Citrus Sinensis ID: 011525
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 484 | 2.2.26 [Sep-21-2011] | |||||||
| Q7Z569 | 592 | BRCA1-associated protein | yes | no | 0.811 | 0.663 | 0.335 | 3e-70 | |
| Q99MP8 | 591 | BRCA1-associated protein | yes | no | 0.880 | 0.720 | 0.322 | 2e-69 | |
| O13747 | 547 | RING finger protein ETP1 | yes | no | 0.822 | 0.727 | 0.336 | 1e-62 | |
| P38748 | 585 | RING finger protein ETP1 | yes | no | 0.842 | 0.697 | 0.318 | 3e-57 | |
| Q95QN6 | 590 | Uncharacterized RING fing | yes | no | 0.871 | 0.715 | 0.299 | 3e-57 | |
| Q0V9G5 | 652 | Ubiquitin carboxyl-termin | no | no | 0.119 | 0.088 | 0.431 | 9e-09 | |
| Q5XGZ2 | 690 | Ubiquitin carboxyl-termin | N/A | no | 0.119 | 0.084 | 0.431 | 1e-08 | |
| Q6NTR6 | 690 | Ubiquitin carboxyl-termin | N/A | no | 0.119 | 0.084 | 0.431 | 1e-08 | |
| Q9H0E7 | 712 | Ubiquitin carboxyl-termin | no | no | 0.175 | 0.119 | 0.367 | 2e-08 | |
| D2HBJ8 | 711 | Ubiquitin carboxyl-termin | no | no | 0.177 | 0.120 | 0.348 | 3e-08 |
| >sp|Q7Z569|BRAP_HUMAN BRCA1-associated protein OS=Homo sapiens GN=BRAP PE=1 SV=2 | Back alignment and function desciption |
|---|
Score = 266 bits (680), Expect = 3e-70, Method: Compositional matrix adjust.
Identities = 147/438 (33%), Positives = 238/438 (54%), Gaps = 45/438 (10%)
Query: 37 NPKFSERRGLVHLFRGTSQSYQQNPNSRSTCIFVVAVPNYLSSDEFVRFCGSHIDHVEEL 96
NP G++HL++ + + RS + ++ VP ++S + ++F + +E++
Sbjct: 132 NPSVEIVHGIMHLYKTNKMTSLKEDVRRSAMLCILTVPAAMTSHDLMKFVAPFNEVIEQM 191
Query: 97 IFIRNDAMEDRYSVLIKLVDQLTADEFYSNLNGKRFSPAEAEVCHMLFMLSVEYTELAEI 156
IR D+ ++Y VLIK Q AD FY NG++F+ E +VC ++++ E + +
Sbjct: 192 KIIR-DSTPNQYMVLIKFRAQADADSFYMTCNGRQFNSIEDDVCQLVYVERAEVLKSEDG 250
Query: 157 ASTPPAGFTELPTCPICLERLDPDTSGILSTICDHSFQCSCTAKWTVLSCQVCRFCHQQD 216
AS P TELP C +CLER+D +GIL+T+C+HSF C +W +C VCR+C +
Sbjct: 251 ASLPVMDLTELPKCTVCLERMDESVNGILTTLCNHSFHSQCLQRWDDTTCPVCRYCQTPE 310
Query: 217 --ERPTCSVCGTVENLWVCLICGFVGCGRYKEGHAVRHWKDTQHWYSLDLRTQQIWDYVG 274
E C CG ENLW+CLICG +GCGRY HA +H+++TQH Y++ L ++WDY G
Sbjct: 311 PVEENKCFECGVQENLWICLICGHIGCGRYVSRHAYKHFEETQHTYAMQLTNHRVWDYAG 370
Query: 275 DNYVHRLNQSKADGKLVEMNSPCMSHEAHCGTCECSEDSGISGALFNSKVEAIVDEYNRL 334
DNYVHRL SK DGK+V+ +E TC+ K++A+ EY+ L
Sbjct: 371 DNYVHRLVASKTDGKIVQ-------YECEGDTCQ------------EEKIDALQLEYSYL 411
Query: 335 LATQLETQRQYYESLL-------AEAKSKRESLIPETVEKA--VASKMQDIQNELD---- 381
L +QLE+QR Y+E+ + AE + ++ ET+EK + K+ D+ E
Sbjct: 412 LTSQLESQRIYWENKIVRIEKDTAEEINNMKTKFKETIEKCDNLEHKLNDLLKEKQSVER 471
Query: 382 ICEEAKKAVADVNSKLIKNQE----------IMRKKFKEIEEREITSLRLRDATILDLEE 431
C + VA + ++L + QE +++ K KE E + +D I +++E
Sbjct: 472 KCTQLNTKVAKLTNELKEEQEMNKCLRANQVLLQNKLKEEERVLKETCDQKDLQITEIQE 531
Query: 432 QIRDLTVYIEAQKTLTNM 449
Q+RD+ Y+E Q+ + ++
Sbjct: 532 QLRDVMFYLETQQKINHL 549
|
Negatively regulates MAP kinase activation by limiting the formation of Raf/MEK complexes probably by inactivation of the KSR1 scaffold protein. Also acts as a Ras responsive E3 ubiquitin ligase that, on activation of Ras, is modified by auto-polyubiquitination resulting in the release of inhibition of Raf/MEK complex formation. May also act as a cytoplasmic retention protein with a role in regulating nuclear transport. Homo sapiens (taxid: 9606) EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: - |
| >sp|Q99MP8|BRAP_MOUSE BRCA1-associated protein OS=Mus musculus GN=Brap PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|O13747|EPT1_SCHPO RING finger protein ETP1 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC16E8.13 PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|P38748|ETP1_YEAST RING finger protein ETP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ETP1 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q95QN6|YQOE_CAEEL Uncharacterized RING finger protein EEED8.16 OS=Caenorhabditis elegans GN=EEED8.16 PE=4 SV=1 | Back alignment and function description |
|---|
| >sp|Q0V9G5|UBP44_XENTR Ubiquitin carboxyl-terminal hydrolase 44 OS=Xenopus tropicalis GN=usp44 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q5XGZ2|UP44B_XENLA Ubiquitin carboxyl-terminal hydrolase 44-B OS=Xenopus laevis GN=usp44-b PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q6NTR6|UP44A_XENLA Ubiquitin carboxyl-terminal hydrolase 44-A OS=Xenopus laevis GN=usp44-a PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9H0E7|UBP44_HUMAN Ubiquitin carboxyl-terminal hydrolase 44 OS=Homo sapiens GN=USP44 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|D2HBJ8|UBP44_AILME Ubiquitin carboxyl-terminal hydrolase 44 OS=Ailuropoda melanoleuca GN=USP44 PE=3 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 484 | ||||||
| 255572491 | 477 | brca1-associated protein, putative [Rici | 0.985 | 1.0 | 0.735 | 0.0 | |
| 224144167 | 486 | predicted protein [Populus trichocarpa] | 0.995 | 0.991 | 0.727 | 0.0 | |
| 225445567 | 470 | PREDICTED: BRCA1-associated protein [Vit | 0.969 | 0.997 | 0.709 | 0.0 | |
| 449517888 | 487 | PREDICTED: BRCA1-associated protein-like | 0.995 | 0.989 | 0.670 | 0.0 | |
| 449443061 | 487 | PREDICTED: BRCA1-associated protein-like | 0.995 | 0.989 | 0.670 | 0.0 | |
| 356562985 | 470 | PREDICTED: BRCA1-associated protein-like | 0.966 | 0.995 | 0.660 | 0.0 | |
| 297827885 | 488 | zinc finger (ubiquitin-hydrolase) domain | 0.995 | 0.987 | 0.646 | 0.0 | |
| 356548484 | 484 | PREDICTED: BRCA1-associated protein-like | 0.995 | 0.995 | 0.666 | 0.0 | |
| 42569859 | 488 | zinc finger (ubiquitin-hydrolase) domain | 0.997 | 0.989 | 0.637 | 0.0 | |
| 2673908 | 506 | hypothetical protein [Arabidopsis thalia | 0.997 | 0.954 | 0.616 | 0.0 |
| >gi|255572491|ref|XP_002527180.1| brca1-associated protein, putative [Ricinus communis] gi|223533445|gb|EEF35193.1| brca1-associated protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 739 bits (1907), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 356/484 (73%), Positives = 403/484 (83%), Gaps = 7/484 (1%)
Query: 1 MFVLRVHSVDDNHPITIEEAGFCTVSSTATRSRANPNPKFSERRGLVHLFRGTSQSYQQN 60
MF+LRVHSVD +HP+T+E S + T + + NPK+SERRG+VHL R SQS N
Sbjct: 1 MFILRVHSVDTDHPLTLESTT--FSSVSTTTTTSQSNPKYSERRGVVHLHRSPSQSSLSN 58
Query: 61 PNSRSTCIFVVAVPNYLSSDEFVRFCGSHIDHVEELIFIRNDAMEDRYSVLIKLVDQLTA 120
PN R T +FVVAVPNYLS+D+F+RFC SH + V E++FIRND MEDRYSVLIKL +Q+TA
Sbjct: 59 PNCRPTSLFVVAVPNYLSADDFIRFCESHTEKVHEVLFIRNDGMEDRYSVLIKLNNQVTA 118
Query: 121 DEFYSNLNGKRFSPAEAEVCHMLFMLSVEYTELAEIASTPPAGFTELPTCPICLERLDPD 180
D FY + NGKRFSPAEAEVCH+LF +SVEYTE+AEIASTPP GFTELPTCPICLERLDPD
Sbjct: 119 DRFYESFNGKRFSPAEAEVCHILF-VSVEYTEVAEIASTPPVGFTELPTCPICLERLDPD 177
Query: 181 TSGILSTICDHSFQCSCTAKWTVLSCQVCRFCHQQDERPTCSVCGTVENLWVCLICGFVG 240
TSGILST+CDHSFQCSCT+KWT LSCQVCR C QQDE+P C+VCGTVENLWVCLICGF+G
Sbjct: 178 TSGILSTLCDHSFQCSCTSKWTYLSCQVCRLCQQQDEKPACAVCGTVENLWVCLICGFIG 237
Query: 241 CGRYKEGHAVRHWKDTQHWYSLDLRTQQIWDYVGDNYVHRLNQSKADGKLVEMNSPCMSH 300
CGRYKEGHA+RHW+DTQH Y LDLRTQQIWDYVGDNYVHRLNQSKAD KLV+MN S
Sbjct: 238 CGRYKEGHAMRHWQDTQHCYILDLRTQQIWDYVGDNYVHRLNQSKADAKLVDMN----SR 293
Query: 301 EAHCGTCECSEDSGISGALFNSKVEAIVDEYNRLLATQLETQRQYYESLLAEAKSKRESL 360
E CGTC CSEDSGISGALF+SKVE IVDEYN LLATQL+ QRQYYESL+ E K+KRES
Sbjct: 294 EGDCGTCGCSEDSGISGALFSSKVETIVDEYNHLLATQLKAQRQYYESLITEVKNKRESS 353
Query: 361 IPETVEKAVASKMQDIQNELDICEEAKKAVADVNSKLIKNQEIMRKKFKEIEEREITSLR 420
I E VEKAV S MQDIQN+L+ CE K AV DVN LIKNQ+I RKK KE+EERE++SLR
Sbjct: 354 ILEAVEKAVTSTMQDIQNKLERCEMEKDAVTDVNRNLIKNQDIWRKKVKEVEEREMSSLR 413
Query: 421 LRDATILDLEEQIRDLTVYIEAQKTLTNMTDSDGIKGGTVLPVSYQQSSPTNTRRHKKSS 480
RD ILDLEEQIRDLT+YIEAQKTL MTD++ I+GGT+LPV +QSSP N RRH K
Sbjct: 414 SRDERILDLEEQIRDLTIYIEAQKTLNKMTDTNDIQGGTLLPVPSKQSSPANNRRHSKPG 473
Query: 481 RRKN 484
RR+N
Sbjct: 474 RRRN 477
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224144167|ref|XP_002325207.1| predicted protein [Populus trichocarpa] gi|222866641|gb|EEF03772.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|225445567|ref|XP_002285333.1| PREDICTED: BRCA1-associated protein [Vitis vinifera] gi|297738981|emb|CBI28226.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449517888|ref|XP_004165976.1| PREDICTED: BRCA1-associated protein-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449443061|ref|XP_004139299.1| PREDICTED: BRCA1-associated protein-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356562985|ref|XP_003549748.1| PREDICTED: BRCA1-associated protein-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|297827885|ref|XP_002881825.1| zinc finger (ubiquitin-hydrolase) domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297327664|gb|EFH58084.1| zinc finger (ubiquitin-hydrolase) domain-containing protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|356548484|ref|XP_003542631.1| PREDICTED: BRCA1-associated protein-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|42569859|ref|NP_181746.2| zinc finger (ubiquitin-hydrolase) domain-containing protein [Arabidopsis thaliana] gi|312274868|gb|ADQ57814.1| BRIZ1 [Arabidopsis thaliana] gi|330254987|gb|AEC10081.1| zinc finger (ubiquitin-hydrolase) domain-containing protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|2673908|gb|AAB88642.1| hypothetical protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 484 | ||||||
| TAIR|locus:2060045 | 488 | BRIZ1 "AT2G42160" [Arabidopsis | 0.997 | 0.989 | 0.616 | 5.2e-168 | |
| TAIR|locus:2057469 | 479 | BRIZ2 "AT2G26000" [Arabidopsis | 0.915 | 0.924 | 0.443 | 2.5e-106 | |
| DICTYBASE|DDB_G0270200 | 687 | DDB_G0270200 "BRCA1-associated | 0.621 | 0.438 | 0.355 | 1.6e-71 | |
| UNIPROTKB|F1NJH4 | 556 | BRAP "Uncharacterized protein" | 0.917 | 0.798 | 0.309 | 6e-64 | |
| UNIPROTKB|F1NR06 | 585 | BRAP "Uncharacterized protein" | 0.917 | 0.758 | 0.309 | 6e-64 | |
| UNIPROTKB|F1PGI5 | 592 | BRAP "Uncharacterized protein" | 0.917 | 0.75 | 0.299 | 3.3e-63 | |
| ZFIN|ZDB-GENE-040718-168 | 578 | brap "BRCA1 associated protein | 0.834 | 0.698 | 0.318 | 2.3e-62 | |
| UNIPROTKB|A6H716 | 592 | BRAP "BRAP protein" [Bos tauru | 0.917 | 0.75 | 0.304 | 1.3e-61 | |
| UNIPROTKB|J3KNN7 | 562 | BRAP "BRCA1-associated protein | 0.917 | 0.790 | 0.297 | 5.5e-61 | |
| UNIPROTKB|Q7Z569 | 592 | BRAP "BRCA1-associated protein | 0.917 | 0.75 | 0.297 | 5.5e-61 |
| TAIR|locus:2060045 BRIZ1 "AT2G42160" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1634 (580.3 bits), Expect = 5.2e-168, P = 5.2e-168
Identities = 301/488 (61%), Positives = 375/488 (76%)
Query: 1 MFVLRVHSVDDNHPITIEE--AGFCTVSSTATR--SRANPNPKFSERRGLVHLFRGTSQS 56
MF+LRVHSVD PI++EE +GF S A P+ K ++R+GL+HL+R +S S
Sbjct: 1 MFILRVHSVDSERPISVEEEESGFTYASKRAQPPLKLIQPSLKLTDRKGLIHLYRKSSHS 60
Query: 57 YQQNPNSRSTCIFVVAVPNYLSSDEFVRFCGSHIDHVEELIFIRNDAMEDRYSVLIKLVD 116
NP+SRST +F+VAVPNYLSS +F+RFC S I V +++FIRND MEDRYSVLI D
Sbjct: 61 SLPNPSSRSTTLFIVAVPNYLSSLDFIRFCDSRISQVSDILFIRNDGMEDRYSVLITFSD 120
Query: 117 QLTADEFYSNLNGKRFSPAEAEVCHMLFMLSVEYTELAEIASTPPAGFTELPTCPICLER 176
Q AD FY+NLNGK+F+P+EAEVCH+L+++SVE+TE E+A+ P GFTELPTCPICLER
Sbjct: 121 QSEADGFYNNLNGKKFAPSEAEVCHILYVMSVEHTEFDEVAAEAPTGFTELPTCPICLER 180
Query: 177 LDPDTSGILSTICDHSFQCSCTAKWTVLSCQVCRFCHQQDERPTCSVCGTVENLWVCLIC 236
LDPDTSGI+ST+CDHSFQCSCT+KWT LSCQVCR C QQDE CS+CG EN+W CL+C
Sbjct: 181 LDPDTSGIVSTLCDHSFQCSCTSKWTYLSCQVCRLCQQQDEILNCSICGKTENVWACLVC 240
Query: 237 GFVGCGRYKEGHAVRHWKDTQHWYSLDLRTQQIWDYVGDNYVHRLNQSKADGKLVEMNSP 296
GFVGCGRYKEGH++RHWK+T H YSLDLRTQQIWDYVGD+YVHRLN SK DGK VEM++
Sbjct: 241 GFVGCGRYKEGHSIRHWKETHHCYSLDLRTQQIWDYVGDSYVHRLNHSKIDGKSVEMSTS 300
Query: 297 CMSHEAHCGTCECSEDSGISGALFNSKVEAIVDEYNRLLATQLETQRQYYESLLAEAKSK 356
C+SH+ CG CECSED+GISGA+FNSKV++IV EYN LLA+QL+ QRQYYESL+ EA+SK
Sbjct: 301 CLSHQGDCGLCECSEDTGISGAIFNSKVDSIVIEYNDLLASQLKGQRQYYESLIVEARSK 360
Query: 357 RESLIPETVEKAVASKMQDIQNELDICEEAKKAVADVNSKLIKNQXXXXXXXXXXXXXXX 416
+ES I E VE+ V + MQ++QN+++ CEE K + +VN+KLIK Q
Sbjct: 361 QESSIAEAVEQIVVNTMQELQNKIEKCEEEKSGITEVNTKLIKEQDTWRKKAKEIEEREA 420
Query: 417 TSLRLRDATILDLEEQIRDLTVYIEAQKTLTNMT-DSDGIKGGTVLPVSYQQSSPTNTRR 475
L +D I DL+EQIRD+TV+IEA+KTL M+ D+DGI+ GTVLPV ++ RR
Sbjct: 421 ALLGSKDEMITDLQEQIRDITVFIEAKKTLKKMSSDTDGIREGTVLPVPISPEPVSSVRR 480
Query: 476 HKKSSRRK 483
KKS+RRK
Sbjct: 481 QKKSNRRK 488
|
|
| TAIR|locus:2057469 BRIZ2 "AT2G26000" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0270200 DDB_G0270200 "BRCA1-associated protein" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NJH4 BRAP "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NR06 BRAP "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PGI5 BRAP "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040718-168 brap "BRCA1 associated protein" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A6H716 BRAP "BRAP protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J3KNN7 BRAP "BRCA1-associated protein" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q7Z569 BRAP "BRCA1-associated protein" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
No EC number assignment, probably not an enzyme!
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 484 | |||
| cd12437 | 82 | cd12437, RRM_BRAP2_like, RNA recognition motif in | 7e-29 | |
| pfam07576 | 110 | pfam07576, BRAP2, BRCA1-associated protein 2 | 5e-28 | |
| pfam02148 | 63 | pfam02148, zf-UBP, Zn-finger in ubiquitin-hydrolas | 1e-24 | |
| smart00290 | 50 | smart00290, ZnF_UBP, Ubiquitin Carboxyl-terminal H | 2e-20 | |
| cd12717 | 82 | cd12717, RRM_ETP1, RNA recognition motif in yeast | 1e-16 | |
| cd12718 | 84 | cd12718, RRM_BRAP2, RNA recognition motif in BRCA1 | 3e-16 | |
| COG5207 | 749 | COG5207, UBP14, Isopeptidase T [Posttranslational | 2e-08 | |
| COG3853 | 386 | COG3853, TelA, Uncharacterized protein involved in | 0.001 |
| >gnl|CDD|240883 cd12437, RRM_BRAP2_like, RNA recognition motif in BRCA1-associated protein (BRAP2) and similar proteins | Back alignment and domain information |
|---|
Score = 108 bits (272), Expect = 7e-29
Identities = 36/82 (43%), Positives = 55/82 (67%)
Query: 68 IFVVAVPNYLSSDEFVRFCGSHIDHVEELIFIRNDAMEDRYSVLIKLVDQLTADEFYSNL 127
+ ++AVP+Y++S + FCGS I + ++ +RN+ +RY VLIK Q AD FY++
Sbjct: 1 LCILAVPSYMTSADLCTFCGSFIQQISDMRILRNEGRGNRYMVLIKFRSQEDADSFYNDF 60
Query: 128 NGKRFSPAEAEVCHMLFMLSVE 149
NGK F+ E EVCH++F+ SVE
Sbjct: 61 NGKPFNSLEPEVCHLVFVKSVE 82
|
This subfamily corresponds to the RRM domain of BRAP2, also termed impedes mitogenic signal propagation (IMP), or ring finger protein 52, or renal carcinoma antigen NY-REN-63, a novel cytoplasmic protein interacting with the two functional nuclear localisation signal (NLS) motifs of BRCA1, a nuclear protein linked to breast cancer. It also binds to the SV40 large T antigen NLS motif and the bipartite NLS motif found in mitosin. BRAP2 may serve as a cytoplasmic retention protein and play a role in the regulation of nuclear protein transport. The family also includes RING finger protein ETP1 and its homologs found in fungi. ETP1, also termed BRAP2 homolog, or ethanol tolerance protein 1, is the yeast homolog of BRCA1-associated protein (BRAP2) found in vertebrates. It may be involved in ethanol and salt-induced transcriptional activation of the NHA1 promoter and heat shock protein genes (HSP12 and HSP26), and participate in ethanol-induced turnover of the low-affinity hexose transporter Hxt3p. Members in this family contain an N-terminal RNA recognition motif (RRM), also termed RBD (RNA binding domain) or RNP (ribonucleoprotein domain), followed by a C3HC4-type ring finger domain and a UBP-type zinc finger. . Length = 82 |
| >gnl|CDD|191791 pfam07576, BRAP2, BRCA1-associated protein 2 | Back alignment and domain information |
|---|
| >gnl|CDD|216903 pfam02148, zf-UBP, Zn-finger in ubiquitin-hydrolases and other protein | Back alignment and domain information |
|---|
| >gnl|CDD|197632 smart00290, ZnF_UBP, Ubiquitin Carboxyl-terminal Hydrolase-like zinc finger | Back alignment and domain information |
|---|
| >gnl|CDD|241161 cd12717, RRM_ETP1, RNA recognition motif in yeast RING finger protein ETP1 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241162 cd12718, RRM_BRAP2, RNA recognition motif in BRCA1-associated protein (BRAP2) | Back alignment and domain information |
|---|
| >gnl|CDD|227532 COG5207, UBP14, Isopeptidase T [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|226371 COG3853, TelA, Uncharacterized protein involved in tellurite resistance [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 484 | |||
| KOG0804 | 493 | consensus Cytoplasmic Zn-finger protein BRAP2 (BRC | 100.0 | |
| PF07576 | 110 | BRAP2: BRCA1-associated protein 2; InterPro: IPR01 | 99.97 | |
| PF02148 | 63 | zf-UBP: Zn-finger in ubiquitin-hydrolases and othe | 99.63 | |
| KOG0944 | 763 | consensus Ubiquitin-specific protease UBP14 [Postt | 99.34 | |
| KOG0804 | 493 | consensus Cytoplasmic Zn-finger protein BRAP2 (BRC | 99.3 | |
| COG5207 | 749 | UBP14 Isopeptidase T [Posttranslational modificati | 99.22 | |
| smart00290 | 50 | ZnF_UBP Ubiquitin Carboxyl-terminal Hydrolase-like | 99.09 | |
| cd02669 | 440 | Peptidase_C19M A subfamily of Peptidase C19. Pepti | 98.89 | |
| KOG1873 | 877 | consensus Ubiquitin-specific protease [Posttransla | 98.78 | |
| PF13639 | 44 | zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C | 98.62 | |
| PF15227 | 42 | zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: | 98.43 | |
| KOG4628 | 348 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.24 | |
| PLN03208 | 193 | E3 ubiquitin-protein ligase RMA2; Provisional | 98.21 | |
| PHA02929 | 238 | N1R/p28-like protein; Provisional | 98.2 | |
| PF12678 | 73 | zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 | 98.16 | |
| PF13923 | 39 | zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); | 97.96 | |
| KOG0823 | 230 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.9 | |
| PF13920 | 50 | zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); | 97.86 | |
| TIGR00599 | 397 | rad18 DNA repair protein rad18. This family is bas | 97.85 | |
| PF14634 | 44 | zf-RING_5: zinc-RING finger domain | 97.85 | |
| PHA02926 | 242 | zinc finger-like protein; Provisional | 97.83 | |
| KOG0317 | 293 | consensus Predicted E3 ubiquitin ligase, integral | 97.82 | |
| PF00097 | 41 | zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I | 97.79 | |
| cd00162 | 45 | RING RING-finger (Really Interesting New Gene) dom | 97.77 | |
| COG5540 | 374 | RING-finger-containing ubiquitin ligase [Posttrans | 97.77 | |
| KOG2177 | 386 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.65 | |
| KOG0320 | 187 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.64 | |
| smart00504 | 63 | Ubox Modified RING finger domain. Modified RING fi | 97.62 | |
| smart00184 | 39 | RING Ring finger. E3 ubiquitin-protein ligase acti | 97.61 | |
| PF14835 | 65 | zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM | 97.54 | |
| TIGR00570 | 309 | cdk7 CDK-activating kinase assembly factor MAT1. A | 97.53 | |
| PF13445 | 43 | zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. | 97.41 | |
| PF12861 | 85 | zf-Apc11: Anaphase-promoting complex subunit 11 RI | 97.23 | |
| KOG0825 | 1134 | consensus PHD Zn-finger protein [General function | 97.23 | |
| KOG2164 | 513 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.17 | |
| COG5432 | 391 | RAD18 RING-finger-containing E3 ubiquitin ligase [ | 97.11 | |
| PF14259 | 70 | RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or | 97.08 | |
| COG5574 | 271 | PEX10 RING-finger-containing E3 ubiquitin ligase [ | 96.99 | |
| KOG0287 | 442 | consensus Postreplication repair protein RAD18 [Re | 96.98 | |
| KOG0802 | 543 | consensus E3 ubiquitin ligase [Posttranslational m | 96.91 | |
| COG5243 | 491 | HRD1 HRD ubiquitin ligase complex, ER membrane com | 96.73 | |
| PF00076 | 70 | RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or | 96.64 | |
| PF04564 | 73 | U-box: U-box domain; InterPro: IPR003613 Quality c | 96.58 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 96.39 | |
| cd00590 | 74 | RRM RRM (RNA recognition motif), also known as RBD | 96.3 | |
| KOG0978 | 698 | consensus E3 ubiquitin ligase involved in syntaxin | 96.13 | |
| KOG1734 | 328 | consensus Predicted RING-containing E3 ubiquitin l | 96.03 | |
| smart00362 | 72 | RRM_2 RNA recognition motif. | 95.82 | |
| KOG0828 | 636 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.76 | |
| KOG0824 | 324 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.75 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 95.57 | |
| COG5194 | 88 | APC11 Component of SCF ubiquitin ligase and anapha | 95.5 | |
| smart00744 | 49 | RINGv The RING-variant domain is a C4HC3 zinc-fing | 95.43 | |
| COG5219 | 1525 | Uncharacterized conserved protein, contains RING Z | 95.19 | |
| KOG0827 | 465 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.12 | |
| PF04059 | 97 | RRM_2: RNA recognition motif 2; InterPro: IPR00720 | 95.09 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 95.08 | |
| KOG1039 | 344 | consensus Predicted E3 ubiquitin ligase [Posttrans | 94.93 | |
| smart00360 | 71 | RRM RNA recognition motif. | 94.76 | |
| KOG0311 | 381 | consensus Predicted E3 ubiquitin ligase [Posttrans | 94.67 | |
| PF11793 | 70 | FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. | 94.53 | |
| PF12325 | 120 | TMF_TATA_bd: TATA element modulatory factor 1 TATA | 94.26 | |
| KOG0297 | 391 | consensus TNF receptor-associated factor [Signal t | 94.24 | |
| PF06785 | 401 | UPF0242: Uncharacterised protein family (UPF0242); | 93.39 | |
| PF07926 | 132 | TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: | 93.24 | |
| PF11789 | 57 | zf-Nse: Zinc-finger of the MIZ type in Nse subunit | 93.24 | |
| PLN03134 | 144 | glycine-rich RNA-binding protein 4; Provisional | 93.04 | |
| PF07227 | 446 | DUF1423: Protein of unknown function (DUF1423); In | 92.89 | |
| KOG4159 | 398 | consensus Predicted E3 ubiquitin ligase [Posttrans | 92.57 | |
| KOG1645 | 463 | consensus RING-finger-containing E3 ubiquitin liga | 92.32 | |
| KOG0971 | 1243 | consensus Microtubule-associated protein dynactin | 92.1 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 92.02 | |
| KOG1493 | 84 | consensus Anaphase-promoting complex (APC), subuni | 91.82 | |
| KOG0161 | 1930 | consensus Myosin class II heavy chain [Cytoskeleto | 91.78 | |
| KOG0982 | 502 | consensus Centrosomal protein Nuf [Cell cycle cont | 91.29 | |
| PF05883 | 134 | Baculo_RING: Baculovirus U-box/Ring-like domain; I | 91.21 | |
| PF10168 | 717 | Nup88: Nuclear pore component; InterPro: IPR019321 | 91.1 | |
| PRK09039 | 343 | hypothetical protein; Validated | 90.94 | |
| PF11559 | 151 | ADIP: Afadin- and alpha -actinin-Binding; InterPro | 90.89 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 90.86 | |
| KOG4739 | 233 | consensus Uncharacterized protein involved in syna | 90.85 | |
| KOG2879 | 298 | consensus Predicted E3 ubiquitin ligase [Posttrans | 90.8 | |
| PF06005 | 72 | DUF904: Protein of unknown function (DUF904); Inte | 90.75 | |
| COG5152 | 259 | Uncharacterized conserved protein, contains RING a | 90.73 | |
| PF10212 | 518 | TTKRSYEDQ: Predicted coiled-coil domain-containing | 90.67 | |
| PF10367 | 109 | Vps39_2: Vacuolar sorting protein 39 domain 2; Int | 90.63 | |
| PF12718 | 143 | Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 | 90.6 | |
| PF10211 | 189 | Ax_dynein_light: Axonemal dynein light chain; Inte | 90.25 | |
| KOG0971 | 1243 | consensus Microtubule-associated protein dynactin | 90.24 | |
| TIGR03825 | 255 | FliH_bacil flagellar assembly protein FliH. This b | 90.13 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 90.04 | |
| TIGR02449 | 65 | conserved hypothetical protein TIGR02449. Members | 89.98 | |
| KOG4445 | 368 | consensus Uncharacterized conserved protein, conta | 89.78 | |
| KOG4367 | 699 | consensus Predicted Zn-finger protein [Function un | 89.7 | |
| KOG1941 | 518 | consensus Acetylcholine receptor-associated protei | 89.63 | |
| KOG0977 | 546 | consensus Nuclear envelope protein lamin, intermed | 89.37 | |
| KOG0250 | 1074 | consensus DNA repair protein RAD18 (SMC family pro | 89.37 | |
| PRK00409 | 782 | recombination and DNA strand exchange inhibitor pr | 89.35 | |
| PF14662 | 193 | CCDC155: Coiled-coil region of CCDC155 | 89.21 | |
| TIGR03752 | 472 | conj_TIGR03752 integrating conjugative element pro | 89.15 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 88.77 | |
| PF07798 | 177 | DUF1640: Protein of unknown function (DUF1640); In | 88.67 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 88.65 | |
| PF12718 | 143 | Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 | 88.38 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 88.22 | |
| PF09731 | 582 | Mitofilin: Mitochondrial inner membrane protein; I | 88.22 | |
| PRK09343 | 121 | prefoldin subunit beta; Provisional | 88.03 | |
| KOG1655 | 218 | consensus Protein involved in vacuolar protein sor | 88.0 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 87.92 | |
| KOG4848 | 225 | consensus Extracellular matrix-associated peroxida | 87.84 | |
| KOG2114 | 933 | consensus Vacuolar assembly/sorting protein PEP5/V | 87.82 | |
| PF10473 | 140 | CENP-F_leu_zip: Leucine-rich repeats of kinetochor | 87.71 | |
| PRK12704 | 520 | phosphodiesterase; Provisional | 87.62 | |
| KOG1103 | 561 | consensus Predicted coiled-coil protein [Function | 87.42 | |
| KOG2660 | 331 | consensus Locus-specific chromosome binding protei | 87.09 | |
| KOG3759 | 621 | consensus Uncharacterized RUN domain protein [Sign | 87.05 | |
| PF13851 | 201 | GAS: Growth-arrest specific micro-tubule binding | 86.97 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 86.89 | |
| KOG1813 | 313 | consensus Predicted E3 ubiquitin ligase [Posttrans | 86.87 | |
| TIGR01069 | 771 | mutS2 MutS2 family protein. Function of MutS2 is u | 86.83 | |
| KOG1940 | 276 | consensus Zn-finger protein [General function pred | 86.81 | |
| PF14570 | 48 | zf-RING_4: RING/Ubox like zinc-binding domain; PDB | 86.78 | |
| COG5185 | 622 | HEC1 Protein involved in chromosome segregation, i | 86.74 | |
| KOG3002 | 299 | consensus Zn finger protein [General function pred | 86.49 | |
| PF10473 | 140 | CENP-F_leu_zip: Leucine-rich repeats of kinetochor | 86.39 | |
| PF15070 | 617 | GOLGA2L5: Putative golgin subfamily A member 2-lik | 86.28 | |
| PF11932 | 251 | DUF3450: Protein of unknown function (DUF3450); In | 86.23 | |
| PF05700 | 221 | BCAS2: Breast carcinoma amplified sequence 2 (BCAS | 86.1 | |
| COG3937 | 108 | Uncharacterized conserved protein [Function unknow | 86.05 | |
| KOG1785 | 563 | consensus Tyrosine kinase negative regulator CBL [ | 85.95 | |
| KOG3039 | 303 | consensus Uncharacterized conserved protein [Funct | 85.87 | |
| COG4026 | 290 | Uncharacterized protein containing TOPRIM domain, | 85.79 | |
| COG3074 | 79 | Uncharacterized protein conserved in bacteria [Fun | 85.79 | |
| PF04111 | 314 | APG6: Autophagy protein Apg6; InterPro: IPR007243 | 85.67 | |
| KOG0995 | 581 | consensus Centromere-associated protein HEC1 [Cell | 85.59 | |
| KOG0996 | 1293 | consensus Structural maintenance of chromosome pro | 85.51 | |
| KOG2930 | 114 | consensus SCF ubiquitin ligase, Rbx1 component [Po | 85.45 | |
| TIGR01659 | 346 | sex-lethal sex-lethal family splicing factor. This | 85.42 | |
| PRK10361 | 475 | DNA recombination protein RmuC; Provisional | 85.31 | |
| PF09731 | 582 | Mitofilin: Mitochondrial inner membrane protein; I | 85.27 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 85.27 | |
| KOG0964 | 1200 | consensus Structural maintenance of chromosome pro | 85.22 | |
| COG5222 | 427 | Uncharacterized conserved protein, contains RING Z | 85.15 | |
| KOG0579 | 1187 | consensus Ste20-like serine/threonine protein kina | 84.89 | |
| TIGR03319 | 514 | YmdA_YtgF conserved hypothetical protein YmdA/YtgF | 84.8 | |
| TIGR01661 | 352 | ELAV_HUD_SF ELAV/HuD family splicing factor. These | 84.64 | |
| PF02403 | 108 | Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal dom | 84.55 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 84.55 | |
| KOG4265 | 349 | consensus Predicted E3 ubiquitin ligase [Posttrans | 84.32 | |
| PRK09039 | 343 | hypothetical protein; Validated | 84.32 | |
| PRK10884 | 206 | SH3 domain-containing protein; Provisional | 84.25 | |
| KOG2932 | 389 | consensus E3 ubiquitin ligase involved in ubiquiti | 84.21 | |
| TIGR03007 | 498 | pepcterm_ChnLen polysaccharide chain length determ | 84.14 | |
| KOG3970 | 299 | consensus Predicted E3 ubiquitin ligase [Posttrans | 84.11 | |
| PF11180 | 192 | DUF2968: Protein of unknown function (DUF2968); In | 83.37 | |
| PF10046 | 99 | BLOC1_2: Biogenesis of lysosome-related organelles | 83.19 | |
| KOG1002 | 791 | consensus Nucleotide excision repair protein RAD16 | 83.18 | |
| KOG1962 | 216 | consensus B-cell receptor-associated protein and r | 83.09 | |
| KOG0288 | 459 | consensus WD40 repeat protein TipD [General functi | 83.07 | |
| PF05791 | 184 | Bacillus_HBL: Bacillus haemolytic enterotoxin (HBL | 82.99 | |
| PF04576 | 94 | Zein-binding: Zein-binding; InterPro: IPR007656 Th | 82.97 | |
| KOG4005 | 292 | consensus Transcription factor XBP-1 [Transcriptio | 82.86 | |
| PF11932 | 251 | DUF3450: Protein of unknown function (DUF3450); In | 82.81 | |
| PRK00106 | 535 | hypothetical protein; Provisional | 82.72 | |
| COG5175 | 480 | MOT2 Transcriptional repressor [Transcription] | 82.69 | |
| KOG1952 | 950 | consensus Transcription factor NF-X1, contains NFX | 82.53 | |
| PF10226 | 195 | DUF2216: Uncharacterized conserved proteins (DUF22 | 82.51 | |
| PF15233 | 134 | SYCE1: Synaptonemal complex central element protei | 82.4 | |
| KOG1571 | 355 | consensus Predicted E3 ubiquitin ligase [Posttrans | 82.27 | |
| TIGR01622 | 457 | SF-CC1 splicing factor, CC1-like family. A homolog | 82.26 | |
| PF15619 | 194 | Lebercilin: Ciliary protein causing Leber congenit | 82.18 | |
| KOG1029 | 1118 | consensus Endocytic adaptor protein intersectin [S | 81.93 | |
| PRK15422 | 79 | septal ring assembly protein ZapB; Provisional | 81.91 | |
| PRK10698 | 222 | phage shock protein PspA; Provisional | 81.86 | |
| PF06160 | 560 | EzrA: Septation ring formation regulator, EzrA ; I | 81.51 | |
| PF04641 | 260 | Rtf2: Rtf2 RING-finger | 81.48 | |
| TIGR01069 | 771 | mutS2 MutS2 family protein. Function of MutS2 is u | 81.47 | |
| TIGR01649 | 481 | hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor | 81.36 | |
| TIGR01622 | 457 | SF-CC1 splicing factor, CC1-like family. A homolog | 81.09 | |
| KOG4443 | 694 | consensus Putative transcription factor HALR/MLL3, | 81.07 | |
| PF07926 | 132 | TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: | 80.96 | |
| KOG4643 | 1195 | consensus Uncharacterized coiled-coil protein [Fun | 80.88 | |
| KOG2002 | 1018 | consensus TPR-containing nuclear phosphoprotein th | 80.84 | |
| smart00787 | 312 | Spc7 Spc7 kinetochore protein. This domain is foun | 80.8 | |
| PF11068 | 131 | YlqD: YlqD protein; InterPro: IPR021297 This bacte | 80.56 | |
| PF09738 | 302 | DUF2051: Double stranded RNA binding protein (DUF2 | 80.42 | |
| TIGR02338 | 110 | gimC_beta prefoldin, beta subunit, archaeal. Chape | 80.41 | |
| COG2433 | 652 | Uncharacterized conserved protein [Function unknow | 80.25 |
| >KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.6e-127 Score=977.63 Aligned_cols=460 Identities=47% Similarity=0.841 Sum_probs=405.0
Q ss_pred CceEEEee---cCCCCcccc-ccccceeecCCC---cccccCCCCceeeeeeeEEEccCCCCCcCCCCCCCCcEEEEecc
Q 011525 1 MFVLRVHS---VDDNHPITI-EEAGFCTVSSTA---TRSRANPNPKFSERRGLVHLFRGTSQSYQQNPNSRSTCIFVVAV 73 (484)
Q Consensus 1 ~~~~~~~~---~~~~~~~~~-~~~~~~~~~s~~---~~~~~~gnp~v~~~~g~~hl~r~~~~~~~~~~~~~~~~l~il~v 73 (484)
||+.++++ +++..+++. .+.-++...|.. ++.|+||||.|++|+|||||||.++.++++.+.. ++|||||||
T Consensus 4 v~~e~~~~~~~~~ssr~i~~r~~d~g~~~~s~~~~~~~~~~sgnp~ve~t~GiiHLyk~n~~~s~~~~~~-~~mLcilaV 82 (493)
T KOG0804|consen 4 VIIESLVSEPLVDSSREISGRSEDSGFTSASERLPSQIKYSSGNPSVEETHGIIHLYKKNSHSSLKNASS-STMLCILAV 82 (493)
T ss_pred chhhhcccCcccccccccCCcccccccchhhhccCCcccccCCCCceeeeceeEEEEecCcccccccCCC-CcEEEEEec
Confidence 45677887 899998888 444477877776 3359999999999999999999999888776643 999999999
Q ss_pred CCCCChhHHHHhhcccccceeEEEEEecCCCCcceEEEEEecChhcHHHHHhhhcCCcCCCCcccceeeEEEeEEEEeec
Q 011525 74 PNYLSSDEFVRFCGSHIDHVEELIFIRNDAMEDRYSVLIKLVDQLTADEFYSNLNGKRFSPAEAEVCHMLFMLSVEYTEL 153 (484)
Q Consensus 74 P~~~~~~d~l~F~~~~~~~i~~~riir~~~~pn~ymvLikF~~~~~A~~f~~~~ng~~F~sle~e~C~~v~v~~v~~~~~ 153 (484)
|+|||++|||+|+++++.+|++||||| |++||||||||||+++.+|+.||..|||++||++||++||++||.+|+|+.+
T Consensus 83 P~~mt~~Dll~F~~~~~~~I~~irivR-d~~pnrymvLIkFr~q~da~~Fy~efNGk~Fn~le~e~Chll~V~~ve~~~s 161 (493)
T KOG0804|consen 83 PAYMTSHDLLRFCASFIKQISDIRIVR-DGMPNRYMVLIKFRDQADADTFYEEFNGKQFNSLEPEVCHLLYVDRVEVTES 161 (493)
T ss_pred cccccHHHHHHHHHHHhhhhheeEEee-cCCCceEEEEEEeccchhHHHHHHHcCCCcCCCCCccceeEEEEEEEEEEec
Confidence 999999999999999999999999999 7899999999999999999999999999999999999999999999999999
Q ss_pred ccccCCCCCCCCCCCcCccccCCcCCCCCCceeecCCCccccccccccCCcccccccccccc--CCCCccCCCCCCCcee
Q 011525 154 AEIASTPPAGFTELPTCPICLERLDPDTSGILSTICDHSFQCSCTAKWTVLSCQVCRFCHQQ--DERPTCSVCGTVENLW 231 (484)
Q Consensus 154 ~~~~~~~~~~l~e~ptCpICLe~l~~~~~givt~~C~H~Fh~~Cl~~w~~~~CPvCR~~~~~--~~~~~C~~C~~~~nlW 231 (484)
.+++..++.+++|+|||||||||||++++||+++.|+|+||++|+.+|.+++||||||++.+ .+...|.+|+.++|||
T Consensus 162 ~d~as~~~~~~tELPTCpVCLERMD~s~~gi~t~~c~Hsfh~~cl~~w~~~scpvcR~~q~p~~ve~~~c~~c~~~~~Lw 241 (493)
T KOG0804|consen 162 EDGASEPPTGLTELPTCPVCLERMDSSTTGILTILCNHSFHCSCLMKWWDSSCPVCRYCQSPSVVESSLCLACGCTEDLW 241 (493)
T ss_pred ccCCCCCCCCcccCCCcchhHhhcCccccceeeeecccccchHHHhhcccCcChhhhhhcCcchhhhhhhhhhcccccEE
Confidence 99999999999999999999999999999999999999999999999999999999999862 1568899999999999
Q ss_pred eccccccccccCCCCCccccccCCCCCceeeeCCCceeEeeccchhhhhhhhccccCceeeccCCCCCcCCCCCCcccCC
Q 011525 232 VCLICGFVGCGRYKEGHAVRHWKDTQHWYSLDLRTQQIWDYVGDNYVHRLNQSKADGKLVEMNSPCMSHEAHCGTCECSE 311 (484)
Q Consensus 232 iCL~CG~vGCgr~~~~HA~~H~~~t~H~~~l~l~t~~Vwcy~cd~~Vhrl~q~k~dgklve~~~~~~~~~~~~~~~e~~~ 311 (484)
+||+||++|||||..|||++||++|+|+|+|+|+|+|||||+||+|||||+++++|||+|+....+.+..
T Consensus 242 icliCg~vgcgrY~eghA~rHweet~H~yalel~tqrVWDYAGDnYVhRl~~~~~dGklve~~~~~~~~~---------- 311 (493)
T KOG0804|consen 242 ICLICGNVGCGRYKEGHARRHWEETGHCYALELETQRVWDYAGDNYVHRLPQSKTDGKLVESSTEGDDSR---------- 311 (493)
T ss_pred EEEEccceecccccchhHHHHHHhhcceEEEeecceeeeecccchhhhhccccCCCCceEEecccccccc----------
Confidence 9999999999999999999999999999999999999999999999999999999999999987653321
Q ss_pred CCCccccchhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-------------------HHH-hhhcccHHHHHHHHHH
Q 011525 312 DSGISGALFNSKVEAIVDEYNRLLATQLETQRQYYESLLAE-------------------AKS-KRESLIPETVEKAVAS 371 (484)
Q Consensus 312 ~~~~~~~~~~~K~e~~~~EY~~LLtsQLEsQR~yyE~~l~~-------------------~~~-~~~~~~~~~~~~~~~~ 371 (484)
..+.+.+.++|+.||+||||+||.|||+.+.+ +.+ +.+....++.++.++.
T Consensus 312 ---------~~~~~~~~~~~s~ll~sqleSqr~y~e~~~~e~~qsqlen~k~~~e~~~~e~~~l~~~~~~~e~~kk~~e~ 382 (493)
T KOG0804|consen 312 ---------KDDCDSLELEYSPLLTSQLESQRKYYEQIMSEYEQSQLENQKQYYELLITEADSLKQESSDLEAEKKIVER 382 (493)
T ss_pred ---------ccCcceEEeecchhhhhhhhHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHhhhhhhhHHHHHHHHHHH
Confidence 12334444555555555555555555554444 433 3333344556667889
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHhHHHhhhhHHHhhccCC
Q 011525 372 KMQDIQNELDICEEAKKAVADVNSKLIKNQEIMRKKFKEIEEREITSLRLRDATILDLEEQIRDLTVYIEAQKTLTNMTD 451 (484)
Q Consensus 372 k~~~l~~~l~kl~~e~~~l~~ln~~L~~nq~~~~~~~~~~e~~~~~~~~~~~~~i~eL~EQvrDLmf~leaq~ki~~~~~ 451 (484)
++++++.+++++.+|+++++++|+.|++||..|+.+++++++++++++..+|++|+||+|||||||||||+|+||+ ++
T Consensus 383 k~~q~q~k~~k~~kel~~~~E~n~~l~knq~vw~~kl~~~~e~~~~~~~s~d~~I~dLqEQlrDlmf~le~qqklk--~d 460 (493)
T KOG0804|consen 383 KLQQLQTKLKKCQKELKEEREENKKLIKNQDVWRGKLKELEEREKEALGSKDEKITDLQEQLRDLMFFLEAQQKLK--SD 460 (493)
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHheehhhhhhhh--cc
Confidence 9999999999999999999999999999999999999999999999999999999999999999999999999998 34
Q ss_pred CCCccCcEEeecCCCCCCCCCccCCCCcCCCC
Q 011525 452 SDGIKGGTVLPVSYQQSSPTNTRRHKKSSRRK 483 (484)
Q Consensus 452 ~~ei~~G~v~~~~~~~~~~~~~~~~kk~~~~~ 483 (484)
.+||++|||++++...+++++.+++||+|||+
T Consensus 461 t~eIqegtI~~~~~s~~~~~~~~~kkk~nrrk 492 (493)
T KOG0804|consen 461 TDEIQEGTILITQISPSSSSSVKSKKKSNRRK 492 (493)
T ss_pred hhhhcCceeeccCCCCCccccccchhhhcccC
Confidence 56999999998877666666667777777776
|
|
| >PF07576 BRAP2: BRCA1-associated protein 2; InterPro: IPR011422 These proteins include BRCA1-associated protein 2 (BRAP2), which binds nuclear localisation signals (NLSs) in vitro and in yeast two-hybrid screening [] | Back alignment and domain information |
|---|
| >PF02148 zf-UBP: Zn-finger in ubiquitin-hydrolases and other protein; InterPro: IPR001607 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG0944 consensus Ubiquitin-specific protease UBP14 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] | Back alignment and domain information |
|---|
| >COG5207 UBP14 Isopeptidase T [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00290 ZnF_UBP Ubiquitin Carboxyl-terminal Hydrolase-like zinc finger | Back alignment and domain information |
|---|
| >cd02669 Peptidase_C19M A subfamily of Peptidase C19 | Back alignment and domain information |
|---|
| >KOG1873 consensus Ubiquitin-specific protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A | Back alignment and domain information |
|---|
| >PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A | Back alignment and domain information |
|---|
| >KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional | Back alignment and domain information |
|---|
| >PHA02929 N1R/p28-like protein; Provisional | Back alignment and domain information |
|---|
| >PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A | Back alignment and domain information |
|---|
| >KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A | Back alignment and domain information |
|---|
| >TIGR00599 rad18 DNA repair protein rad18 | Back alignment and domain information |
|---|
| >PF14634 zf-RING_5: zinc-RING finger domain | Back alignment and domain information |
|---|
| >PHA02926 zinc finger-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00504 Ubox Modified RING finger domain | Back alignment and domain information |
|---|
| >smart00184 RING Ring finger | Back alignment and domain information |
|---|
| >PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B | Back alignment and domain information |
|---|
| >TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 | Back alignment and domain information |
|---|
| >PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A | Back alignment and domain information |
|---|
| >PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger | Back alignment and domain information |
|---|
| >KOG0825 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF14259 RRM_6: RNA recognition motif (a | Back alignment and domain information |
|---|
| >COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF00076 RRM_1: RNA recognition motif | Back alignment and domain information |
|---|
| >PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability | Back alignment and domain information |
|---|
| >KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00362 RRM_2 RNA recognition motif | Back alignment and domain information |
|---|
| >KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins | Back alignment and domain information |
|---|
| >COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00360 RRM RNA recognition motif | Back alignment and domain information |
|---|
| >KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A | Back alignment and domain information |
|---|
| >PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] | Back alignment and domain information |
|---|
| >KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function | Back alignment and domain information |
|---|
| >PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) | Back alignment and domain information |
|---|
| >PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C | Back alignment and domain information |
|---|
| >PLN03134 glycine-rich RNA-binding protein 4; Provisional | Back alignment and domain information |
|---|
| >PF07227 DUF1423: Protein of unknown function (DUF1423); InterPro: IPR004082 A total of 715 potential protein-coding genes have been identified in the nucleotide sequence of Arabidopsis thaliana chromosome 5, with an average gene density of 1 gene per 4001 bp [] | Back alignment and domain information |
|---|
| >KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0982 consensus Centrosomal protein Nuf [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length | Back alignment and domain information |
|---|
| >PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation | Back alignment and domain information |
|---|
| >COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] | Back alignment and domain information |
|---|
| >PF10212 TTKRSYEDQ: Predicted coiled-coil domain-containing protein; InterPro: IPR019348 This entry represents a C-terminal 500 residue region, which contains a conserved TTKRSYEDQ motif | Back alignment and domain information |
|---|
| >PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 | Back alignment and domain information |
|---|
| >PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >PF10211 Ax_dynein_light: Axonemal dynein light chain; InterPro: IPR019347 Axonemal dynein light chain proteins play a dynamic role in flagellar and cilial motility | Back alignment and domain information |
|---|
| >KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >TIGR03825 FliH_bacil flagellar assembly protein FliH | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >TIGR02449 conserved hypothetical protein TIGR02449 | Back alignment and domain information |
|---|
| >KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] | Back alignment and domain information |
|---|
| >KOG4367 consensus Predicted Zn-finger protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] | Back alignment and domain information |
|---|
| >KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] | Back alignment and domain information |
|---|
| >KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed | Back alignment and domain information |
|---|
| >PF14662 CCDC155: Coiled-coil region of CCDC155 | Back alignment and domain information |
|---|
| >TIGR03752 conj_TIGR03752 integrating conjugative element protein, PFL_4705 family | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >PF07798 DUF1640: Protein of unknown function (DUF1640); InterPro: IPR024461 This family consists of uncharacterised proteins | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >PF09731 Mitofilin: Mitochondrial inner membrane protein; InterPro: IPR019133 Mitofilin controls mitochondrial cristae morphology | Back alignment and domain information |
|---|
| >PRK09343 prefoldin subunit beta; Provisional | Back alignment and domain information |
|---|
| >KOG1655 consensus Protein involved in vacuolar protein sorting [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >KOG4848 consensus Extracellular matrix-associated peroxidase [Extracellular structures; Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] | Back alignment and domain information |
|---|
| >PRK12704 phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >KOG1103 consensus Predicted coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] | Back alignment and domain information |
|---|
| >KOG3759 consensus Uncharacterized RUN domain protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13851 GAS: Growth-arrest specific micro-tubule binding | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR01069 mutS2 MutS2 family protein | Back alignment and domain information |
|---|
| >KOG1940 consensus Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B | Back alignment and domain information |
|---|
| >COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG3002 consensus Zn finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] | Back alignment and domain information |
|---|
| >PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 | Back alignment and domain information |
|---|
| >PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function | Back alignment and domain information |
|---|
| >PF05700 BCAS2: Breast carcinoma amplified sequence 2 (BCAS2); InterPro: IPR008409 This family consists of several eukaryotic sequences of unknown function | Back alignment and domain information |
|---|
| >COG3937 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG3039 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] | Back alignment and domain information |
|---|
| >COG3074 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR01659 sex-lethal sex-lethal family splicing factor | Back alignment and domain information |
|---|
| >PRK10361 DNA recombination protein RmuC; Provisional | Back alignment and domain information |
|---|
| >PF09731 Mitofilin: Mitochondrial inner membrane protein; InterPro: IPR019133 Mitofilin controls mitochondrial cristae morphology | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0579 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF | Back alignment and domain information |
|---|
| >TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor | Back alignment and domain information |
|---|
| >PF02403 Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal domain; InterPro: IPR015866 The aminoacyl-tRNA synthetases (6 | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK10884 SH3 domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF11180 DUF2968: Protein of unknown function (DUF2968); InterPro: IPR021350 This family of proteins has no known function | Back alignment and domain information |
|---|
| >PF10046 BLOC1_2: Biogenesis of lysosome-related organelles complex-1 subunit 2 ; InterPro: IPR019269 This entry represents a family of proteins that play a role in cellular proliferation, as well as in the biogenesis of specialised organelles of the endosomal-lysosomal system [] | Back alignment and domain information |
|---|
| >KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG1962 consensus B-cell receptor-associated protein and related proteins [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG0288 consensus WD40 repeat protein TipD [General function prediction only] | Back alignment and domain information |
|---|
| >PF05791 Bacillus_HBL: Bacillus haemolytic enterotoxin (HBL); InterPro: IPR008414 This family consists of several Bacillus haemolytic enterotoxins (HblC, HblD, HblA, NheA, and NheB), which can cause food poisoning in humans [] | Back alignment and domain information |
|---|
| >PF04576 Zein-binding: Zein-binding; InterPro: IPR007656 This is a family of uncharacterised proteins | Back alignment and domain information |
|---|
| >KOG4005 consensus Transcription factor XBP-1 [Transcription] | Back alignment and domain information |
|---|
| >PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function | Back alignment and domain information |
|---|
| >PRK00106 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG5175 MOT2 Transcriptional repressor [Transcription] | Back alignment and domain information |
|---|
| >KOG1952 consensus Transcription factor NF-X1, contains NFX-type Zn2+-binding and R3H domains [Transcription] | Back alignment and domain information |
|---|
| >PF10226 DUF2216: Uncharacterized conserved proteins (DUF2216); InterPro: IPR019359 Proteins in this entry are found in Metazoa and contain a coiled-coil domain | Back alignment and domain information |
|---|
| >PF15233 SYCE1: Synaptonemal complex central element protein 1 | Back alignment and domain information |
|---|
| >KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR01622 SF-CC1 splicing factor, CC1-like family | Back alignment and domain information |
|---|
| >PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease | Back alignment and domain information |
|---|
| >KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK15422 septal ring assembly protein ZapB; Provisional | Back alignment and domain information |
|---|
| >PRK10698 phage shock protein PspA; Provisional | Back alignment and domain information |
|---|
| >PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site | Back alignment and domain information |
|---|
| >PF04641 Rtf2: Rtf2 RING-finger | Back alignment and domain information |
|---|
| >TIGR01069 mutS2 MutS2 family protein | Back alignment and domain information |
|---|
| >TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family | Back alignment and domain information |
|---|
| >TIGR01622 SF-CC1 splicing factor, CC1-like family | Back alignment and domain information |
|---|
| >KOG4443 consensus Putative transcription factor HALR/MLL3, involved in embryonic development [General function prediction only] | Back alignment and domain information |
|---|
| >PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) | Back alignment and domain information |
|---|
| >KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >smart00787 Spc7 Spc7 kinetochore protein | Back alignment and domain information |
|---|
| >PF11068 YlqD: YlqD protein; InterPro: IPR021297 This bacterial family of proteins has no known function | Back alignment and domain information |
|---|
| >PF09738 DUF2051: Double stranded RNA binding protein (DUF2051); InterPro: IPR019139 This entry represents transcriptional repressors which preferentially bind to the GC-rich consensus sequence (5'-AGCCCCCGGCG-3') and may regulate expression of TNF, EGFR and PDGFA | Back alignment and domain information |
|---|
| >TIGR02338 gimC_beta prefoldin, beta subunit, archaeal | Back alignment and domain information |
|---|
| >COG2433 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 484 | ||||
| 3c5k_A | 109 | Crystal Structure Of Human Hdac6 Zinc Finger Domain | 1e-06 | ||
| 3gv4_A | 107 | Crystal Structure Of Human Hdac6 Zinc Finger Domain | 1e-06 | ||
| 2uzg_A | 97 | Zf-Ubp Domain Of Vdu1 Length = 97 | 5e-04 |
| >pdb|3C5K|A Chain A, Crystal Structure Of Human Hdac6 Zinc Finger Domain Length = 109 | Back alignment and structure |
|
| >pdb|3GV4|A Chain A, Crystal Structure Of Human Hdac6 Zinc Finger Domain And Ubiquitin C-Terminal Peptide Rlrgg Length = 107 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >2i50_A Ubiquitin carboxyl-terminal hydrolase 16; alpha/beta zinc-finger, ring-finger, ZNF-UBP, metalloprotein, ubiquitin-binding protein, USP; NMR {Homo sapiens} Length = 126 | Back alignment and structure |
|---|
Score = 108 bits (271), Expect = 2e-28
Identities = 30/127 (23%), Positives = 50/127 (39%), Gaps = 11/127 (8%)
Query: 183 GILSTICDHSFQCSCTAKWTVL----SCQVCRFCHQQ--DERPTCSVCGTVENLWVCLIC 236
G +C H + +C+ C + ++W+CL C
Sbjct: 1 GSHMPVCRHIRKGLEQGNLKKALVNVEWNICQDCKTDNKVKDKAEEETEEKPSVWLCLKC 60
Query: 237 GFVGCGRY-KEGHAVRHW---KDTQHWYSLDLRTQQIWDYVGDNYVHRLNQSKADGKLVE 292
G GCGR +E HA++H+ + H L L +W YV DN V + ++ G++V+
Sbjct: 61 GHQGCGRNSQEQHALKHYLTPRSEPHCLVLSLDNWSVWCYVCDNEVQYCSSNQ-LGQVVD 119
Query: 293 MNSPCMS 299
S
Sbjct: 120 YVRKQAS 126
|
| >3c5k_A HD6, histone deacetylase 6; HDAC6, zinc finger, actin-binding, chromatin regulator, cytoplasm, hydrolase, metal-binding, nucleus, phosphoprotein; 1.55A {Homo sapiens} PDB: 3gv4_A 3phd_A Length = 109 | Back alignment and structure |
|---|
| >2g45_A Ubiquitin carboxyl-terminal hydrolase 5; zinc finger, hydrolase; 1.99A {Homo sapiens} SCOP: g.44.1.5 PDB: 2g43_A 2l80_A Length = 129 | Back alignment and structure |
|---|
| >2ida_A Hypothetical protein; zinc binding protein, structural genomics, PSI-2, protein structure initiative; NMR {Rhodopseudomonas palustris} SCOP: g.44.1.5 Length = 102 | Back alignment and structure |
|---|
| >3ihp_A Ubiquitin carboxyl-terminal hydrolase 5; hydrolase, protease, thiol protease, UBL conjugation pathway, metal-binding, zinc-finger,structural genomics; 2.80A {Homo sapiens} Length = 854 | Back alignment and structure |
|---|
| >3mhs_A Ubiquitin carboxyl-terminal hydrolase 8; multi-protein complex, hydrolase-transcription regulator-Pro binding complex, acetylation, cytoplasm; 1.89A {Saccharomyces cerevisiae} PDB: 3mhh_A 3m99_A Length = 476 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 112 | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Length = 85 | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 58 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 484 | |||
| 2i50_A | 126 | Ubiquitin carboxyl-terminal hydrolase 16; alpha/be | 99.82 | |
| 2g45_A | 129 | Ubiquitin carboxyl-terminal hydrolase 5; zinc fing | 99.81 | |
| 3c5k_A | 109 | HD6, histone deacetylase 6; HDAC6, zinc finger, ac | 99.75 | |
| 2uzg_A | 97 | Ubiquitin carboxyl-terminal hydrolase 33; UBL conj | 99.7 | |
| 3ihp_A | 854 | Ubiquitin carboxyl-terminal hydrolase 5; hydrolase | 99.67 | |
| 2ida_A | 102 | Hypothetical protein; zinc binding protein, struct | 99.67 | |
| 3mhs_A | 476 | Ubiquitin carboxyl-terminal hydrolase 8; multi-pro | 99.18 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 98.76 | |
| 1iym_A | 55 | EL5; ring-H2 finger, ubiquitin ligase, DNA binding | 98.69 | |
| 2egp_A | 79 | Tripartite motif-containing protein 34; ZF-C3HC4 d | 98.66 | |
| 2ecj_A | 58 | Tripartite motif-containing protein 39; TRIM39, ri | 98.66 | |
| 2ect_A | 78 | Ring finger protein 126; metal binding protein, st | 98.65 | |
| 2yur_A | 74 | Retinoblastoma-binding protein 6; P53-associated c | 98.65 | |
| 2ecm_A | 55 | Ring finger and CHY zinc finger domain- containing | 98.64 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 98.62 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 98.62 | |
| 1x4j_A | 75 | Ring finger protein 38; structural genomics, NPPSF | 98.6 | |
| 3ztg_A | 92 | E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR | 98.6 | |
| 2ep4_A | 74 | Ring finger protein 24; zinc binding, ubiquitin, E | 98.59 | |
| 4ayc_A | 138 | E3 ubiquitin-protein ligase RNF8; DNA damage, K63 | 98.59 | |
| 2ea6_A | 69 | Ring finger protein 4; RNF4, RES4-26, ring domain, | 98.59 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 98.58 | |
| 2ysj_A | 63 | Tripartite motif-containing protein 31; ring-type | 98.57 | |
| 1t1h_A | 78 | Gspef-atpub14, armadillo repeat containing protein | 98.57 | |
| 1g25_A | 65 | CDK-activating kinase assembly factor MAT1; ring f | 98.57 | |
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 98.56 | |
| 2ecw_A | 85 | Tripartite motif-containing protein 30; metal bind | 98.56 | |
| 2kiz_A | 69 | E3 ubiquitin-protein ligase arkadia; ring-H2 finge | 98.56 | |
| 1bor_A | 56 | Transcription factor PML; proto-oncogene, nuclear | 98.55 | |
| 2ct2_A | 88 | Tripartite motif protein 32; zinc-finger protein H | 98.55 | |
| 2ecv_A | 85 | Tripartite motif-containing protein 5; metal bindi | 98.52 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 98.52 | |
| 2ecl_A | 81 | Ring-box protein 2; RNF7, ring domian, zinc-bindin | 98.52 | |
| 2l0b_A | 91 | E3 ubiquitin-protein ligase praja-1; zinc finger, | 98.51 | |
| 1v87_A | 114 | Deltex protein 2; ring-H2 domain, zinc-binding dom | 98.5 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 98.49 | |
| 1e4u_A | 78 | Transcriptional repressor NOT4; gene regulation, t | 98.48 | |
| 3l11_A | 115 | E3 ubiquitin-protein ligase RNF168; E3 ligase, rin | 98.48 | |
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 98.48 | |
| 2ecn_A | 70 | Ring finger protein 141; RNF141, ring domain, zinc | 98.48 | |
| 3fl2_A | 124 | E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA | 98.46 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 98.46 | |
| 1chc_A | 68 | Equine herpes virus-1 ring domain; viral protein; | 98.43 | |
| 2ckl_A | 108 | Polycomb group ring finger protein 4; BMI1, RING1B | 98.4 | |
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 98.38 | |
| 2y43_A | 99 | E3 ubiquitin-protein ligase RAD18; DNA repair, met | 98.38 | |
| 3dpl_R | 106 | Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST | 98.33 | |
| 1jm7_A | 112 | BRCA1, breast cancer type 1 susceptibility protein | 98.32 | |
| 2kr4_A | 85 | Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri | 98.31 | |
| 1rmd_A | 116 | RAG1; V(D)J recombination, antibody, MAD, ring fin | 98.31 | |
| 2ckl_B | 165 | Ubiquitin ligase protein RING2; BMI1, RING1B, poly | 98.3 | |
| 2kre_A | 100 | Ubiquitin conjugation factor E4 B; U-box domain, E | 98.29 | |
| 1z6u_A | 150 | NP95-like ring finger protein isoform B; structura | 98.28 | |
| 4ic3_A | 74 | E3 ubiquitin-protein ligase XIAP; ring domain, zin | 98.27 | |
| 1wgm_A | 98 | Ubiquitin conjugation factor E4A; ubiquitinating e | 98.26 | |
| 3hct_A | 118 | TNF receptor-associated factor 6; cross-brace, bet | 98.25 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 98.23 | |
| 3knv_A | 141 | TNF receptor-associated factor 2; cross-brace, alt | 98.19 | |
| 2d8s_A | 80 | Cellular modulator of immune recognition; C-MIR, m | 98.15 | |
| 4a0k_B | 117 | E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi | 98.14 | |
| 2yu4_A | 94 | E3 SUMO-protein ligase NSE2; SP-ring domain, struc | 98.13 | |
| 2ecg_A | 75 | Baculoviral IAP repeat-containing protein 4; BIRC4 | 97.95 | |
| 2f42_A | 179 | STIP1 homology and U-box containing protein 1; cha | 97.95 | |
| 2y1n_A | 389 | E3 ubiquitin-protein ligase; ligase-transferase co | 97.95 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 97.92 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 97.83 | |
| 2yho_A | 79 | E3 ubiquitin-protein ligase mylip; ligase, E2 liga | 97.83 | |
| 3t6p_A | 345 | Baculoviral IAP repeat-containing protein 2; ring, | 97.82 | |
| 3htk_C | 267 | E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- | 97.8 | |
| 2vje_A | 64 | E3 ubiquitin-protein ligase MDM2; proto-oncogene, | 97.69 | |
| 2ea5_A | 68 | Cell growth regulator with ring finger domain prot | 97.63 | |
| 2vje_B | 63 | MDM4 protein; proto-oncogene, phosphorylation, alt | 97.57 | |
| 2ct0_A | 74 | Non-SMC element 1 homolog; ring domain, structural | 97.44 | |
| 1wim_A | 94 | KIAA0161 protein; ring finger domain, UBCM4-intera | 97.32 | |
| 3k1l_B | 381 | Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A | 97.03 | |
| 1vyx_A | 60 | ORF K3, K3RING; zinc-binding protein, ring domain, | 97.0 | |
| 2dgw_A | 91 | Probable RNA-binding protein 19; RRM domain, struc | 96.82 | |
| 2bay_A | 61 | PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l | 96.8 | |
| 2dnh_A | 105 | Bruno-like 5, RNA binding protein; RRM domain, RBD | 96.44 | |
| 3bs9_A | 87 | Nucleolysin TIA-1 isoform P40; RNA recognition mot | 96.39 | |
| 2cq3_A | 103 | RNA-binding protein 9; RRM domain, structural geno | 96.37 | |
| 2dng_A | 103 | Eukaryotic translation initiation factor 4H; RRM d | 96.28 | |
| 3vk6_A | 101 | E3 ubiquitin-protein ligase hakai; HYB, phosphotyr | 96.21 | |
| 2dgv_A | 92 | HnRNP M, heterogeneous nuclear ribonucleoprotein M | 96.18 | |
| 2d9p_A | 103 | Polyadenylate-binding protein 3; RRM domain, struc | 96.15 | |
| 2dnz_A | 95 | Probable RNA-binding protein 23; RNA recognition m | 96.12 | |
| 2ywk_A | 95 | Putative RNA-binding protein 11; RRM-domain, struc | 96.1 | |
| 2dgo_A | 115 | Cytotoxic granule-associated RNA binding protein 1 | 96.06 | |
| 2jrs_A | 108 | RNA-binding protein 39; RNA binding motif of RBM39 | 96.04 | |
| 2cqc_A | 95 | Arginine/serine-rich splicing factor 10; RNA recog | 96.03 | |
| 2do4_A | 100 | Squamous cell carcinoma antigen recognized by T- c | 96.02 | |
| 1x4e_A | 85 | RNA binding motif, single-stranded interacting pro | 95.95 | |
| 1oo0_B | 110 | CG8781-PA, drosophila Y14; RNA recognition motif, | 95.92 | |
| 1p27_B | 106 | RNA-binding protein 8A; nuclear protein, mRNA spli | 95.92 | |
| 2do0_A | 114 | HnRNP M, heterogeneous nuclear ribonucleoprotein M | 95.89 | |
| 2fy1_A | 116 | RNA-binding motif protein, Y chromosome, family 1 | 95.89 | |
| 2dhg_A | 104 | TRNA selenocysteine associated protein (SECP43); R | 95.86 | |
| 1x5o_A | 114 | RNA binding motif, single-stranded interacting pro | 95.85 | |
| 2cqi_A | 103 | Nucleolysin TIAR; RNA recognition motif, RRM, RNA | 95.83 | |
| 2la6_A | 99 | RNA-binding protein FUS; structural genomics, nort | 95.78 | |
| 2dnm_A | 103 | SRP46 splicing factor; RRM domain, RBD, structural | 95.78 | |
| 2e5h_A | 94 | Zinc finger CCHC-type and RNA-binding motif- conta | 95.74 | |
| 1wi8_A | 104 | EIF-4B, eukaryotic translation initiation factor 4 | 95.71 | |
| 3md1_A | 83 | Nuclear and cytoplasmic polyadenylated RNA-bindin | 95.7 | |
| 3ulh_A | 107 | THO complex subunit 4; nuclear protein, RNA bindin | 95.7 | |
| 3mdf_A | 85 | Peptidyl-prolyl CIS-trans isomerase E; RRM domain, | 95.69 | |
| 2cq0_A | 103 | Eukaryotic translation initiation factor 3 subunit | 95.68 | |
| 2cph_A | 107 | RNA binding motif protein 19; RNA recognition moti | 95.67 | |
| 2cpz_A | 115 | CUG triplet repeat RNA-binding protein 1; RRM doma | 95.63 | |
| 3lqv_A | 115 | PRE-mRNA branch site protein P14; cysless mutant, | 95.62 | |
| 1whw_A | 99 | Hypothetical protein riken cDNA 1200009A02; RNA re | 95.52 | |
| 1x5s_A | 102 | Cold-inducible RNA-binding protein; structure geno | 95.5 | |
| 2err_A | 109 | Ataxin-2-binding protein 1; protein-RNA complex, R | 95.39 | |
| 4fxv_A | 99 | ELAV-like protein 1; RNA recognition motif, putati | 95.38 | |
| 2ytc_A | 85 | PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s | 95.37 | |
| 3nmr_A | 175 | Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl | 95.36 | |
| 2dnp_A | 90 | RNA-binding protein 14; RRM domain, RBD, structura | 95.3 | |
| 1x5u_A | 105 | Splicing factor 3B subunit 4 (spliceosome associat | 95.3 | |
| 2div_A | 99 | TRNA selenocysteine associated protein; structural | 95.29 | |
| 2kt5_A | 124 | RNA and export factor-binding protein 2; chaperone | 95.28 | |
| 2x1f_A | 96 | MRNA 3'-END-processing protein RNA15; transcriptio | 95.26 | |
| 2dgs_A | 99 | DAZ-associated protein 1; RRM domain, structural g | 95.24 | |
| 2dgp_A | 106 | Bruno-like 4, RNA binding protein; RRM domain, str | 95.2 | |
| 4a8x_A | 88 | RNA-binding protein with serine-rich domain 1; tra | 95.18 | |
| 2dgt_A | 92 | RNA-binding protein 30; RRM domain, structural gen | 95.17 | |
| 2cqb_A | 102 | Peptidyl-prolyl CIS-trans isomerase E; RNA recogni | 95.14 | |
| 2kxn_B | 129 | Transformer-2 protein homolog beta; SR protein, RR | 95.12 | |
| 1x5t_A | 96 | Splicing factor 3B subunit 4; structure genomics, | 95.08 | |
| 2cpj_A | 99 | Non-POU domain-containing octamer-binding protein; | 95.06 | |
| 3ex7_B | 126 | RNA-binding protein 8A; protein-RNA complex, mRNA | 95.04 | |
| 2xs2_A | 102 | Deleted in azoospermia-like; RNA binding protein-R | 95.02 | |
| 2cpf_A | 98 | RNA binding motif protein 19; RNA recognition moti | 94.97 | |
| 1fxl_A | 167 | Paraneoplastic encephalomyelitis antigen HUD; prot | 94.9 | |
| 2khc_A | 118 | Testis-specific RNP-type RNA binding protein; RRM, | 94.86 | |
| 2j76_E | 100 | EIF-4B, EIF4B, eukaryotic translation initiation f | 94.84 | |
| 2ku7_A | 140 | MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio | 94.82 | |
| 2fc9_A | 101 | NCL protein; structure genomics, RRM_1 domain, str | 94.77 | |
| 1rk8_A | 165 | CG8781-PA, CG8781-PA protein; mRNA processing, RRM | 94.75 | |
| 2cpe_A | 113 | RNA-binding protein EWS; RNA recognition motif, RR | 94.68 | |
| 3md3_A | 166 | Nuclear and cytoplasmic polyadenylated RNA-bindin | 94.68 | |
| 3ucg_A | 89 | Polyadenylate-binding protein 2; ferredoxin-like, | 94.67 | |
| 2krb_A | 81 | Eukaryotic translation initiation factor 3 subunit | 94.65 | |
| 1p1t_A | 104 | Cleavage stimulation factor, 64 kDa subunit; RNA r | 94.63 | |
| 1x4a_A | 109 | Splicing factor, arginine/serine-rich 1 (splicing | 94.6 | |
| 4f25_A | 115 | Polyadenylate-binding protein 1; RRM fold, transla | 94.55 | |
| 3nmr_A | 175 | Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl | 94.54 | |
| 2cqd_A | 116 | RNA-binding region containing protein 1; RNA recog | 94.53 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 94.52 | |
| 1h2v_Z | 156 | 20 kDa nuclear CAP binding protein; CAP-binding-co | 94.46 | |
| 2dis_A | 109 | Unnamed protein product; structural genomics, RRM | 94.4 | |
| 2dh8_A | 105 | DAZ-associated protein 1; RRM domain, structural g | 94.37 | |
| 1x4h_A | 111 | RNA-binding protein 28; structural genomics, RRM d | 94.31 | |
| 2dgu_A | 103 | Heterogeneous nuclear ribonucleoprotein Q; RRM dom | 94.29 | |
| 2fc8_A | 102 | NCL protein; structure genomics, RRM_1 domain, str | 94.29 | |
| 2db1_A | 118 | Heterogeneous nuclear ribonucleoprotein F; RRM dom | 94.25 | |
| 1x4g_A | 109 | Nucleolysin TIAR; structural genomics, RRM domain, | 94.15 | |
| 1u6f_A | 139 | Tcubp1, RNA-binding protein UBP1; trypanosome, mRN | 94.13 | |
| 2hzc_A | 87 | Splicing factor U2AF 65 kDa subunit; RNA splicing, | 94.13 | |
| 2cpy_A | 114 | RNA-binding protein 12; RRM domain, structural gen | 94.1 | |
| 3md3_A | 166 | Nuclear and cytoplasmic polyadenylated RNA-bindin | 94.09 | |
| 2kn4_A | 158 | Immunoglobulin G-binding protein G, splicing FACT | 94.02 | |
| 2cpi_A | 111 | CCR4-NOT transcription complex subunit 4; RNA reco | 93.98 | |
| 2la4_A | 101 | Nuclear and cytoplasmic polyadenylated RNA-bindin | 93.96 | |
| 2jwn_A | 124 | Embryonic polyadenylate-binding protein 2-B; epabp | 93.89 | |
| 1b7f_A | 168 | Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP | 93.81 | |
| 2g4b_A | 172 | Splicing factor U2AF 65 kDa subunit; protein-RNA c | 93.78 | |
| 3s7r_A | 87 | Heterogeneous nuclear ribonucleoprotein A/B; ferre | 93.77 | |
| 1fxl_A | 167 | Paraneoplastic encephalomyelitis antigen HUD; prot | 93.73 | |
| 2dgx_A | 96 | KIAA0430 protein; RRM domain, structural genomics, | 93.72 | |
| 2lmi_A | 107 | GRSF-1, G-rich sequence factor 1; G-rich RNA seque | 93.69 | |
| 1s79_A | 103 | Lupus LA protein; RRM, alpha/beta, RNA binding pro | 93.67 | |
| 2e44_A | 96 | Insulin-like growth factor 2 mRNA binding protein | 93.63 | |
| 1wg1_A | 88 | KIAA1579 protein, homolog EXC-7; RBD, structural g | 93.62 | |
| 1why_A | 97 | Hypothetical protein riken cDNA 1810017N16; RNA re | 93.61 | |
| 2cqg_A | 103 | TDP-43, TAR DNA-binding protein-43; RNA recognitio | 93.59 | |
| 2lxi_A | 91 | RNA-binding protein 10; NMR {Homo sapiens} | 93.58 | |
| 2qfj_A | 216 | FBP-interacting repressor; protein-DNA complex; HE | 93.58 | |
| 1b7f_A | 168 | Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP | 93.51 | |
| 2dnq_A | 90 | RNA-binding protein 4B; RRM domain,RBD, structural | 93.49 | |
| 2cpd_A | 99 | Apobec-1 stimulating protein; RNA recognition moti | 93.48 | |
| 2cq4_A | 114 | RNA binding motif protein 23; RRM domain, structur | 93.45 | |
| 1wg5_A | 104 | Heterogeneous nuclear ribonucleoprotein H; structu | 93.31 | |
| 3s8s_A | 110 | Histone-lysine N-methyltransferase SETD1A; chromat | 93.28 | |
| 2hvz_A | 101 | Splicing factor, arginine/serine-rich 7; RRM, RNA | 93.27 | |
| 2qfj_A | 216 | FBP-interacting repressor; protein-DNA complex; HE | 93.11 | |
| 2mss_A | 75 | Protein (musashi1); RNA-binding domain, RNA bindin | 93.09 | |
| 1nu4_A | 97 | U1A RNA binding domain; RNA recognition motif, U1 | 93.04 | |
| 2dnn_A | 109 | RNA-binding protein 12; RRM domain, RBD, structura | 93.02 | |
| 1x4c_A | 108 | Splicing factor, arginine/serine-rich 1; structura | 92.97 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 92.9 | |
| 1l3k_A | 196 | Heterogeneous nuclear ribonucleoprotein A1; nuclea | 92.9 | |
| 2cqp_A | 98 | RNA-binding protein 12; RNA recognition motif, RRM | 92.85 | |
| 2yh0_A | 198 | Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli | 92.81 | |
| 1wez_A | 102 | HnRNP H', FTP-3, heterogeneous nuclear ribonucleop | 92.8 | |
| 3p5t_L | 90 | Cleavage and polyadenylation specificity factor S; | 92.78 | |
| 2ki2_A | 90 | SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA | 92.77 | |
| 3ns6_A | 100 | Eukaryotic translation initiation factor 3 subuni; | 92.76 | |
| 2f3j_A | 177 | RNA and export factor binding protein 2; RRM domai | 92.74 | |
| 2jun_A | 101 | Midline-1; B-BOX, TRIM, ring finger, alternative s | 92.71 | |
| 2ek1_A | 95 | RNA-binding protein 12; RNA recognition motif, dim | 92.7 | |
| 2lkz_A | 95 | RNA-binding protein 5; RRM; NMR {Homo sapiens} | 92.65 | |
| 2i2y_A | 150 | Fusion protein consists of immunoglobin G- binding | 92.49 | |
| 3ghg_A | 562 | Fibrinogen alpha chain; triple-stranded coiled coi | 92.48 | |
| 3n9u_C | 156 | Cleavage and polyadenylation specificity factor S; | 92.45 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 92.35 | |
| 2nlw_A | 105 | Eukaryotic translation initiation factor 3 subunit | 92.16 | |
| 2lea_A | 135 | Serine/arginine-rich splicing factor 2; SR protein | 91.99 | |
| 2hgl_A | 136 | HNRPF protein, heterogeneous nuclear ribonucleopro | 91.98 | |
| 3beg_B | 115 | Splicing factor, arginine/serine-rich 1; kinase, S | 91.98 | |
| 2cpx_A | 115 | Hypothetical protein FLJ11016; RRM domain, structu | 91.94 | |
| 2hgm_A | 126 | HNRPF protein, heterogeneous nuclear ribonucleopro | 91.92 | |
| 3nw0_A | 238 | Non-structural maintenance of chromosomes element | 91.92 | |
| 3bas_A | 89 | Myosin heavy chain, striated muscle/general contro | 91.83 | |
| 2jvo_A | 108 | Nucleolar protein 3; nucleus, phosphorylation, rib | 91.79 | |
| 1uaw_A | 77 | Mouse-musashi-1; RNP-type structure, RNA binding p | 91.79 | |
| 1wf1_A | 110 | RNA-binding protein RALY; structural genomics, RRM | 91.72 | |
| 3hnw_A | 138 | Uncharacterized protein; coiled-coil, structural g | 91.7 | |
| 2e5j_A | 97 | Methenyltetrahydrofolate synthetase domain contain | 91.67 | |
| 3ol1_A | 119 | Vimentin; structural genomics, PSI-2, protein stru | 91.61 | |
| 1fjc_A | 96 | Nucleolin RBD2, protein C23; RNP, RRM, RNA binding | 91.54 | |
| 2xnq_A | 97 | Nuclear polyadenylated RNA-binding protein 3; tran | 91.26 | |
| 2adc_A | 229 | Polypyrimidine tract-binding protein 1; RBD, RRM, | 91.18 | |
| 3q2s_C | 229 | Cleavage and polyadenylation specificity factor S; | 91.13 | |
| 1qm9_A | 198 | Polypyrimidine tract-binding protein; ribonucleopr | 91.09 | |
| 3r27_A | 100 | HnRNP L, heterogeneous nuclear ribonucleoprotein L | 91.01 | |
| 3smz_A | 284 | Protein raver-1, ribonucleoprotein PTB-binding 1; | 91.01 | |
| 1x4b_A | 116 | Heterogeneous nuclear ribonucleoproteins A2/B1; st | 90.79 | |
| 3egn_A | 143 | RNA-binding protein 40; RNA recognition motif (RRM | 90.63 | |
| 4f02_A | 213 | Polyadenylate-binding protein 1; mRNA, eukaryotic | 90.37 | |
| 1l3k_A | 196 | Heterogeneous nuclear ribonucleoprotein A1; nuclea | 90.22 | |
| 1qm9_A | 198 | Polypyrimidine tract-binding protein; ribonucleopr | 90.2 | |
| 1wel_A | 124 | RNA-binding protein 12; structural genomics, NPPSF | 90.19 | |
| 3mq9_A | 471 | Bone marrow stromal antigen 2 fused to maltose-BI | 89.87 | |
| 1whx_A | 111 | Hypothetical protein riken cDNA 1200009A02; RNA re | 89.77 | |
| 4f02_A | 213 | Polyadenylate-binding protein 1; mRNA, eukaryotic | 89.67 | |
| 2cqh_A | 93 | IGF-II mRNA-binding protein 2 isoform A; RNA recog | 89.6 | |
| 3smz_A | 284 | Protein raver-1, ribonucleoprotein PTB-binding 1; | 89.59 | |
| 2ghp_A | 292 | U4/U6 snRNA-associated splicing factor PRP24; RNA | 89.54 | |
| 2kvi_A | 96 | Nuclear polyadenylated RNA-binding protein 3; RNA- | 89.5 | |
| 3ghg_A | 562 | Fibrinogen alpha chain; triple-stranded coiled coi | 89.49 | |
| 2ocy_A | 154 | RAB guanine nucleotide exchange factor SEC2; RAB, | 89.42 | |
| 3sde_A | 261 | Paraspeckle component 1; RRM, anti parallel right | 89.4 | |
| 1wex_A | 104 | Hypothetical protein (riken cDNA 2810036L13); stru | 89.38 | |
| 2cjk_A | 167 | Nuclear polyadenylated RNA-binding protein 4; HRP1 | 89.31 | |
| 2cq1_A | 101 | PTB-like protein L; RRM domain, structural genomic | 88.88 | |
| 2adc_A | 229 | Polypyrimidine tract-binding protein 1; RBD, RRM, | 88.78 | |
| 1uw4_A | 91 | UPF3X; nonsense mediated mRNA decay protein, RNA-b | 88.67 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 88.4 | |
| 2ghp_A | 292 | U4/U6 snRNA-associated splicing factor PRP24; RNA | 88.06 | |
| 2cjk_A | 167 | Nuclear polyadenylated RNA-binding protein 4; HRP1 | 87.96 | |
| 2rs2_A | 109 | Musashi-1, RNA-binding protein musashi homolog 1; | 87.88 | |
| 3sde_A | 261 | Paraspeckle component 1; RRM, anti parallel right | 87.65 | |
| 1iqt_A | 75 | AUF1, heterogeneous nuclear ribonucleoprotein D0; | 87.44 | |
| 2e5g_A | 94 | U6 snRNA-specific terminal uridylyltransferase 1; | 87.33 | |
| 2fxo_A | 129 | Myosin heavy chain, cardiac muscle beta isoform; c | 87.29 | |
| 2dha_A | 123 | FLJ20171 protein; RRM domain, structural genomics, | 87.01 | |
| 2m2b_A | 131 | RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio | 86.92 | |
| 2w83_C | 77 | C-JUN-amino-terminal kinase-interacting protein 4; | 86.72 | |
| 1fj7_A | 101 | Nucleolin RBD1, protein C23; RNP, RRM, RNA binding | 86.66 | |
| 2g4b_A | 172 | Splicing factor U2AF 65 kDa subunit; protein-RNA c | 86.61 | |
| 2voo_A | 193 | Lupus LA protein; RNA-binding protein, RNA recogni | 86.49 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 85.97 | |
| 3pgw_A | 282 | U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c | 85.89 | |
| 2dnl_A | 114 | Cytoplasmic polyadenylation element binding protei | 85.8 | |
| 3pgw_S | 437 | U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM | 85.68 | |
| 2lcw_A | 116 | RNA-binding protein FUS; RRM, nucleic acid binding | 85.69 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 85.41 | |
| 3tnu_B | 129 | Keratin, type II cytoskeletal 5; coiled-coil, stru | 85.23 | |
| 1fje_B | 175 | Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin | 85.08 | |
| 1x4d_A | 102 | Matrin 3; structural genomics, RRM domain, NPPSFA, | 85.05 | |
| 3tnu_A | 131 | Keratin, type I cytoskeletal 14; coiled-coil, stru | 84.98 | |
| 1wf0_A | 88 | TDP-43, TAR DNA-binding protein-43; structural gen | 84.7 | |
| 2jvr_A | 111 | Nucleolar protein 3; RNA recognition motif, nucleu | 84.56 | |
| 3pgw_A | 282 | U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c | 84.41 | |
| 1sjr_A | 164 | Polypyrimidine tract-binding protein 1; extended b | 84.1 | |
| 2a3j_A | 127 | U1 small nuclear ribonucleoprotein A; computationa | 83.47 | |
| 1gs9_A | 165 | Apolipoprotein E, APOE4; lipid transport, heparin- | 83.26 | |
| 1sjq_A | 105 | Polypyrimidine tract-binding protein 1; babbab mot | 83.23 | |
| 2hgn_A | 139 | Heterogeneous nuclear ribonucleoprotein F; RNA rec | 83.13 | |
| 2zqm_A | 117 | Prefoldin beta subunit 1; chaperone; HET: CIT; 1.9 | 83.12 | |
| 3d2w_A | 89 | TAR DNA-binding protein 43; DP-43 proteinopathy, T | 82.73 | |
| 2e5i_A | 124 | Heterogeneous nuclear ribonucleoprotein L-like; RR | 82.55 | |
| 2yh0_A | 198 | Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli | 82.02 | |
| 2ad9_A | 119 | Polypyrimidine tract-binding protein 1; RBD, RRM, | 82.0 | |
| 2jee_A | 81 | YIIU; FTSZ, septum, coiled-coil, cell division, ce | 81.96 | |
| 1nfn_A | 191 | Apolipoprotein E3; lipid transport, heparin-bindin | 81.88 | |
| 2pe8_A | 105 | Splicing factor 45; RRM, protein binding; 2.00A {H | 81.83 | |
| 2l08_A | 97 | Regulator of nonsense transcripts 3A; NESG, nonsen | 81.21 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 80.72 | |
| 2cq2_A | 114 | Hypothetical protein LOC91801; RRM domain, structu | 80.15 |
| >2i50_A Ubiquitin carboxyl-terminal hydrolase 16; alpha/beta zinc-finger, ring-finger, ZNF-UBP, metalloprotein, ubiquitin-binding protein, USP; NMR {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.82 E-value=3.2e-22 Score=177.70 Aligned_cols=108 Identities=28% Similarity=0.520 Sum_probs=90.2
Q ss_pred eeecCCCccccccccccC-------CccccccccccccCCCCccCCCCCCCceeeccccccccccCC-CCCccccccCC-
Q 011525 185 LSTICDHSFQCSCTAKWT-------VLSCQVCRFCHQQDERPTCSVCGTVENLWVCLICGFVGCGRY-KEGHAVRHWKD- 255 (484)
Q Consensus 185 vt~~C~H~Fh~~Cl~~w~-------~~~CPvCR~~~~~~~~~~C~~C~~~~nlWiCL~CG~vGCgr~-~~~HA~~H~~~- 255 (484)
+...|.|.++..++..|. ...|+.|+... ......+.+|....+||+||+||++||||+ .++||..||++
T Consensus 3 ~~~~C~H~~~~~~l~~~~~~~~~~~~~~C~~C~~~~-~~~~~~~~~~~~~~~Lw~CL~CG~vgCgr~~~~~Ha~~H~~~~ 81 (126)
T 2i50_A 3 HMPVCRHIRKGLEQGNLKKALVNVEWNICQDCKTDN-KVKDKAEEETEEKPSVWLCLKCGHQGCGRNSQEQHALKHYLTP 81 (126)
T ss_dssp --CCCSCHHHHCCHHHHHHHHSSCCSSSCHHHHTCT-TSSCSSCTTTCCCCCEEEETTTCCEEECTTSSSCHHHHHHHSC
T ss_pred CCCCCcChhhccccccccccccCCCCCcCccccccc-cccccccccccccccceeeeeCCccccCCCCcchHHHHHHhCc
Confidence 567899999988887663 35799998754 233345678999999999999999999998 68999999999
Q ss_pred --CCCceeeeCCCceeEeeccchhhhhhhhccccCceeecc
Q 011525 256 --TQHWYSLDLRTQQIWDYVGDNYVHRLNQSKADGKLVEMN 294 (484)
Q Consensus 256 --t~H~~~l~l~t~~Vwcy~cd~~Vhrl~q~k~dgklve~~ 294 (484)
++|+++++++|++||||.||+||+ ..+++.++++|++.
T Consensus 82 ~~t~H~l~~~l~t~~vwCY~cd~~V~-~~~~~~l~~~v~~~ 121 (126)
T 2i50_A 82 RSEPHCLVLSLDNWSVWCYVCDNEVQ-YCSSNQLGQVVDYV 121 (126)
T ss_dssp CSSCCCEEEETTTCCEEETTTTEEEC-CCTTSHHHHHHHHH
T ss_pred CCCCCcEEEECCCCeEEeCCCCcEEE-cCcchhHHHHHHHH
Confidence 899999999999999999999998 56778888888764
|
| >2g45_A Ubiquitin carboxyl-terminal hydrolase 5; zinc finger, hydrolase; 1.99A {Homo sapiens} SCOP: g.44.1.5 PDB: 2g43_A 2l80_A | Back alignment and structure |
|---|
| >3c5k_A HD6, histone deacetylase 6; HDAC6, zinc finger, actin-binding, chromatin regulator, cytoplasm, hydrolase, metal-binding, nucleus, phosphoprotein; 1.55A {Homo sapiens} PDB: 3gv4_A 3phd_A | Back alignment and structure |
|---|
| >3ihp_A Ubiquitin carboxyl-terminal hydrolase 5; hydrolase, protease, thiol protease, UBL conjugation pathway, metal-binding, zinc-finger,structural genomics; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2ida_A Hypothetical protein; zinc binding protein, structural genomics, PSI-2, protein structure initiative; NMR {Rhodopseudomonas palustris} SCOP: g.44.1.5 | Back alignment and structure |
|---|
| >3mhs_A Ubiquitin carboxyl-terminal hydrolase 8; multi-protein complex, hydrolase-transcription regulator-Pro binding complex, acetylation, cytoplasm; 1.89A {Saccharomyces cerevisiae} PDB: 3mhh_A 4fjc_A 4fk5_A 4fip_A 3m99_A | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B | Back alignment and structure |
|---|
| >2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A | Back alignment and structure |
|---|
| >1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} | Back alignment and structure |
|---|
| >2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A | Back alignment and structure |
|---|
| >3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B | Back alignment and structure |
|---|
| >3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A | Back alignment and structure |
|---|
| >2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* | Back alignment and structure |
|---|
| >2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 | Back alignment and structure |
|---|
| >2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A | Back alignment and structure |
|---|
| >2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A | Back alignment and structure |
|---|
| >3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A | Back alignment and structure |
|---|
| >2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} | Back alignment and structure |
|---|
| >2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A | Back alignment and structure |
|---|
| >2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* | Back alignment and structure |
|---|
| >1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 | Back alignment and structure |
|---|
| >3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A | Back alignment and structure |
|---|
| >3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* | Back alignment and structure |
|---|
| >2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A | Back alignment and structure |
|---|
| >3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B | Back alignment and structure |
|---|
| >1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A | Back alignment and structure |
|---|
| >2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B | Back alignment and structure |
|---|
| >2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A | Back alignment and structure |
|---|
| >4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A | Back alignment and structure |
|---|
| >1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* | Back alignment and structure |
|---|
| >2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A | Back alignment and structure |
|---|
| >2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A | Back alignment and structure |
|---|
| >2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A | Back alignment and structure |
|---|
| >2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A | Back alignment and structure |
|---|
| >2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A | Back alignment and structure |
|---|
| >3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A | Back alignment and structure |
|---|
| >2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X | Back alignment and structure |
|---|
| >2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A | Back alignment and structure |
|---|
| >2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A | Back alignment and structure |
|---|
| >2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} | Back alignment and structure |
|---|
| >2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} | Back alignment and structure |
|---|
| >1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A | Back alignment and structure |
|---|
| >2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A | Back alignment and structure |
|---|
| >3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A | Back alignment and structure |
|---|
| >1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A | Back alignment and structure |
|---|
| >2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A | Back alignment and structure |
|---|
| >1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2lxi_A RNA-binding protein 10; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A | Back alignment and structure |
|---|
| >1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A | Back alignment and structure |
|---|
| >2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A | Back alignment and structure |
|---|
| >2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A | Back alignment and structure |
|---|
| >1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... | Back alignment and structure |
|---|
| >2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} | Back alignment and structure |
|---|
| >1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A | Back alignment and structure |
|---|
| >2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A | Back alignment and structure |
|---|
| >1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C | Back alignment and structure |
|---|
| >2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} | Back alignment and structure |
|---|
| >3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A | Back alignment and structure |
|---|
| >2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A | Back alignment and structure |
|---|
| >2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A | Back alignment and structure |
|---|
| >3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* | Back alignment and structure |
|---|
| >3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A | Back alignment and structure |
|---|
| >2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A | Back alignment and structure |
|---|
| >3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A | Back alignment and structure |
|---|
| >2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A | Back alignment and structure |
|---|
| >3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} | Back alignment and structure |
|---|
| >3bas_A Myosin heavy chain, striated muscle/general control protein GCN4 chimera; alpha-helical coiled coil, disorder, salt links; 2.30A {Argopecten irradians} SCOP: h.1.26.1 PDB: 1nkn_A 3bat_A | Back alignment and structure |
|---|
| >2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A | Back alignment and structure |
|---|
| >1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A | Back alignment and structure |
|---|
| >3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} | Back alignment and structure |
|---|
| >2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A | Back alignment and structure |
|---|
| >2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A | Back alignment and structure |
|---|
| >3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C | Back alignment and structure |
|---|
| >1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 | Back alignment and structure |
|---|
| >3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} | Back alignment and structure |
|---|
| >3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E | Back alignment and structure |
|---|
| >1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* | Back alignment and structure |
|---|
| >1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A | Back alignment and structure |
|---|
| >1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 | Back alignment and structure |
|---|
| >1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3mq9_A Bone marrow stromal antigen 2 fused to maltose-BI periplasmic protein; HIV, antiviral protein; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* | Back alignment and structure |
|---|
| >2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E | Back alignment and structure |
|---|
| >2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A | Back alignment and structure |
|---|
| >2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* | Back alignment and structure |
|---|
| >2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B | Back alignment and structure |
|---|
| >1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C | Back alignment and structure |
|---|
| >2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A | Back alignment and structure |
|---|
| >1uw4_A UPF3X; nonsense mediated mRNA decay protein, RNA-binding protein, N domain, MIF4G domain; 1.95A {Homo sapiens} SCOP: d.58.7.4 | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} | Back alignment and structure |
|---|
| >2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A | Back alignment and structure |
|---|
| >2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C | Back alignment and structure |
|---|
| >2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B | Back alignment and structure |
|---|
| >1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A | Back alignment and structure |
|---|
| >2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A | Back alignment and structure |
|---|
| >2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2w83_C C-JUN-amino-terminal kinase-interacting protein 4; golgi apparatus, protein transport, ER-golgi transport, ARF, GTPase, effector, myristate; HET: GTP; 1.93A {Homo sapiens} | Back alignment and structure |
|---|
| >1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A | Back alignment and structure |
|---|
| >2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A | Back alignment and structure |
|---|
| >2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* | Back alignment and structure |
|---|
| >2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A | Back alignment and structure |
|---|
| >1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A | Back alignment and structure |
|---|
| >3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A | Back alignment and structure |
|---|
| >1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A | Back alignment and structure |
|---|
| >2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1gs9_A Apolipoprotein E, APOE4; lipid transport, heparin-binding, plasma, lipid binding protein; 1.7A {Homo sapiens} SCOP: a.24.1.1 PDB: 1or3_A 1or2_A 1le4_A 1bz4_A 1lpe_A 1le2_A | Back alignment and structure |
|---|
| >1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A | Back alignment and structure |
|---|
| >2zqm_A Prefoldin beta subunit 1; chaperone; HET: CIT; 1.90A {Thermococcus SP} PDB: 2zdi_A | Back alignment and structure |
|---|
| >3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} | Back alignment and structure |
|---|
| >2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A | Back alignment and structure |
|---|
| >2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} | Back alignment and structure |
|---|
| >1nfn_A Apolipoprotein E3; lipid transport, heparin-binding, plasma protein, HDL, VLDL; 1.80A {Homo sapiens} SCOP: a.24.1.1 PDB: 1h7i_A 1ea8_A 1b68_A 1nfo_A 2kc3_A 1ya9_A | Back alignment and structure |
|---|
| >2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A | Back alignment and structure |
|---|
| >2l08_A Regulator of nonsense transcripts 3A; NESG, nonsense regulator, structural genomics, PSI-2, protei structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 484 | ||||
| d2uzga1 | 95 | g.44.1.5 (A:36-130) Ubiquitin carboxyl-terminal hy | 4e-20 | |
| d2g45a1 | 113 | g.44.1.5 (A:173-285) Ubiquitin carboxyl-terminal h | 5e-18 | |
| d2idaa1 | 102 | g.44.1.5 (A:1-102) Hypothetical protein RPA1320 {R | 5e-15 | |
| d1iyma_ | 55 | g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati | 5e-05 | |
| d1ur6b_ | 52 | g.44.1.1 (B:) Not-4 N-terminal RING finger domain | 5e-05 | |
| d1g25a_ | 65 | g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi | 0.001 | |
| d1rmda2 | 86 | g.44.1.1 (A:1-86) V(D)J recombination activating p | 0.001 | |
| d1chca_ | 68 | g.44.1.1 (A:) Immediate early protein, IEEHV {Equi | 0.002 | |
| d1fbva4 | 79 | g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta | 0.003 | |
| d1bora_ | 56 | g.44.1.1 (A:) Acute promyelocytic leukaemia proto- | 0.003 |
| >d2uzga1 g.44.1.5 (A:36-130) Ubiquitin carboxyl-terminal hydrolase 33, UBP33 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
class: Small proteins fold: RING/U-box superfamily: RING/U-box family: Zf-UBP domain: Ubiquitin carboxyl-terminal hydrolase 33, UBP33 species: Human (Homo sapiens) [TaxId: 9606]
Score = 83.1 bits (205), Expect = 4e-20
Identities = 23/77 (29%), Positives = 38/77 (49%), Gaps = 3/77 (3%)
Query: 206 CQVCRFCHQQDERPTCSVCG-TVENLWVCL--ICGFVGCGRYKEGHAVRHWKDTQHWYSL 262
++ + Q TC C NLW CL C +VGCG + H+ H ++T+H+ ++
Sbjct: 11 GEITKEDLIQKSLGTCQDCKVQGPNLWACLENRCSYVGCGESQVDHSTIHSQETKHYLTV 70
Query: 263 DLRTQQIWDYVGDNYVH 279
+L T ++W Y V
Sbjct: 71 NLTTLRVWCYACSKEVF 87
|
| >d2g45a1 g.44.1.5 (A:173-285) Ubiquitin carboxyl-terminal hydrolase 5, UBP5 {Human (Homo sapiens) [TaxId: 9606]} Length = 113 | Back information, alignment and structure |
|---|
| >d2idaa1 g.44.1.5 (A:1-102) Hypothetical protein RPA1320 {Rhodopseudomonas palustris [TaxId: 1076]} Length = 102 | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 484 | |||
| d2g45a1 | 113 | Ubiquitin carboxyl-terminal hydrolase 5, UBP5 {Hum | 99.71 | |
| d2uzga1 | 95 | Ubiquitin carboxyl-terminal hydrolase 33, UBP33 {H | 99.69 | |
| d2idaa1 | 102 | Hypothetical protein RPA1320 {Rhodopseudomonas pal | 99.57 | |
| d1iyma_ | 55 | EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 | 98.86 | |
| d1ur6b_ | 52 | Not-4 N-terminal RING finger domain {Human (Homo s | 98.71 | |
| d1jm7b_ | 97 | bard1 RING domain {Human (Homo sapiens) [TaxId: 96 | 98.69 | |
| d1bora_ | 56 | Acute promyelocytic leukaemia proto-oncoprotein PM | 98.65 | |
| d1chca_ | 68 | Immediate early protein, IEEHV {Equine herpesvirus | 98.6 | |
| d1g25a_ | 65 | TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 | 98.58 | |
| d1jm7a_ | 103 | brca1 RING domain {Human (Homo sapiens) [TaxId: 96 | 98.57 | |
| d1fbva4 | 79 | CBL {Human (Homo sapiens) [TaxId: 9606]} | 98.54 | |
| d1rmda2 | 86 | V(D)J recombination activating protein 1 (RAG1), d | 98.53 | |
| d2c2la2 | 80 | STIP1 homology and U box-containing protein 1, STU | 98.42 | |
| d1t1ha_ | 78 | E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi | 98.37 | |
| d3dplr1 | 88 | RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase | 98.32 | |
| d2baya1 | 56 | Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac | 98.23 | |
| d1v87a_ | 114 | Deltex protein 2 RING-H2 domain {Mouse (Mus muscul | 98.22 | |
| d1vyxa_ | 60 | IE1B protein (ORF K3), N-terminal domain {Kaposi's | 98.06 | |
| d1wgma_ | 98 | Ubiquitin conjugation factor E4A {Human (Homo sapi | 97.66 | |
| d1wima_ | 94 | UbcM4-interacting protein 4 (KIAA0161) {Human (Hom | 96.87 | |
| d1fxla1 | 82 | Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 | 96.3 | |
| d1rk8a_ | 88 | RNA-binding protein 8 {Fruit fly (Drosophila melan | 96.28 | |
| d1b7fa2 | 85 | Sex-lethal protein {Drosophila melanogaster [TaxId | 96.26 | |
| d1fxla2 | 85 | Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 | 96.25 | |
| d2cqca1 | 83 | Arginine/serine-rich splicing factor 10 {Human (Ho | 96.25 | |
| d1x5oa1 | 101 | RNA-binding motif, single-stranded-interacting pro | 96.2 | |
| d1b7fa1 | 82 | Sex-lethal protein {Drosophila melanogaster [TaxId | 96.09 | |
| d2b0ga1 | 83 | Splicesomal U1A protein {Drosophila melanogaster [ | 95.85 | |
| d2ghpa2 | 75 | U4/U6 snRNA-associated-splicing factor PRP24 {Bake | 95.85 | |
| d2cqia1 | 90 | Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 | 95.83 | |
| d2cq3a1 | 93 | RNA-binding protein 9 {Human (Homo sapiens) [TaxId | 95.72 | |
| d2cqpa1 | 86 | RNA-binding protein 12 {Mouse (Mus musculus) [TaxI | 95.57 | |
| d2f9da1 | 114 | Pre-mRNA branch site protein p14 {Human (Homo sapi | 95.56 | |
| d1cvja1 | 80 | Poly(A)-binding protein {Human (Homo sapiens) [Tax | 95.45 | |
| d1wi8a_ | 104 | Eukaryotic translation initiation factor 4B {Human | 95.37 | |
| d1zh5a2 | 85 | Lupus LA protein {Human (Homo sapiens) [TaxId: 960 | 95.25 | |
| d1h2vz_ | 93 | CBP20, 20KDa nuclear cap-binding protein {Human (H | 95.24 | |
| d1wexa_ | 104 | Heterogeneous nuclear ribonucleoprotein L-like {Mo | 95.19 | |
| d2cpxa1 | 102 | RNA-binding protein 41, RBM41 {Human (Homo sapiens | 95.14 | |
| d1wg4a_ | 98 | Splicing factor, arginine/serine-rich 9 (SFRS9) {M | 95.04 | |
| d2u2fa_ | 85 | Splicing factor U2AF 65 KDa subunit {Human (Homo s | 95.02 | |
| d1x5ua1 | 93 | Splicing factor 3B subunit 4 {Human (Homo sapiens) | 94.97 | |
| d1whya_ | 97 | Putative RNA-binding protein 15B, Rbm15b {Mouse (M | 94.87 | |
| d1p1ta_ | 104 | Cleavage stimulation factor, 64 kda subunit {Human | 94.79 | |
| d1x4ea1 | 72 | RNA-binding motif, single-stranded-interacting pro | 94.76 | |
| d2adca1 | 109 | Polypyrimidine tract-binding protein {Human (Homo | 94.71 | |
| d1weza_ | 102 | Heterogeneous nuclear ribonucleoprotein H' {Human | 94.68 | |
| d1wg5a_ | 104 | Heterogeneous nuclear ribonucleoprotein H' {Human | 94.58 | |
| d1x4ga1 | 96 | Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 | 94.55 | |
| d1no8a_ | 78 | Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 | 94.55 | |
| d2cq0a1 | 90 | Eukaryotic translation initiation factor 3 subunit | 94.49 | |
| d2disa1 | 96 | Hypothetical protein FLJ20273 {Human (Homo sapiens | 94.34 | |
| d2cpha1 | 94 | Probable RNA-binding protein 19, Rbm19 {Mouse (Mus | 94.27 | |
| d2ghpa1 | 81 | U4/U6 snRNA-associated-splicing factor PRP24 {Bake | 94.26 | |
| d2cpfa1 | 85 | Probable RNA-binding protein 19, Rbm19 {Mouse (Mus | 94.16 | |
| d2cpza1 | 102 | CUG triplet repeat RNA-binding protein 1 {Human (H | 94.07 | |
| d1whxa_ | 111 | Probable RNA-binding protein 19, Rbm19 {Mouse (Mus | 93.98 | |
| d2cpea1 | 101 | RNA-binding protein EWS {Human (Homo sapiens) [Tax | 93.93 | |
| d2cpja1 | 86 | Non-POU domain-containing octamer-binding protein, | 93.93 | |
| d1nu4a_ | 91 | Splicesomal U1A protein {Human (Homo sapiens) [Tax | 93.91 | |
| d1x4aa1 | 95 | Splicing factor, arginine/serine-rich 1, SFRS1 {Hu | 93.84 | |
| d2bz2a1 | 79 | Negative elongation factor E, NELF-E {Human (Homo | 93.76 | |
| d2cpia1 | 89 | E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc | 93.73 | |
| d1cvja2 | 89 | Poly(A)-binding protein {Human (Homo sapiens) [Tax | 93.71 | |
| d2cqba1 | 89 | Peptidyl-prolyl cis-trans isomerase E, N-terminal | 93.66 | |
| d2cq1a1 | 88 | Polypyrimidine tract-binding protein 2, PTBP2 {Hum | 93.63 | |
| d1whwa_ | 99 | Probable RNA-binding protein 19, Rbm19 {Mouse (Mus | 93.24 | |
| d2adca2 | 88 | Polypyrimidine tract-binding protein {Human (Homo | 93.21 | |
| d1x5sa1 | 90 | Cold-inducible RNA-binding protein {Human (Homo sa | 92.92 | |
| d1x4ha1 | 98 | RNA-binding protein 28 {Mouse (Mus musculus) [TaxI | 92.85 | |
| d2cqga1 | 90 | TAR DNA-binding protein 43, TDP-43 {Human (Homo sa | 92.79 | |
| d2ghpa3 | 86 | U4/U6 snRNA-associated-splicing factor PRP24 {Bake | 92.73 | |
| d1x5ta1 | 83 | Splicing factor 3B subunit 4 {Human (Homo sapiens) | 92.64 | |
| d1u6fa1 | 139 | RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId | 92.61 | |
| d1fjca_ | 96 | Nucleolin {Golden hamster (Mesocricetus auratus) [ | 92.44 | |
| d1l3ka1 | 84 | Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human | 92.21 | |
| d2cq4a1 | 101 | RNA binding protein 23 {Human (Homo sapiens) [TaxI | 91.92 | |
| d3begb1 | 87 | Splicing factor, arginine/serine-rich 1, SFRS1 {Hu | 91.7 | |
| d2cpya1 | 103 | RNA-binding protein 12 {Human (Homo sapiens) [TaxI | 91.57 | |
| d1uawa_ | 77 | Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} | 91.28 | |
| d1wela1 | 112 | RNA-binding protein 12 {Human (Homo sapiens) [TaxI | 91.14 | |
| d1wi6a1 | 75 | Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M | 90.12 | |
| d2msta_ | 75 | Neural RNA-binding protein Musashi-1 {Mouse (Mus m | 90.03 | |
| d1wg1a_ | 88 | Probable RNA-binding protein KIAA1579 {Human (Homo | 89.87 | |
| d2cqda1 | 103 | RNA-binding region containing protein 1 {Human (Ho | 89.08 | |
| d1x4fa1 | 99 | Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} | 89.03 | |
| d1x4ba1 | 103 | Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu | 88.54 | |
| d1hd0a_ | 75 | Heterogeneous nuclear ribonucleoprotein d0 {Human | 88.46 | |
| d2cpda1 | 86 | APOBEC1 stimulating protein {Human (Homo sapiens) | 88.43 | |
| d1fjeb1 | 91 | Nucleolin {Golden hamster (Mesocricetus auratus) [ | 87.54 | |
| d1u1qa_ | 183 | Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human | 87.44 | |
| d1l3ka2 | 79 | Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human | 86.78 | |
| d2adba1 | 108 | Polypyrimidine tract-binding protein {Human (Homo | 86.11 | |
| d1seta1 | 110 | Seryl-tRNA synthetase (SerRS) {Thermus thermophilu | 85.77 | |
| d1uw4a_ | 91 | RNA processing protein UPF3x, RRM domain {Human (H | 84.6 | |
| d1x0fa1 | 75 | Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s | 83.53 | |
| d1x4da1 | 89 | Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} | 82.57 | |
| d2cq2a1 | 101 | Alkylation repair AlkB homolog 8, ALKBH8 {Human (H | 82.33 | |
| d1wf2a_ | 98 | Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu | 80.71 |
| >d2g45a1 g.44.1.5 (A:173-285) Ubiquitin carboxyl-terminal hydrolase 5, UBP5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Small proteins fold: RING/U-box superfamily: RING/U-box family: Zf-UBP domain: Ubiquitin carboxyl-terminal hydrolase 5, UBP5 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.71 E-value=8.5e-19 Score=150.58 Aligned_cols=65 Identities=34% Similarity=0.571 Sum_probs=59.9
Q ss_pred cCCCCccCCCCCCCceeeccccccccccCCC------CCccccccCCCCCceeeeCCC-----ceeEeeccchhhh
Q 011525 215 QDERPTCSVCGTVENLWVCLICGFVGCGRYK------EGHAVRHWKDTQHWYSLDLRT-----QQIWDYVGDNYVH 279 (484)
Q Consensus 215 ~~~~~~C~~C~~~~nlWiCL~CG~vGCgr~~------~~HA~~H~~~t~H~~~l~l~t-----~~Vwcy~cd~~Vh 279 (484)
+|+.+.|..|+...++|+||+||++|||||. ++||..||++++|++++.|.| .+||||.||+||.
T Consensus 21 ~p~~~~C~~C~~~~~lWlCL~CG~vgCgR~~~~~~~~~~HA~~H~~~t~H~l~v~l~t~~~~~~~vwCY~cd~~V~ 96 (113)
T d2g45a1 21 PPCGWKCSKCDMRENLWLNLTDGSILCGRRYFDGSGGNNHAVEHYRETGYPLAVKLGTITPDGADVYSYDEDDMVL 96 (113)
T ss_dssp CCCBCCCSSSSCCSSEEEETTTCCEEECCBCTTSCBCCSHHHHHHHHHCCCEEEETTCCBTTBCCEEETTTTEEEE
T ss_pred CCCCCcccCCCCcCCEEEEecCCCCccCcccccCCCCChHHHHHHHhcCCCEEEEecCCCCCCceEEEecCCCEEE
Confidence 5677899999999999999999999999985 889999999999999999976 5699999999994
|
| >d2uzga1 g.44.1.5 (A:36-130) Ubiquitin carboxyl-terminal hydrolase 33, UBP33 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2idaa1 g.44.1.5 (A:1-102) Hypothetical protein RPA1320 {Rhodopseudomonas palustris [TaxId: 1076]} | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} | Back information, alignment and structure |
|---|
| >d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} | Back information, alignment and structure |
|---|
| >d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} | Back information, alignment and structure |
|---|
| >d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1seta1 a.2.7.1 (A:1-110) Seryl-tRNA synthetase (SerRS) {Thermus thermophilus, strain hb27 [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|