillus stearothermophilus [TaxId: 1422]} 98.03
d1fsea_67 Germination protein GerE {Bacillus subtilis [TaxId 98.02
d1p4wa_87 Transcriptional regulator RcsB {Erwinia amylovora 97.75
d1ku2a160 Sigma factor SigA {Thermus aquaticus [TaxId: 271]} 97.54
d1rp3a177 Sigma factor sigma-28 (FliA) {Aquifex aeolicus [Ta 96.54
d1ijwc_47 HIN recombinase (DNA-binding domain) {Synthetic} 95.45
d1l0oc_57 SigmaF {Bacillus stearothermophilus [TaxId: 1422]} 95.02
d1jhfa171 LexA repressor, N-terminal DNA-binding domain {Esc 94.52
d1rp3a177 Sigma factor sigma-28 (FliA) {Aquifex aeolicus [Ta 94.39
d1gdta143 gamma,delta resolvase (C-terminal domain) {Escheri 93.99
d2cfxa163 Transcriptional regulator LrpC {Bacillus subtilis 93.21
d2cg4a163 Regulatory protein AsnC {Escherichia coli [TaxId: 93.19
d1i1ga160 LprA {Archaeon Pyrococcus furiosus [TaxId: 2261]} 92.49
d1hlva166 DNA-binding domain of centromere binding protein B 92.18
d2cyya160 Putative transcriptional regulator PH1519 {Archaeo 91.68
d1k78a163 Pax-5 {Human (Homo sapiens) [TaxId: 9606]} 91.44
d1pdnc_123 Paired protein (prd) {Fruit fly (Drosophila melano 91.0
d2jn6a189 Uncharacterized protein Cgl2762 {Corynebacterium g 90.91
d2o3fa183 Putative transcriptional regulator YbbH {Bacillus 89.45
d1ku2a160 Sigma factor SigA {Thermus aquaticus [TaxId: 271]} 89.39
d1biaa163 Biotin repressor, N-terminal domain {Escherichia c 89.35
d1yz8p160 Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 88.85
d2ppxa162 Uncharacterized protein Atu1735 {Agrobacterium tum 88.8
d1uxda_59 Fructose repressor (FruR), N-terminal domain {Esch 88.08
d2d1ha1109 Hypothetical transcriptional regulator ST1889 {Sul 87.63
d2auwa167 Hypothetical protein NE0471 C-terminal domain {Nit 86.68
d1le8a_53 Mating type protein A1 Homeodomain {Baker's yeast 86.63
d1r1ua_94 Metal-sensing transcriptional repressor CzrA {Stap 86.55
d1ft9a180 CO-sensing protein CooA, C-terminal domain {Rhodos 86.37
d2isya163 Iron-dependent regulator IdeR {Mycobacterium tuber 86.31
d1ku9a_151 DNA-binding protein Mj223 {Archaeon Methanococcus 86.3
d1jhga_101 Trp repressor, TrpR {Escherichia coli [TaxId: 562] 86.04
d1stza187 Heat-inducible transcription repressor HrcA, N-ter 85.88
d1x2na162 Homeobox protein pknox1 {Human (Homo sapiens) [Tax 85.8
d1fjla_65 Paired protein {Fruit fly (Drosophila melanogaster 85.71
d1ig7a_58 Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10 85.68
d2a6ca169 HTH-motif protein NE1354 {Nitrosomonas europaea [T 85.63
d2ecca176 Homeobox-leucine zipper protein Homez {Human (Homo 85.55
d1utxa_66 Putative transcription regulator CylR2 {Enterococc 85.43
d3broa1135 Transcriptional regulator OEOE1854 {Oenococcus oen 85.28
d1z05a171 Transcriptional regulator VC2007 N-terminal domain 84.98
d1r1ta_98 SmtB repressor {Cyanobacteria (Synechococcus), pcc 84.98
d1zq3p167 Homeotic bicoid protein {Fruit fly (Drosophila mel 84.74
d2o38a189 Hypothetical protein RPA3824 {Rhodopseudomonas pal 84.58
d1qpza157 Purine repressor (PurR), N-terminal domain {Escher 84.29
d1j5ya165 Putative transcriptional regulator TM1602, N-termi 84.08
d1nr3a_122 DNA-binding protein Tfx {Archaeon Methanobacterium 84.06
d1dpua_69 C-terminal domain of RPA32 {Human (Homo sapiens) [ 84.01
d1zyba173 Probable transcription regulator BT4300, C-termina 83.76
d1i5za169 Catabolite gene activator protein (CAP), C-termina 83.76
d2croa_65 cro 434 {Bacteriophage 434 [TaxId: 10712]} 83.59
d1vz0a193 Putative partitioning protein ParB/Spo0J {Thermus 83.55
d1r71a_114 Transcriptional repressor protein KorB DNA-binding 83.47
d1y7ya169 Restriction-modification controller protein C.AhdI 83.38
d1r69a_63 434 C1 repressor, DNA-binding domain {Bacteriophag 83.31
d1au7a158 Pit-1 POU homeodomain {Rat (Rattus norvegicus) [Ta 83.22
d1ulya_ 190 Hypothetical protein PH1932 {Pyrococcus horikoshii 83.16
d1e3oc157 Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId 82.93
d2cuea168 Paired box protein pax6 {Human (Homo sapiens) [Tax 82.82
d1jgga_57 Even-skipped homeodomain {Fruit fly (Drosophila me 81.33
d1ub9a_100 Hypothetical protein PH1061 {Archaeon Pyrococcus h 81.25
d3e5ua180 Chlorophenol reduction protein CprK {Desulfitobact 80.96
d1uhsa_72 Homeodomain-only protein, Hop {Mouse (Mus musculus 80.95
d1x57a178 Endothelial differentiation-related factor 1, EDF1 80.78
d1sfxa_109 Hypothetical protein AF2008 {Archaeoglobus fulgidu 80.76
d2hsga157 Glucose-resistance amylase regulator CcpA, N-termi 80.72
d9anta_56 Antennapedia Homeodomain {Drosophila melanogaster 80.48
d1pb6a172 Hypothetical transcriptional regulator YcdC {Esche 80.2
d2e1oa157 Homeobox protein prh {Human (Homo sapiens) [TaxId: 80.19
d1b0na268 SinR repressor, DNA-binding domain {Bacillus subti 80.06
>d1ku2a2 a.177.1.1 (A:93-272) Sigma factor SigA {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
class: All alpha proteins
fold: Sigma2 domain of RNA polymerase sigma factors
superfamily: Sigma2 domain of RNA polymerase sigma factors
family: Sigma2 domain of RNA polymerase sigma factors
domain: Sigma factor SigA
species: Thermus aquaticus [TaxId: 271]
Probab=99.94  E-value=3.7e-28  Score=224.99  Aligned_cols=148  Identities=33%  Similarity=0.581  Sum_probs=121.0

Q ss_pred             hhHHHHHHhhccccCCCHHHHHHHHHHHHcCCcchhHHHHHHh------------------hhCCCCc---------hHH
Q 011454          191 NRLKGYVKGVVSEELLTHAEVVRLSKKIKTGLSLDDHKLRLKE------------------RLGCEPS---------MEQ  243 (485)
Q Consensus       191 ~~~~~yl~~i~~~~~Lt~eee~~L~~~ik~Gd~l~~~~~~l~~------------------~~g~~p~---------~~~  243 (485)
                      |.++.||++|+++|+||++||++|+++|+.|..+.+.......                  ..++.|.         ..+
T Consensus         2 DpVr~YLreig~v~LLT~EEEieLAr~Ie~g~~~~~~~~e~~~~~~~l~~e~~~~~~~~~~~~~~~~~~~e~~~~~~~~~   81 (180)
T d1ku2a2           2 DPVRQYLHEIGQVPLLTLEEEIDLARKVEEGMEAIKKLSEATGLDQELIREVVRAKILGTARIQKIPGLKEKPDPKTVEE   81 (180)
T ss_dssp             HHHHHHHHHHTTSCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHTTCSSCCCTTSCCSSCTTTHHH
T ss_pred             CcHHHHHHHhcCcCCCCHHHHHHHHHHHHHHHHHHHHHHHhhhccHHHHHHHHHHHhhhHHHHhcchhhHHHhhHHHHHH
Confidence            5789999999999999999999999999988764433222210                  1222222         233


Q ss_pred             HHHHhhcC---hhHHHHhhhhhHHHHHHHHHHhHHHHHHHHHHhcCCCCcHHHHHHHHHHHHHHhHhcCCCCCCcchhhH
Q 011454          244 LAASLRIS---RPELQSILMECSLAREKLVMSNVRLVMSIAQRYDNMGADMADLVQGGLIGLLRGIEKFDSSKGFKISTY  320 (485)
Q Consensus       244 ~a~~~~~s---~~~L~~~l~~~~~A~e~Lie~yl~LV~sIA~ry~~~~~d~EDLiQEG~IgL~kAiekFDp~rG~rFsTY  320 (485)
                      +.......   ..++.+....+..|+++||+.|+++|+++|++|.+.+.+++||+|||+|||++|+++|||++|++|+||
T Consensus        82 ~~~~~~~~~~el~~l~~~~~~~~~a~~~li~~~~~lv~~~a~~~~~~~~~~~dl~q~g~~gl~~a~~~fd~~~g~~f~ty  161 (180)
T d1ku2a2          82 VDGKLKSLPKELKRYLHIAREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGLIRAVEKFEYKRRFKFSTY  161 (180)
T ss_dssp             HHHHHHSCCHHHHHHHHHHHHHHHHHHHHHHTTHHHHHHHHHTTCSSSSCHHHHHHHHHHHHHHHHHHCCGGGCSCHHHH
T ss_pred             HHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcccCCCcCHHHHHHHHHHHHHHHHHHcCCCCCCCHHHH
Confidence            33333333   345566777899999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHhhh
Q 011454          321 VYWWIRQGVSRALVENSR  338 (485)
Q Consensus       321 A~~~Ir~~I~~~I~~~~r  338 (485)
                      |+|||+++|.++|+++.|
T Consensus       162 a~~~i~~~i~~~~~~~~r  179 (180)
T d1ku2a2         162 ATWWIRQAINRAIADQAR  179 (180)
T ss_dssp             HHHHHHHHHHHHHTTSCC
T ss_pred             HHHHHHHHHHHHHHHhCC
Confidence            999999999999998875



>d1siga_ a.177.1.1 (A:) Sigma70 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rp3a3 a.177.1.1 (A:0-86) Sigma factor sigma-28 (FliA) {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2p7vb1 a.4.13.2 (B:546-613) Sigma70 (SigA, RpoD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rp3a2 a.4.13.2 (A:164-234) Sigma factor sigma-28 (FliA) {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ttya_ a.4.13.2 (A:) Sigma70 (SigA, RpoD) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ku3a_ a.4.13.2 (A:) Sigma70 (SigA, RpoD) {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1or7a1 a.4.13.2 (A:120-187) SigmaE factor (RpoE) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xsva_ a.4.13.3 (A:) Hypothetical protein SAV1236 {Staphylococcus aureus, strain Mu50 / ATCC 700699 [TaxId: 1280]} Back     information, alignment and structure
>d1s7oa_ a.4.13.3 (A:) Hypothetical protein SPy1201 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1h3la_ a.177.1.1 (A:) Sigma factor SigR {Streptomyces coelicolor a3(2) [TaxId: 100226]} Back     information, alignment and structure
>d1yioa1 a.4.6.2 (A:131-200) Response regulatory protein StyR, C-terminal domain {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1a04a1 a.4.6.2 (A:150-216) Nitrate/nitrite response regulator (NarL) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l3la1 a.4.6.2 (A:170-234) Quorum-sensing transcription factor TraR, C-terminal domain {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1l0oc_ a.4.13.2 (C:) SigmaF {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1fsea_ a.4.6.2 (A:) Germination protein GerE {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1p4wa_ a.4.6.2 (A:) Transcriptional regulator RcsB {Erwinia amylovora [TaxId: 552]} Back     information, alignment and structure
>d1ku2a1 a.4.13.1 (A:273-332) Sigma factor SigA {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1rp3a1 a.4.13.1 (A:87-163) Sigma factor sigma-28 (FliA) {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ijwc_ a.4.1.2 (C:) HIN recombinase (DNA-binding domain) {Synthetic} Back     information, alignment and structure
>d1l0oc_ a.4.13.2 (C:) SigmaF {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1jhfa1 a.4.5.2 (A:2-72) LexA repressor, N-terminal DNA-binding domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rp3a1 a.4.13.1 (A:87-163) Sigma factor sigma-28 (FliA) {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1gdta1 a.4.1.2 (A:141-183) gamma,delta resolvase (C-terminal domain) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cfxa1 a.4.5.32 (A:1-63) Transcriptional regulator LrpC {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2cg4a1 a.4.5.32 (A:4-66) Regulatory protein AsnC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i1ga1 a.4.5.32 (A:2-61) LprA {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1hlva1 a.4.1.7 (A:1-66) DNA-binding domain of centromere binding protein B (CENP-B) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cyya1 a.4.5.32 (A:5-64) Putative transcriptional regulator PH1519 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1k78a1 a.4.1.5 (A:19-81) Pax-5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pdnc_ a.4.1.5 (C:) Paired protein (prd) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2jn6a1 a.4.1.19 (A:1-89) Uncharacterized protein Cgl2762 {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d2o3fa1 a.4.1.20 (A:1-83) Putative transcriptional regulator YbbH {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ku2a1 a.4.13.1 (A:273-332) Sigma factor SigA {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1biaa1 a.4.5.1 (A:1-63) Biotin repressor, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ppxa1 a.35.1.3 (A:30-91) Uncharacterized protein Atu1735 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1uxda_ a.35.1.5 (A:) Fructose repressor (FruR), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2d1ha1 a.4.5.50 (A:1-109) Hypothetical transcriptional regulator ST1889 {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d2auwa1 a.35.1.10 (A:88-154) Hypothetical protein NE0471 C-terminal domain {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r1ua_ a.4.5.5 (A:) Metal-sensing transcriptional repressor CzrA {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1ft9a1 a.4.5.4 (A:134-213) CO-sensing protein CooA, C-terminal domain {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d2isya1 a.4.5.24 (A:2-64) Iron-dependent regulator IdeR {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ku9a_ a.4.5.36 (A:) DNA-binding protein Mj223 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1jhga_ a.4.12.1 (A:) Trp repressor, TrpR {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1stza1 a.4.5.51 (A:14-100) Heat-inducible transcription repressor HrcA, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2a6ca1 a.35.1.13 (A:1-69) HTH-motif protein NE1354 {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1utxa_ a.35.1.3 (A:) Putative transcription regulator CylR2 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d3broa1 a.4.5.28 (A:3-137) Transcriptional regulator OEOE1854 {Oenococcus oeni [TaxId: 1247]} Back     information, alignment and structure
>d1z05a1 a.4.5.63 (A:10-80) Transcriptional regulator VC2007 N-terminal domain {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1r1ta_ a.4.5.5 (A:) SmtB repressor {Cyanobacteria (Synechococcus), pcc7942 [TaxId: 1129]} Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2o38a1 a.35.1.13 (A:28-116) Hypothetical protein RPA3824 {Rhodopseudomonas palustris [TaxId: 1076]} Back     information, alignment and structure
>d1qpza1 a.35.1.5 (A:2-58) Purine repressor (PurR), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j5ya1 a.4.5.1 (A:3-67) Putative transcriptional regulator TM1602, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nr3a_ d.236.1.1 (A:) DNA-binding protein Tfx {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1dpua_ a.4.5.16 (A:) C-terminal domain of RPA32 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zyba1 a.4.5.4 (A:148-220) Probable transcription regulator BT4300, C-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1i5za1 a.4.5.4 (A:138-206) Catabolite gene activator protein (CAP), C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2croa_ a.35.1.2 (A:) cro 434 {Bacteriophage 434 [TaxId: 10712]} Back     information, alignment and structure
>d1vz0a1 a.4.14.1 (A:116-208) Putative partitioning protein ParB/Spo0J {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r71a_ a.4.14.1 (A:) Transcriptional repressor protein KorB DNA-binding domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y7ya1 a.35.1.3 (A:5-73) Restriction-modification controller protein C.AhdI {Aeromonas hydrophila [TaxId: 644]} Back     information, alignment and structure
>d1r69a_ a.35.1.2 (A:) 434 C1 repressor, DNA-binding domain {Bacteriophage 434 [TaxId: 10712]} Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ulya_ a.4.5.58 (A:) Hypothetical protein PH1932 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ub9a_ a.4.5.28 (A:) Hypothetical protein PH1061 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d3e5ua1 a.4.5.4 (A:148-227) Chlorophenol reduction protein CprK {Desulfitobacterium hafniense [TaxId: 49338]} Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x57a1 a.35.1.12 (A:8-85) Endothelial differentiation-related factor 1, EDF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sfxa_ a.4.5.50 (A:) Hypothetical protein AF2008 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2hsga1 a.35.1.5 (A:2-58) Glucose-resistance amylase regulator CcpA, N-terminal domain {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1pb6a1 a.4.1.9 (A:14-85) Hypothetical transcriptional regulator YcdC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b0na2 a.35.1.3 (A:1-68) SinR repressor, DNA-binding domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure