Citrus Sinensis ID: 011542

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480---

MHYWVRASSSDFGGTVPQPRSGHSAVNIGKSKVVVFGGLVDKRFLSDVVVYDIDNKLWFQPECTGNGSNGQVGPGPRAFHIAVAIDCHMFIFGGRFGSRRLGDFWVLDTDIWQWSELTSFGDLPSPRDFAAASAIGNRKIVMYGGWDGKKWLSDVYVLDTISLEWMQLPVTGSVPPPRCGHTATMVEKRLLIYGGRGGGGPIMGDLWALKGLIEEENETPGWTQLKLPGQAPSSRCGHTITSGGHYLLLFGGHGTGGWLSRYDIYYNDTIILDRLSAQWKRLPIGNEPPPARAYHSMTCLGSLYLLFGGFDGKSTFGDIWWLVPEEDPIAKRYTESPPKVLPENKDVGMENYNSQFAVKESQRESSAIVELQKKLDISVSLSRPGLQIMDELEDEEFLELASRLMGAGVFSNGQVSRIQATQVLRDHWKKSTPRSIPIKELGPLLRDYQRLIARHLANLQSTELGLPGKEAYTFYHLKNSSQV

ccEEEEcccccccccccccccccEEEEEcccEEEEEcccccccccccEEEEEcccccEEccEEccccccccccccccccEEEEEEccEEEEEcccccccccccEEEEEccccEEEEEEEcccccccccccEEEEEcccEEEEEcccccccccccEEEEEcccccEEEEcccccccccccccEEEEEccEEEEEEcccccccccccccccccccccccccccEEEEcccccccccccccccEEEccEEEEEcccccccccccccccccEEEEEEcccccEEEEccccccccccccEEEEEEccEEEEEcccccccccccEEEEEcccccccccccccccccccccccEEEEccccEEEEcccccccHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHccccccccccccEEEEEEEEcccccc

ccccEccccccccccccccccccEEEEEEccEEEEEEcccccccccEEEEEccccccEEEccccccccccccccccccccEEEEEccEEEEEEcccccccccEEEEEcccccEEEEccccccccccccccEEEEEEccEEEEEEccccccccccEEEEccccccEEEccccccccccccccEEEEEccEEEEEEccccccccccccHHcccEEEEccccccEEEccccccccccccccEEEEEccEEEEEEccccccccccHHHHcccEEEEccccccEEEEccccccccccccEEEEEEccEEEEEEccccccccccEEEEcccccccEEEcccccccccccccccccEEEEEccEEccccccccccccccccccccccccccccccccccccccEEEcccEEEEEccccccccccEEEEccccccEEEEccccccHHHHHHHHHHHHHHHHcccccccccccccccccEEEEEEEEccccc

mhywvrasssdfggtvpqprsghsavnigkSKVVVFGGLVDKRFLSDVVVYDIdnklwfqpectgngsngqvgpgprAFHIAVAIDCHmfifggrfgsrrlgdfwvldtdiwqwseltsfgdlpsprdfAAASAIGNRKIVMYggwdgkkwlsDVYVLDTISLEwmqlpvtgsvppprcghtaTMVEKRLLIyggrggggpimGDLWALKGlieeenetpgwtqlklpgqapssrcghtitsgGHYLLLfgghgtggwlsrydiyynDTIILDRLSAQwkrlpigneppparayhsmTCLGSLYllfggfdgkstfgdiwwlvpeedpiakrytesppkvlpenkdvgmenynsqfavkeSQRESSAIVELQKKLDIsvslsrpglqimdeLEDEEFLELASRLMGagvfsngqvSRIQATQVLRDhwkkstprsipikelgpLLRDYQRLIARHLANLqstelglpgkeaytfyhlknssqv

mhywvrasssdfggtvpqprsghsavnigKSKVVVFGGLVDKRFLSDVVVYDIDNKLWFQPECTGNGSNGQVGPGPRAFHIAVAIDCHMFIFGGRFGSRRLGDFWVLDTDIWQWSEltsfgdlpsPRDFAAASAIGNRKIVMYGGWDGKKWLSDVYVLDTISLEWMQLPVTGSVPPPRCGHTATMVEKRLLIYGGRGGGGPIMGDLWALKGLIEEENETPGWTQLKLPGQAPSSRCGHTITSGGHYLLLFGGHGTGGWLSRYDIYYNDTIILDRLSAQWKRLPIGNEPPPARAYHSMTCLGSLYLLFGGFDGKSTFGDIWWLVPEEDPIAKRYTESPPKVLPENKDVGMENYNSQFAVKESQRESSAIVELQkkldisvslsrpglqiMDELEDEEFLELASRLMGAGVFSNGQVSRIQATQvlrdhwkkstprsipikelgPLLRDYQRLIARHLANlqstelglpgkeaytfyhlknssqv

MHYWVRASSSDFGGTVPQPRSGHSAVNIGKSKVVVFGGLVDKRFLSDVVVYDIDNKLWFQPECTGNGSNGQVGPGPRAFHIAVAIDCHMFIFGGRFGSRRLGDFWVLDTDIWQWSELTSFGDLPSPRDFAAASAIGNRKIVMYGGWDGKKWLSDVYVLDTISLEWMQLPVTGSVPPPRCGHTATMVEKRLLIYggrggggPIMGDLWALKGLIEEENETPGWTQLKLPGQAPSSRCGHTITSgghylllfgghgtggwlSRYDIYYNDTIILDRLSAQWKRLPIGNEPPPARAYHSMTCLGSLYLLFGGFDGKSTFGDIWWLVPEEDPIAKRYTESPPKVLPENKDVGMENYNSQFAVKESQRESSAIVELQKKLDISVSLSRPGLQIMdeledeeflelASRLMGAGVFSNGQVSRIQATQVLRDHWKKSTPRSIPIKELGPLLRDYQRLIARHLANLQSTELGLPGKEAYTFYHLKNSSQV

*************************VNIGKSKVVVFGGLVDKRFLSDVVVYDIDNKLWFQPECTGNGSNGQVGPGPRAFHIAVAIDCHMFIFGGRFGSRRLGDFWVLDTDIWQWSELTSFGDLPSPRDFAAASAIGNRKIVMYGGWDGKKWLSDVYVLDTISLEWMQLPVTGSVPPPRCGHTATMVEKRLLIYGGRGGGGPIMGDLWALKGLIEEENETPGWTQLKL*******RCGHTITSGGHYLLLFGGHGTGGWLSRYDIYYNDTIILDRLSAQWKRLPIGNEPPPARAYHSMTCLGSLYLLFGGFDGKSTFGDIWWLVPEE**************************************************I*V*****GLQIMDELEDEEFLELASRLMGAGVFSNGQVSRIQATQVLRDHWKKSTPRSIPIKELGPLLRDYQRLIARHLANLQSTELGLPGKEAYTFYHL******

MHYWVRASSS*****VPQPRSGHSAVNIGKSKVVVFGGLVDKRFLSDVVVYDIDNKLWFQPECTGNGSNGQVGPGPRAFHIAVAIDCHMFIFGGRFGSRRLGDFWVLDTDIWQWSELTSFGDLPSPRDFAAASAIGNRKIVMYGGWDGKKWLSDVYVLDTISLEWMQLPVTGSVPPPRCGHTATMVEKRLLIYGGRGGGGPIMGDLWALKGLIEEENETPGWTQLKLPGQAPSSRCGHTITSGGHYLLLFGGHGTGGWLSRYDIYYNDTIILDRLSAQWKRL******PPARAYHSMTCLGSLYLLFGGFDGKSTFGDIWWLVPEEDPI********************ENYNSQFAVKESQRESSAIVELQKKLDISVS**********************************************************************************************YHLK*****

**********************HSAVNIGKSKVVVFGGLVDKRFLSDVVVYDIDNKLWFQPECTGNGSNGQVGPGPRAFHIAVAIDCHMFIFGGRFGSRRLGDFWVLDTDIWQWSELTSFGDLPSPRDFAAASAIGNRKIVMYGGWDGKKWLSDVYVLDTISLEWMQLPVTGSVPPPRCGHTATMVEKRLLIYGGRGGGGPIMGDLWALKGLIEEENETPGWTQLKL********CGHTITSGGHYLLLFGGHGTGGWLSRYDIYYNDTIILDRLSAQWKRLPIGNEPPPARAYHSMTCLGSLYLLFGGFDGKSTFGDIWWLVPEEDPIAKRYTESPPKVLPENKDVGMENYNSQFA***********VELQKKLDISVSLSRPGLQIMDELEDEEFLELASRLMGAGVFSNGQVSRIQATQVLRDHWKKSTPRSIPIKELGPLLRDYQRLIARHLANLQSTELGLPGKEAYTFYHLKNSSQV

**YWVRAS*SDFGGTVPQPRSGHSAVNIGKSKVVVFGGLVDKRFLSDVVVYDIDNKLWFQPECTGNGSNGQVGPGPRAFHIAVAIDCHMFIFGGRFGSRRLGDFWVLDTDIWQWSELTSFGDLPSPRDFAAASAIGNRKIVMYGGWDGKKWLSDVYVLDTISLEWMQLPVTGSVPPPRCGHTATMVEKRLLIYGGRGGGGPIMGDLWALKGLIEEENETPGWTQLKLPGQAPSSRCGHTITSGGHYLLLFGGHGTGGWLSRYDIYYNDTIILDRLSAQWKRLPIGNEPPPARAYHSMTCLGSLYLLFGGFDGKSTFGDIWWLVPEEDPIAKRYTESPPKVLPENKDVGMENYNSQFAVKESQRESSAIVELQKKLDISVSLSRPGLQIMDELEDEEFLELASRLMGAGVFSNGQVSRIQATQVLRDHWKKSTPRSIPIKELGPLLRDYQRLIARHLANLQSTELGLPGKEAYTFYHLKNS***

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		483	2.2.26 [Sep-21-2011]
Q7M3S9		943	RING finger protein B OS=	no	no	0.490	0.251	0.285	2e-23
A8JAM0		1159	Coiled-coil domain-contai	N/A	no	0.362	0.150	0.342	2e-22
Q6AXB2		366	Rab9 effector protein wit	N/A	no	0.554	0.732	0.263	1e-21
Q9V4C8		1500	Host cell factor OS=Droso	yes	no	0.602	0.194	0.282	2e-21
P87061		1147	Tip elongation aberrant p	yes	no	0.501	0.210	0.276	6e-21
Q61191		2045	Host cell factor 1 OS=Mus	yes	no	0.614	0.145	0.289	1e-20
P51611		2090	Host cell factor 1 OS=Mes	N/A	no	0.614	0.142	0.289	1e-20
P51610		2035	Host cell factor 1 OS=Hom	no	no	0.614	0.145	0.287	3e-20
Q5EA50		372	Rab9 effector protein wit	no	no	0.548	0.712	0.294	9e-19
Q9MA55		668	Acyl-CoA-binding domain-c	no	no	0.749	0.541	0.251	1e-18

>sp\|Q7M3S9\|RNGB_DICDI RING finger protein B OS=Dictyostelium discoideum GN=rngB PE=2 SV=2	Back alignment and function desciption

 Score =  110 bits (276), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 74/259 (28%), Positives = 122/259 (47%), Gaps = 22/259 (8%)

Query: 14  GTVPQPRSGHSAVNIGKS--------KVVVFGGLVDKRFLSDV-VVYDIDNKLWFQPECT 64
           G  P  R GHSAV             +++ FGG    +  SD+ ++Y   N+ +   + T
Sbjct: 62  GNAPSERYGHSAVLYQSQSRPYSDSYQIIFFGGRATSKPFSDINILYVNSNRSFIWKQVT 121

Query: 65  GNGSNGQVGPGPRAFHIAVAIDCHMFIFGGR--FGSRRLGDFWVLDTDIWQWSELTSFGD 122
                G+ G      H AV    ++ +FGG     S+      +   +  +W +    G 
Sbjct: 122 TKSIEGRAG------HTAVVYRQNLVVFGGHNNHKSKYYNSVLLFSLESNEWRQQVCGGV 175

Query: 123 LPSPRDFAAASAIGNRKIVMYGGWDGKKWLSDVYVLDTISLEWMQLPVTGSVPPPRCGHT 182
           +PS R   +   + N K+ ++GG+DGKK+ +D+Y LD  +  W ++   G+ P PR GH+
Sbjct: 176 IPSARATHSTFQVNNNKMFIFGGYDGKKYYNDIYYLDLETWIWKKVEAKGTPPKPRSGHS 235

Query: 183 ATMVE-KRLLIYGGRGGGGPIMGDLWALKGLIEEENETPGWTQLKLPG-QAPSSRCGHTI 240
           ATM++  +L+I+GG G     + D+  L   IE  NE   W Q    G + P +R  HT 
Sbjct: 236 ATMIQNNKLMIFGGCGSDSNFLNDIHILH--IEGANEYR-WEQPSYLGLEIPQARFRHTT 292

Query: 241 TSGGHYLLLFGGHGTGGWL 259
              G  + ++ G G+G  +
Sbjct: 293 NFIGGRVYIYAGTGSGNLM 311

Dictyostelium discoideum (taxid: 44689)

>sp\|A8JAM0\|CC135_CHLRE Coiled-coil domain-containing protein lobo homolog (Fragment) OS=Chlamydomonas reinhardtii GN=FAP50 PE=2 SV=1	Back alignment and function description

>sp\|Q6AXB2\|RABEK_XENLA Rab9 effector protein with kelch motifs OS=Xenopus laevis GN=rabepk PE=2 SV=1	Back alignment and function description

>sp\|Q9V4C8\|HCF_DROME Host cell factor OS=Drosophila melanogaster GN=Hcf PE=1 SV=2	Back alignment and function description

>sp\|P87061\|TEA1_SCHPO Tip elongation aberrant protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tea1 PE=1 SV=1	Back alignment and function description

>sp\|Q61191\|HCFC1_MOUSE Host cell factor 1 OS=Mus musculus GN=Hcfc1 PE=1 SV=2	Back alignment and function description

>sp\|P51611\|HCFC1_MESAU Host cell factor 1 OS=Mesocricetus auratus GN=HCFC1 PE=1 SV=1	Back alignment and function description

>sp\|P51610\|HCFC1_HUMAN Host cell factor 1 OS=Homo sapiens GN=HCFC1 PE=1 SV=2	Back alignment and function description

>sp\|Q5EA50\|RABEK_BOVIN Rab9 effector protein with kelch motifs OS=Bos taurus GN=RABEPK PE=2 SV=1	Back alignment and function description

>sp\|Q9MA55\|ACBP4_ARATH Acyl-CoA-binding domain-containing protein 4 OS=Arabidopsis thaliana GN=ACBP4 PE=1 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		483
225449698		507	PREDICTED: rab9 effector protein with ke	0.997	0.950	0.787	0.0
296090416		509	unnamed protein product [Vitis vinifera]	0.997	0.946	0.780	0.0
255564088		501	conserved hypothetical protein [Ricinus	0.989	0.954	0.782	0.0
224100649		494	predicted protein [Populus trichocarpa]	0.973	0.951	0.734	0.0
356576309		497	PREDICTED: acyl-CoA-binding domain-conta	0.989	0.961	0.742	0.0
334184721		503	galactose oxidase/kelch repeat-containin	0.991	0.952	0.712	0.0
30686755		496	galactose oxidase/kelch repeat-containin	0.979	0.953	0.715	0.0
356576311		505	PREDICTED: acyl-CoA-binding domain-conta	0.989	0.946	0.730	0.0
334184719		511	galactose oxidase/kelch repeat-containin	0.991	0.937	0.700	0.0
334184717		512	galactose oxidase/kelch repeat-containin	0.991	0.935	0.699	0.0

>gi\|225449698\|ref\|XP_002267817.1\| PREDICTED: rab9 effector protein with kelch motifs-like [Vitis vinifera]	Back alignment and taxonomy information

 Score =  792 bits (2045), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/490 (78%), Positives = 432/490 (88%), Gaps = 8/490 (1%)

Query: 1   MHYWVRASSSDFGGTVPQPRSGHSAVNIGKSKVVVFGGLVDKRFLSDVVVYDIDNKLWFQ 60
           MHYWVRAS SDF GT+PQ RSGH+AVNIGKSK+VVFGGLVDKRF+SD+ VYDI+NKLWFQ
Sbjct: 1   MHYWVRASPSDFSGTLPQRRSGHTAVNIGKSKIVVFGGLVDKRFISDLCVYDIENKLWFQ 60

Query: 61  PECTGNGSNGQVGPGPRAFHIAVAIDCHMFIFGGRFGSRRLGDFWVLDTDIWQWSELTSF 120
           PECTGNGS GQVGP PRAFHIA+AIDCHMF+FGGR G +RLGDFWVLDTDIWQWSELTSF
Sbjct: 61  PECTGNGSVGQVGPSPRAFHIAIAIDCHMFVFGGRSGGKRLGDFWVLDTDIWQWSELTSF 120

Query: 121 GDLPSPRDFAAASAIGNRKIVMYGGWDGKKWLSDVYVLDTISLEWMQLPVTGSVPPPRCG 180
           GDLPSPRDFAAASAIGNRKIVMYGGWDGKKWLSDV+VLDTISLEWM+L V+GS+PPPRCG
Sbjct: 121 GDLPSPRDFAAASAIGNRKIVMYGGWDGKKWLSDVFVLDTISLEWMELSVSGSLPPPRCG 180

Query: 181 HTATMVEKRLLIYGGRGGGGPIMGDLWALKGLIEEENETPGWTQLKLPGQAPSSRCGHTI 240
           HTATMVEKR+L+YGGRGGGGPIMGDLWALKGL+EEENETPGWTQLKLPGQAPS RCGHTI
Sbjct: 181 HTATMVEKRMLVYGGRGGGGPIMGDLWALKGLLEEENETPGWTQLKLPGQAPSPRCGHTI 240

Query: 241 TSGGHYLLLFGGHGTGGWLSRYDIYYNDTIILDRLSAQWKRLPIGNEPPPARAYHSMTCL 300
           TSGGHYLLLFGGHGTGGWLSRYDIYYN+ I+LDR+S QWKRLP  NEPPPARAYHSMTC+
Sbjct: 241 TSGGHYLLLFGGHGTGGWLSRYDIYYNECIVLDRVSVQWKRLPTSNEPPPARAYHSMTCI 300

Query: 301 GSLYLLFGGFDGKSTFGDIWWLVPEEDPIAKRYTESPPKVLPENKDVGMENYNSQFAVKE 360
           GS YLLFGGFDGKSTF D+WWLVPEEDPIAKR T SP K +PE+KD+ +    +Q + + 
Sbjct: 301 GSRYLLFGGFDGKSTFDDLWWLVPEEDPIAKRLTSSPAKNIPEDKDLAIAK-ETQLSHEA 359

Query: 361 SQRESSAIVELQKKLDISVSLSRPGLQIMDELEDEEFLELASRLMGAG--VFSNGQVSRI 418
           SQ+E SA+ EL+K+LDISVS+S P LQI+DELED+EFLELA  L+G G  V SNGQ+S  
Sbjct: 360 SQKEESAVSELRKRLDISVSISVPELQIIDELEDKEFLELALSLIGVGEKVSSNGQISHT 419

Query: 419 QATQVLRDHWKKSTPRSIPIKELGPLLRDYQRLIARHL-----ANLQSTELGLPGKEAYT 473
           QA Q LRDHW +STP+ IP+KELGPLLRDYQRLI RH      ++ Q TE    GKEAY 
Sbjct: 420 QAAQALRDHWGESTPKLIPLKELGPLLRDYQRLITRHHTGNGPSDSQFTESCFSGKEAYR 479

Query: 474 FYHLKNSSQV 483
           FYH+K++SQ+
Sbjct: 480 FYHVKSASQL 489

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|296090416\|emb\|CBI40235.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|255564088\|ref\|XP_002523042.1\| conserved hypothetical protein [Ricinus communis] gi\|223537725\|gb\|EEF39346.1\| conserved hypothetical protein [Ricinus communis]	Back alignment and taxonomy information

>gi\|224100649\|ref\|XP_002311962.1\| predicted protein [Populus trichocarpa] gi\|222851782\|gb\|EEE89329.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|356576309\|ref\|XP_003556275.1\| PREDICTED: acyl-CoA-binding domain-containing protein 4-like isoform 1 [Glycine max]	Back alignment and taxonomy information

>gi\|334184721\|ref\|NP_001189691.1\| galactose oxidase/kelch repeat-containing protein [Arabidopsis thaliana] gi\|330254150\|gb\|AEC09244.1\| galactose oxidase/kelch repeat-containing protein [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi|30686755|ref|NP_850263.1| galactose oxidase/kelch repeat-containing protein [Arabidopsis thaliana] gi|79324451|ref|NP_001031493.1| galactose oxidase/kelch repeat-containing protein [Arabidopsis thaliana] gi|20260248|gb|AAM13022.1| unknown protein [Arabidopsis thaliana] gi|22136502|gb|AAM91329.1| unknown protein [Arabidopsis thaliana] gi|222423480|dbj|BAH19710.1| AT2G36360 [Arabidopsis thaliana] gi|330254146|gb|AEC09240.1| galactose oxidase/kelch repeat-containing protein [Arabidopsis thaliana] gi|330254147|gb|AEC09241.1| galactose oxidase/kelch repeat-containing protein [Arabidopsis thaliana]

Back alignment and taxonomy information

>gi\|356576311\|ref\|XP_003556276.1\| PREDICTED: acyl-CoA-binding domain-containing protein 4-like isoform 2 [Glycine max]	Back alignment and taxonomy information

>gi\|334184719\|ref\|NP_001189690.1\| galactose oxidase/kelch repeat-containing protein [Arabidopsis thaliana] gi\|330254149\|gb\|AEC09243.1\| galactose oxidase/kelch repeat-containing protein [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|334184717\|ref\|NP_001189689.1\| galactose oxidase/kelch repeat-containing protein [Arabidopsis thaliana] gi\|330254148\|gb\|AEC09242.1\| galactose oxidase/kelch repeat-containing protein [Arabidopsis thaliana]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		483
UNIPROTKB\|A8JAM0		1159	FAP50 "Coiled-coil domain-cont	0.356	0.148	0.337	2.2e-19
DICTYBASE\|DDB_G0270750		485	DDB_G0270750 "Kelch repeat-con	0.447	0.445	0.286	8.6e-19
DICTYBASE\|DDB_G0272080		1523	gacHH "RhoGAP domain-containin	0.236	0.074	0.365	1.4e-18
DICTYBASE\|DDB_G0268860		943	rngB "Kelch repeat-containing	0.449	0.230	0.284	9.7e-17
GENEDB_PFALCIPARUM\|PF14_0630		889	PF14_0630 "protein serine/thre	0.445	0.241	0.272	3.5e-16
UNIPROTKB\|Q8IKH5		889	PF14_0630 "Serine/threonine-pr	0.445	0.241	0.272	3.5e-16
UNIPROTKB\|F1P3T0		252	RABEPK "Rab9 effector protein	0.347	0.666	0.303	5.5e-16
UNIPROTKB\|F1RZU3		2074	HCFC1 "Uncharacterized protein	0.451	0.105	0.316	1e-15
UNIPROTKB\|Q5EA50		372	RABEPK "Rab9 effector protein	0.459	0.596	0.275	1.2e-15
UNIPROTKB\|E1BGF3		2001	Bt.44379 "Uncharacterized prot	0.438	0.105	0.319	1.3e-15

UNIPROTKB\|A8JAM0 FAP50 "Coiled-coil domain-containing protein lobo homolog" [Chlamydomonas reinhardtii (taxid:3055)]	Back alignment and assigned GO terms

 Score = 263 (97.6 bits), Expect = 2.2e-19, P = 2.2e-19
 Identities = 61/181 (33%), Positives = 91/181 (50%)

Query:    14 GTVPQPRSGHSAV-NIGKSKVVVFGG-LVDKRFLSDVVVYDIDNKLWFQPECTGNGSNGQ 71
             G  P PR  H+A  +   +++VVFGG   +++ L+D+   D+D+  WF+P   G      
Sbjct:   344 GEKPPPRYNHAACYDEENNRLVVFGGRTAERKRLNDIYFLDLDSWTWFKPSTEGTA---- 399

Query:    72 VGPGPRAFHIAVAIDCHMFIFGGRFGSRRLGDFWVLDTDIWQWSELTSFGDLPSPRDFAA 131
               P PR   +A      M +FGG     R  D ++LD   WQWS+    G  PSPR  A 
Sbjct:   400 --PTPREQAVATFWAGSMVLFGGHAIGGRTNDLFLLDLGAWQWSQPAFSGTAPSPRQ-AC 456

Query:   132 ASAIGNRKIVMYGGWDGKKWLSDVYVLDTISLEWMQLPVTGSVPPPRCGHTATMVEKRLL 191
             A  IG+  ++   G      L D++V+D +S  W ++P  G VPPPR  H  T+   +L 
Sbjct:   457 ALCIGHGNLLFVHGGRNNFVLEDLHVMDFVSKNWTEIPCEGRVPPPRHSHRITVHRDQLY 516

Query:   192 I 192
             +
Sbjct:   517 L 517

GO:0031514 "motile cilium" evidence=IDA

DICTYBASE\|DDB_G0270750 DDB_G0270750 "Kelch repeat-containing protein" [Dictyostelium discoideum (taxid:44689)]	Back alignment and assigned GO terms

DICTYBASE\|DDB_G0272080 gacHH "RhoGAP domain-containing protein" [Dictyostelium discoideum (taxid:44689)]	Back alignment and assigned GO terms

DICTYBASE\|DDB_G0268860 rngB "Kelch repeat-containing protein" [Dictyostelium discoideum (taxid:44689)]	Back alignment and assigned GO terms

GENEDB_PFALCIPARUM\|PF14_0630 PF14_0630 "protein serine/threonine phosphatase" [Plasmodium falciparum (taxid:5833)]	Back alignment and assigned GO terms

UNIPROTKB\|Q8IKH5 PF14_0630 "Serine/threonine-protein phosphatase" [Plasmodium falciparum 3D7 (taxid:36329)]	Back alignment and assigned GO terms

UNIPROTKB\|F1P3T0 RABEPK "Rab9 effector protein with kelch motifs" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

UNIPROTKB\|F1RZU3 HCFC1 "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

UNIPROTKB\|Q5EA50 RABEPK "Rab9 effector protein with kelch motifs" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|E1BGF3 Bt.44379 "Uncharacterized protein" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	2.1.1	LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		483
PLN02153		341	PLN02153, PLN02153, epithiospecifier protein	8e-14
PLN02153		341	PLN02153, PLN02153, epithiospecifier protein	2e-12
PLN02193		470	PLN02193, PLN02193, nitrile-specifier protein	7e-11
PLN02193		470	PLN02193, PLN02193, nitrile-specifier protein	2e-09
PLN02193		470	PLN02193, PLN02193, nitrile-specifier protein	1e-07
pfam13415		48	pfam13415, Kelch_3, Galactose oxidase, central dom	1e-06
pfam13415		48	pfam13415, Kelch_3, Galactose oxidase, central dom	6e-06
pfam01344		46	pfam01344, Kelch_1, Kelch motif	6e-06
PLN02772		398	PLN02772, PLN02772, guanylate kinase	7e-06
pfam13418		49	pfam13418, Kelch_4, Galactose oxidase, central dom	1e-05
PLN02193		470	PLN02193, PLN02193, nitrile-specifier protein	2e-05
pfam01344		46	pfam01344, Kelch_1, Kelch motif	3e-05
pfam01344		46	pfam01344, Kelch_1, Kelch motif	5e-05
pfam13415		48	pfam13415, Kelch_3, Galactose oxidase, central dom	2e-04
PLN02193		470	PLN02193, PLN02193, nitrile-specifier protein	8e-04
pfam13964		50	pfam13964, Kelch_6, Kelch motif	8e-04
pfam13854		42	pfam13854, Kelch_5, Kelch motif	0.001
pfam13415		48	pfam13415, Kelch_3, Galactose oxidase, central dom	0.003
pfam13418		49	pfam13418, Kelch_4, Galactose oxidase, central dom	0.003
smart00612		47	smart00612, Kelch, Kelch domain	0.003

>gnl\|CDD\|177814 PLN02153, PLN02153, epithiospecifier protein	Back alignment and domain information

 Score = 72.3 bits (177), Expect = 8e-14
 Identities = 66/258 (25%), Positives = 98/258 (37%), Gaps = 10/258 (3%)

Query: 59  FQPECTGNGSNGQVGPGPRAFHIAVAIDCHMFIFGGRFGSRRL--GDFWVLDTDIWQWSE 116
            Q         G  GPGPR  H    +   ++ FGG          D +V D +   WS 
Sbjct: 5   LQGGWIKVEQKGGKGPGPRCSHGIAVVGDKLYSFGGELKPNEHIDKDLYVFDFNTHTWSI 64

Query: 117 LTSFGDLPSPRDFAAASAIGNRKIVMYGGWDGKKWLSDVYVLDTISLEW---MQLPVTGS 173
             + GD+P              K+ ++GG D K+  SD Y  DT+  EW    +L   G 
Sbjct: 65  APANGDVPRISCLGVRMVAVGTKLYIFGGRDEKREFSDFYSYDTVKNEWTFLTKLDEEGG 124

Query: 174 VPPPRCGHTATMVEKRLLIYGGRGGGGPIMGDLWALKGLIEEENETPG-WTQLKLPGQAP 232
            P  R  H+    E  + ++GG   GG +M      +  IE  N   G W QL  PG+  
Sbjct: 125 -PEARTFHSMASDENHVYVFGGVSKGG-LMKTPERFR-TIEAYNIADGKWVQLPDPGENF 181

Query: 233 SSRCGHTITSGGHYLLLFGGHGTGGWLSRYDIYYNDTI-ILDRLSAQWKRLPIGNEPPPA 291
             R G         + +  G  T         Y ++ +   D  S +W  +      P A
Sbjct: 182 EKRGGAGFAVVQGKIWVVYGFATSILPGGKSDYESNAVQFFDPASGKWTEVETTGAKPSA 241

Query: 292 RAYHSMTCLGSLYLLFGG 309
           R+  +   +G   ++FGG
Sbjct: 242 RSVFAHAVVGKYIIIFGG 259

Length = 341

>gnl\|CDD\|177814 PLN02153, PLN02153, epithiospecifier protein	Back alignment and domain information

>gnl\|CDD\|177844 PLN02193, PLN02193, nitrile-specifier protein	Back alignment and domain information

>gnl\|CDD\|177844 PLN02193, PLN02193, nitrile-specifier protein	Back alignment and domain information

>gnl\|CDD\|177844 PLN02193, PLN02193, nitrile-specifier protein	Back alignment and domain information

>gnl\|CDD\|222113 pfam13415, Kelch_3, Galactose oxidase, central domain	Back alignment and domain information

>gnl\|CDD\|222113 pfam13415, Kelch_3, Galactose oxidase, central domain	Back alignment and domain information

>gnl\|CDD\|201739 pfam01344, Kelch_1, Kelch motif	Back alignment and domain information

>gnl\|CDD\|215414 PLN02772, PLN02772, guanylate kinase	Back alignment and domain information

>gnl\|CDD\|205596 pfam13418, Kelch_4, Galactose oxidase, central domain	Back alignment and domain information

>gnl\|CDD\|177844 PLN02193, PLN02193, nitrile-specifier protein	Back alignment and domain information

>gnl\|CDD\|201739 pfam01344, Kelch_1, Kelch motif	Back alignment and domain information

>gnl\|CDD\|201739 pfam01344, Kelch_1, Kelch motif	Back alignment and domain information

>gnl\|CDD\|222113 pfam13415, Kelch_3, Galactose oxidase, central domain	Back alignment and domain information

>gnl\|CDD\|177844 PLN02193, PLN02193, nitrile-specifier protein	Back alignment and domain information

>gnl\|CDD\|206134 pfam13964, Kelch_6, Kelch motif	Back alignment and domain information

>gnl\|CDD\|222419 pfam13854, Kelch_5, Kelch motif	Back alignment and domain information

>gnl\|CDD\|222113 pfam13415, Kelch_3, Galactose oxidase, central domain	Back alignment and domain information

>gnl\|CDD\|205596 pfam13418, Kelch_4, Galactose oxidase, central domain	Back alignment and domain information

>gnl\|CDD\|128874 smart00612, Kelch, Kelch domain	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		483
KOG4693		392	consensus Uncharacterized conserved protein, conta	100.0
PLN02193		470	nitrile-specifier protein	100.0
PLN02153		341	epithiospecifier protein	100.0
KOG4441		571	consensus Proteins containing BTB/POZ and Kelch do	100.0
PLN02193		470	nitrile-specifier protein	100.0
PHA02713		557	hypothetical protein; Provisional	100.0
KOG4441		571	consensus Proteins containing BTB/POZ and Kelch do	100.0
PLN02153		341	epithiospecifier protein	100.0
KOG0379		482	consensus Kelch repeat-containing proteins [Genera	100.0
KOG4152		830	consensus Host cell transcription factor HCFC1 [Ce	100.0
TIGR03547		346	muta_rot_YjhT mutatrotase, YjhT family. Members of	100.0
PHA02713		557	hypothetical protein; Provisional	100.0
TIGR03548		323	mutarot_permut cyclically-permuted mutatrotase fam	100.0
PRK14131		376	N-acetylneuraminic acid mutarotase; Provisional	100.0
KOG4693		392	consensus Uncharacterized conserved protein, conta	100.0
PHA03098		534	kelch-like protein; Provisional	100.0
PHA03098		534	kelch-like protein; Provisional	100.0
KOG0379		482	consensus Kelch repeat-containing proteins [Genera	100.0
PHA02790		480	Kelch-like protein; Provisional	100.0
TIGR03548		323	mutarot_permut cyclically-permuted mutatrotase fam	100.0
KOG1230		521	consensus Protein containing repeated kelch motifs	100.0
PHA02790		480	Kelch-like protein; Provisional	100.0
PRK14131		376	N-acetylneuraminic acid mutarotase; Provisional	100.0
TIGR03547		346	muta_rot_YjhT mutatrotase, YjhT family. Members of	100.0
KOG1230		521	consensus Protein containing repeated kelch motifs	99.97
KOG2437		723	consensus Muskelin [Signal transduction mechanisms	99.97
KOG4152		830	consensus Host cell transcription factor HCFC1 [Ce	99.96
COG3055		381	Uncharacterized protein conserved in bacteria [Fun	99.77
COG3055		381	Uncharacterized protein conserved in bacteria [Fun	99.72
KOG2437		723	consensus Muskelin [Signal transduction mechanisms	99.58
PF13964		50	Kelch_6: Kelch motif	99.21
PF13964		50	Kelch_6: Kelch motif	99.11
PLN02772		398	guanylate kinase	99.01
PF01344		47	Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is	98.93
PF13415		49	Kelch_3: Galactose oxidase, central domain	98.93
PF13418		49	Kelch_4: Galactose oxidase, central domain; PDB: 2	98.9
PF07646		49	Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is	98.9
PF13415		49	Kelch_3: Galactose oxidase, central domain	98.9
PF13418		49	Kelch_4: Galactose oxidase, central domain; PDB: 2	98.87
PLN02772		398	guanylate kinase	98.78
PF01344		47	Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is	98.78
PF13854		42	Kelch_5: Kelch motif	98.69
PF07646		49	Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is	98.68
smart00612		47	Kelch Kelch domain.	98.62
PF13854		42	Kelch_5: Kelch motif	98.56
PF07250		243	Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP	98.52
smart00612		47	Kelch Kelch domain.	98.51
PF07250		243	Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP	98.34
PF03089		337	RAG2: Recombination activating protein 2; InterPro	98.28
TIGR01640		230	F_box_assoc_1 F-box protein interaction domain. Th	98.27
PF03089		337	RAG2: Recombination activating protein 2; InterPro	98.2
TIGR01640		230	F_box_assoc_1 F-box protein interaction domain. Th	98.08
PRK11138		394	outer membrane biogenesis protein BamB; Provisiona	97.12
PRK11138		394	outer membrane biogenesis protein BamB; Provisiona	97.09
PF07893		342	DUF1668: Protein of unknown function (DUF1668); In	97.03
PF12768		281	Rax2: Cortical protein marker for cell polarity	96.54
TIGR03300		377	assembly_YfgL outer membrane assembly lipoprotein	96.23
PRK13684		334	Ycf48-like protein; Provisional	96.19
KOG2055		514	consensus WD40 repeat protein [General function pr	96.09
PF13360		238	PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A	96.0
TIGR03300		377	assembly_YfgL outer membrane assembly lipoprotein	95.77
PRK13684		334	Ycf48-like protein; Provisional	95.55
PF12768		281	Rax2: Cortical protein marker for cell polarity	95.53
KOG2055		514	consensus WD40 repeat protein [General function pr	95.19
PF07893		342	DUF1668: Protein of unknown function (DUF1668); In	95.12
cd00094		194	HX Hemopexin-like repeats.; Hemopexin is a heme-bi	94.78
TIGR02800		417	propeller_TolB tol-pal system beta propeller repea	94.44
PRK04792		448	tolB translocation protein TolB; Provisional	94.35
TIGR02800		417	propeller_TolB tol-pal system beta propeller repea	93.94
PF05096		264	Glu_cyclase_2: Glutamine cyclotransferase; InterPr	93.85
PRK04922		433	tolB translocation protein TolB; Provisional	93.74
cd00094		194	HX Hemopexin-like repeats.; Hemopexin is a heme-bi	93.58
PRK05137		435	tolB translocation protein TolB; Provisional	93.34
PF08450		246	SGL: SMP-30/Gluconolaconase/LRE-like region; Inter	93.32
PF02897		414	Peptidase_S9_N: Prolyl oligopeptidase, N-terminal	93.13
PF09910		339	DUF2139: Uncharacterized protein conserved in arch	93.01
PRK04792		448	tolB translocation protein TolB; Provisional	92.88
PRK05137		435	tolB translocation protein TolB; Provisional	92.86
PRK00178		430	tolB translocation protein TolB; Provisional	92.71
PF12217		367	End_beta_propel: Catalytic beta propeller domain o	92.42
PRK00178		430	tolB translocation protein TolB; Provisional	92.41
PF05096		264	Glu_cyclase_2: Glutamine cyclotransferase; InterPr	92.11
PF08268		129	FBA_3: F-box associated domain; InterPro: IPR01318	91.87
PRK03629		429	tolB translocation protein TolB; Provisional	91.08
PF14870		302	PSII_BNR: Photosynthesis system II assembly factor	90.64
PF14870		302	PSII_BNR: Photosynthesis system II assembly factor	90.59
cd00200		289	WD40 WD40 domain, found in a number of eukaryotic	90.47
PF13360		238	PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A	90.4
cd00200		289	WD40 WD40 domain, found in a number of eukaryotic	90.02
PF02191		250	OLF: Olfactomedin-like domain; InterPro: IPR003112	89.87
PRK04043		419	tolB translocation protein TolB; Provisional	89.66
TIGR03075		527	PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan	89.62
PRK04922		433	tolB translocation protein TolB; Provisional	89.6
PF08450		246	SGL: SMP-30/Gluconolaconase/LRE-like region; Inter	89.46
PF03178		321	CPSF_A: CPSF A subunit region; InterPro: IPR004871	89.46
PF02897		414	Peptidase_S9_N: Prolyl oligopeptidase, N-terminal	89.19
KOG0310		487	consensus Conserved WD40 repeat-containing protein	89.18
TIGR03866		300	PQQ_ABC_repeats PQQ-dependent catabolism-associate	86.45
PRK11028		330	6-phosphogluconolactonase; Provisional	86.38
PF10282		345	Lactonase: Lactonase, 7-bladed beta-propeller; Int	86.18
PRK03629		429	tolB translocation protein TolB; Provisional	85.56
PRK02889		427	tolB translocation protein TolB; Provisional	85.14
PLN00033		398	photosystem II stability/assembly factor; Provisio	84.64
PF14583		386	Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C	84.59
PF08268		129	FBA_3: F-box associated domain; InterPro: IPR01318	83.61
PRK11028		330	6-phosphogluconolactonase; Provisional	80.3

>KOG4693 consensus Uncharacterized conserved protein, contains kelch repeat [General function prediction only]	Back alignment and domain information

Probab=100.00  E-value=2.5e-48  Score=346.81  Aligned_cols=351  Identities=23%  Similarity=0.363  Sum_probs=291.8

Q ss_pred             CcceEEceeCCCCCCCCCCCcceeEEEECCcEEEEEcccCCCc-----cccceEEEEcCCCcEEeeeec--CCC--CCCC
Q 011542            1 MHYWVRASSSDFGGTVPQPRSGHSAVNIGKSKVVVFGGLVDKR-----FLSDVVVYDIDNKLWFQPECT--GNG--SNGQ   71 (483)
Q Consensus         1 ~~~W~~~~~~~~~g~~p~~R~~h~~~~~~~~~l~v~GG~~~~~-----~~~~~~~yd~~~~~W~~~~~~--~~~--~~~~   71 (483)
                      |+.|+--..   +   -..|.+|+++.++ .+||.|||+..+.     .--|+++++..+.+|+++++.  ...  ..-+
T Consensus         1 m~~WTVHLe---G---GPrRVNHAavaVG-~riYSFGGYCsGedy~~~~piDVH~lNa~~~RWtk~pp~~~ka~i~~~yp   73 (392)
T KOG4693|consen    1 MATWTVHLE---G---GPRRVNHAAVAVG-SRIYSFGGYCSGEDYDAKDPIDVHVLNAENYRWTKMPPGITKATIESPYP   73 (392)
T ss_pred             CceEEEEec---C---Ccccccceeeeec-ceEEecCCcccccccccCCcceeEEeeccceeEEecCcccccccccCCCC
Confidence            788887652   2   2579999999999 5999999986432     234899999999999999872  211  1123


Q ss_pred             CCCCCcceeEEEEECCEEEEEccccC-CCCCccEEEEECCCCeEEEeecCCCCCCCCcccEEEEECCcEEEEEecCCCC-
Q 011542           72 VGPGPRAFHIAVAIDCHMFIFGGRFG-SRRLGDFWVLDTDIWQWSELTSFGDLPSPRDFAAASAIGNRKIVMYGGWDGK-  149 (483)
Q Consensus        72 ~~p~~R~~h~~~~~~~~iyv~GG~~~-~~~~~~~~~yd~~t~~W~~l~~~~~~p~~r~~~~~~~~~~~~iyv~GG~~~~-  149 (483)
                      ..|-.|++|+.+.+.+++|++||+++ ....|-+++||+++++|++....|.+|.+|.+|++|++++ .+|||||+... 
T Consensus        74 ~VPyqRYGHtvV~y~d~~yvWGGRND~egaCN~Ly~fDp~t~~W~~p~v~G~vPgaRDGHsAcV~gn-~MyiFGGye~~a  152 (392)
T KOG4693|consen   74 AVPYQRYGHTVVEYQDKAYVWGGRNDDEGACNLLYEFDPETNVWKKPEVEGFVPGARDGHSACVWGN-QMYIFGGYEEDA  152 (392)
T ss_pred             ccchhhcCceEEEEcceEEEEcCccCcccccceeeeeccccccccccceeeecCCccCCceeeEECc-EEEEecChHHHH
Confidence            45678999999999999999999987 5567889999999999999888889999999999999988 99999998654 


Q ss_pred             -cCCccEEEEECCCCceEEeccCCCCCCCCcCceEEEeCCEEEEEccCCCCCC-c--ccceecccccccccCCCCCeEEe
Q 011542          150 -KWLSDVYVLDTISLEWMQLPVTGSVPPPRCGHTATMVEKRLLIYGGRGGGGP-I--MGDLWALKGLIEEENETPGWTQL  225 (483)
Q Consensus       150 -~~~~~v~~yd~~t~~W~~i~~~~~~p~~r~~~~~~~~~~~lyv~GG~~~~~~-~--~~d~~~l~~~~~yd~~~~~W~~~  225 (483)
                       .+.++++.+|..|.+|+.+.+.|.+|.-|..|+++++++++|||||+..... +  .++.+ .+.+..+|..+..|...
T Consensus       153 ~~FS~d~h~ld~~TmtWr~~~Tkg~PprwRDFH~a~~~~~~MYiFGGR~D~~gpfHs~~e~Y-c~~i~~ld~~T~aW~r~  231 (392)
T KOG4693|consen  153 QRFSQDTHVLDFATMTWREMHTKGDPPRWRDFHTASVIDGMMYIFGGRSDESGPFHSIHEQY-CDTIMALDLATGAWTRT  231 (392)
T ss_pred             HhhhccceeEeccceeeeehhccCCCchhhhhhhhhhccceEEEeccccccCCCccchhhhh-cceeEEEeccccccccC
Confidence             6789999999999999999999999999999999999999999999876432 2  12333 36777889999999999


Q ss_pred             ccCCCCCCCCeeeEEEEeCCEEEEEcCCCCCCCCcccceeeCcEEEEEcCCCceEEccCCCCCCCCCcceEEEEECCEEE
Q 011542          226 KLPGQAPSSRCGHTITSGGHYLLLFGGHGTGGWLSRYDIYYNDTIILDRLSAQWKRLPIGNEPPPARAYHSMTCLGSLYL  305 (483)
Q Consensus       226 ~~~g~~p~~r~~~~~~~~~~~i~v~GG~~~~~~~~~~~~~~~~v~~yd~~~~~W~~v~~~~~~p~~R~~~~~~~~~~~i~  305 (483)
                      ...+..|..|..|++.++++++|+|||++..-     ..-.+++|.|||.+..|..|...+..|++|..+++++.++++|
T Consensus       232 p~~~~~P~GRRSHS~fvYng~~Y~FGGYng~l-----n~HfndLy~FdP~t~~W~~I~~~Gk~P~aRRRqC~~v~g~kv~  306 (392)
T KOG4693|consen  232 PENTMKPGGRRSHSTFVYNGKMYMFGGYNGTL-----NVHFNDLYCFDPKTSMWSVISVRGKYPSARRRQCSVVSGGKVY  306 (392)
T ss_pred             CCCCcCCCcccccceEEEcceEEEecccchhh-----hhhhcceeecccccchheeeeccCCCCCcccceeEEEECCEEE
Confidence            87788999999999999999999999987632     4567999999999999999999888899999999999999999


Q ss_pred             EEccCCCCCccCcEEEEcCCCCcccceeecCCCCCCCCCCcccccccccceecccccccchhHhhhhhhcCceee
Q 011542          306 LFGGFDGKSTFGDIWWLVPEEDPIAKRYTESPPKVLPENKDVGMENYNSQFAVKESQRESSAIVELQKKLDISVS  380 (483)
Q Consensus       306 v~GG~~~~~~~~d~w~l~~~~d~~~~~w~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~l~~l~~~~~~~~~  380 (483)
                      +|||........        -.| ++--..+++..+.+.+.+++      |+|.|++++++.+.+|+.+++++.+
T Consensus       307 LFGGTsP~~~~~--------~Sp-t~~~G~~~~~~LiD~SDLHv------LDF~PsLKTLa~~~Vl~~~ldqs~L  366 (392)
T KOG4693|consen  307 LFGGTSPLPCHP--------LSP-TNYNGMISPSGLIDLSDLHV------LDFAPSLKTLAMQSVLMFELDQSEL  366 (392)
T ss_pred             EecCCCCCCCCC--------CCc-cccCCCCCccccccccccee------eecChhHHHHHHHHHHHHhhhhhhc
Confidence            999976532111        001 11122445556777888887      9999999999999999999998766

>PLN02193 nitrile-specifier protein	Back alignment and domain information

>PLN02153 epithiospecifier protein	Back alignment and domain information

>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only]	Back alignment and domain information

>PLN02193 nitrile-specifier protein	Back alignment and domain information

>PHA02713 hypothetical protein; Provisional	Back alignment and domain information

>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only]	Back alignment and domain information

>PLN02153 epithiospecifier protein	Back alignment and domain information

>KOG0379 consensus Kelch repeat-containing proteins [General function prediction only]	Back alignment and domain information

>KOG4152 consensus Host cell transcription factor HCFC1 [Cell cycle control, cell division, chromosome partitioning; Transcription]	Back alignment and domain information

>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family	Back alignment and domain information

>PHA02713 hypothetical protein; Provisional	Back alignment and domain information

>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein	Back alignment and domain information

>PRK14131 N-acetylneuraminic acid mutarotase; Provisional	Back alignment and domain information

>KOG4693 consensus Uncharacterized conserved protein, contains kelch repeat [General function prediction only]	Back alignment and domain information

>PHA03098 kelch-like protein; Provisional	Back alignment and domain information

>PHA03098 kelch-like protein; Provisional	Back alignment and domain information

>KOG0379 consensus Kelch repeat-containing proteins [General function prediction only]	Back alignment and domain information

>PHA02790 Kelch-like protein; Provisional	Back alignment and domain information

>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein	Back alignment and domain information

>KOG1230 consensus Protein containing repeated kelch motifs [General function prediction only]	Back alignment and domain information

>PHA02790 Kelch-like protein; Provisional	Back alignment and domain information

>PRK14131 N-acetylneuraminic acid mutarotase; Provisional	Back alignment and domain information

>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family	Back alignment and domain information

>KOG1230 consensus Protein containing repeated kelch motifs [General function prediction only]	Back alignment and domain information

>KOG2437 consensus Muskelin [Signal transduction mechanisms]	Back alignment and domain information

>KOG4152 consensus Host cell transcription factor HCFC1 [Cell cycle control, cell division, chromosome partitioning; Transcription]	Back alignment and domain information

>COG3055 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>COG3055 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>KOG2437 consensus Muskelin [Signal transduction mechanisms]	Back alignment and domain information

>PF13964 Kelch_6: Kelch motif	Back alignment and domain information

>PF13964 Kelch_6: Kelch motif	Back alignment and domain information

>PLN02772 guanylate kinase	Back alignment and domain information

>PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified []	Back alignment and domain information

>PF13415 Kelch_3: Galactose oxidase, central domain	Back alignment and domain information

>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B	Back alignment and domain information

>PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified []	Back alignment and domain information

>PF13415 Kelch_3: Galactose oxidase, central domain	Back alignment and domain information

>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B	Back alignment and domain information

>PLN02772 guanylate kinase	Back alignment and domain information

>PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified []	Back alignment and domain information

>PF13854 Kelch_5: Kelch motif	Back alignment and domain information

>PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified []	Back alignment and domain information

>smart00612 Kelch Kelch domain	Back alignment and domain information

>PF13854 Kelch_5: Kelch motif	Back alignment and domain information

>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes	Back alignment and domain information

>smart00612 Kelch Kelch domain	Back alignment and domain information

>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes	Back alignment and domain information

>PF03089 RAG2: Recombination activating protein 2; InterPro: IPR004321 The variable portion of the genes encoding immunoglobulins and T cell receptors are assembled from component V, D, and J DNA segments by a site-specific recombination reaction termed V(D)J recombination	Back alignment and domain information

>TIGR01640 F_box_assoc_1 F-box protein interaction domain	Back alignment and domain information

>PF03089 RAG2: Recombination activating protein 2; InterPro: IPR004321 The variable portion of the genes encoding immunoglobulins and T cell receptors are assembled from component V, D, and J DNA segments by a site-specific recombination reaction termed V(D)J recombination	Back alignment and domain information

>TIGR01640 F_box_assoc_1 F-box protein interaction domain	Back alignment and domain information

>PRK11138 outer membrane biogenesis protein BamB; Provisional	Back alignment and domain information

>PRK11138 outer membrane biogenesis protein BamB; Provisional	Back alignment and domain information

>PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function	Back alignment and domain information

>PF12768 Rax2: Cortical protein marker for cell polarity	Back alignment and domain information

>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL	Back alignment and domain information

>PRK13684 Ycf48-like protein; Provisional	Back alignment and domain information

>KOG2055 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A	Back alignment and domain information

>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL	Back alignment and domain information

>PRK13684 Ycf48-like protein; Provisional	Back alignment and domain information

>PF12768 Rax2: Cortical protein marker for cell polarity	Back alignment and domain information

>KOG2055 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function	Back alignment and domain information

>cd00094 HX Hemopexin-like repeats	Back alignment and domain information

>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB	Back alignment and domain information

>PRK04792 tolB translocation protein TolB; Provisional	Back alignment and domain information

>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB	Back alignment and domain information

>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2	Back alignment and domain information

>PRK04922 tolB translocation protein TolB; Provisional	Back alignment and domain information

>cd00094 HX Hemopexin-like repeats	Back alignment and domain information

>PRK05137 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species	Back alignment and domain information

>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families	Back alignment and domain information

>PF09910 DUF2139: Uncharacterized protein conserved in archaea (DUF2139); InterPro: IPR016675 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function	Back alignment and domain information

>PRK04792 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK05137 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK00178 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PF12217 End_beta_propel: Catalytic beta propeller domain of bacteriophage endosialidase; InterPro: IPR024428 This entry represents the beta propeller domain of endosialidases, which consists of catalytically active part of the enzymes	Back alignment and domain information

>PRK00178 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2	Back alignment and domain information

>PF08268 FBA_3: F-box associated domain; InterPro: IPR013187 This domain occurs in a diverse superfamily of genes in plants	Back alignment and domain information

>PRK03629 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A	Back alignment and domain information

>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A	Back alignment and domain information

>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto

Back alignment and domain information

>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A	Back alignment and domain information

Back alignment and domain information

>PF02191 OLF: Olfactomedin-like domain; InterPro: IPR003112 The olfactomedin-domain was first identified in olfactomedin, an extracellular matrix protein of the olfactory neuroepithelium []	Back alignment and domain information

>PRK04043 tolB translocation protein TolB; Provisional	Back alignment and domain information

>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family	Back alignment and domain information

>PRK04922 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species	Back alignment and domain information

>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit	Back alignment and domain information

>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families	Back alignment and domain information

>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein	Back alignment and domain information

>PRK11028 6-phosphogluconolactonase; Provisional	Back alignment and domain information

>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3	Back alignment and domain information

>PRK03629 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK02889 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PLN00033 photosystem II stability/assembly factor; Provisional	Back alignment and domain information

>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A	Back alignment and domain information

>PF08268 FBA_3: F-box associated domain; InterPro: IPR013187 This domain occurs in a diverse superfamily of genes in plants	Back alignment and domain information

>PRK11028 6-phosphogluconolactonase; Provisional	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		483
2zwa_A		695	Leucine carboxyl methyltransferase 2; HET: SAH CIT	8e-54
2zwa_A		695	Leucine carboxyl methyltransferase 2; HET: SAH CIT	1e-40
2uvk_A		357	YJHT; unknown function, hypothetical protein, sial	5e-30
2uvk_A		357	YJHT; unknown function, hypothetical protein, sial	2e-22
2uvk_A		357	YJHT; unknown function, hypothetical protein, sial	9e-16
1zgk_A		308	Kelch-like ECH-associated protein 1; beta-propelle	2e-29
1zgk_A		308	Kelch-like ECH-associated protein 1; beta-propelle	6e-19
1zgk_A		308	Kelch-like ECH-associated protein 1; beta-propelle	3e-18
2xn4_A		302	Kelch-like protein 2; structural protein, cytoskel	9e-29
2xn4_A		302	Kelch-like protein 2; structural protein, cytoskel	5e-20
2xn4_A		302	Kelch-like protein 2; structural protein, cytoskel	6e-16
2xn4_A		302	Kelch-like protein 2; structural protein, cytoskel	3e-11
2vpj_A		301	Kelch-like protein 12; adaptor protein, WNT signal	5e-27
2vpj_A		301	Kelch-like protein 12; adaptor protein, WNT signal	1e-17
2vpj_A		301	Kelch-like protein 12; adaptor protein, WNT signal	5e-10
3ii7_A		306	Kelch-like protein 7; protein-binding, kelch-repea	2e-26
3ii7_A		306	Kelch-like protein 7; protein-binding, kelch-repea	7e-16
3ii7_A		306	Kelch-like protein 7; protein-binding, kelch-repea	6e-15
3ii7_A		306	Kelch-like protein 7; protein-binding, kelch-repea	4e-09
4asc_A		315	Kelch repeat and BTB domain-containing protein 5;	2e-21
4asc_A		315	Kelch repeat and BTB domain-containing protein 5;	3e-15
2woz_A		318	Kelch repeat and BTB domain-containing protein 10;	2e-21
2woz_A		318	Kelch repeat and BTB domain-containing protein 10;	3e-15
1k3i_A		656	Galactose oxidase precursor; blade beta propeller,	5e-08
1k3i_A		656	Galactose oxidase precursor; blade beta propeller,	2e-07
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	5e-06

>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695	Back alignment and structure

 Score =  191 bits (485), Expect = 8e-54
 Identities = 58/334 (17%), Positives = 106/334 (31%), Gaps = 36/334 (10%)

Query: 1   MHYWVRASSSDFGGTVPQPRSGHSAVNIGKSKVVVFGGLVDKRFLSDVVVYDIDNKLWFQ 60
           +    +    +     P  R        G + V   GG    R +++++   I       
Sbjct: 373 VDEDYQLLECEC----PINRKFGDVDVAG-NDVFYMGGSNPYR-VNEILQLSIHYDKIDM 426

Query: 61  PECTGNGSNGQVGPGPRAFHIAVAI--DCHMFIFGGRFGSRR-LGDFWVLDTDIWQWSEL 117
                + S     P  R  H    I  +  + + GGR    + L D W+ D    +WS +
Sbjct: 427 KNIEVSSSEV---PVARMCHTFTTISRNNQLLLIGGRKAPHQGLSDNWIFDMKTREWSMI 483

Query: 118 TSFGDLPSPRDFAAASAIGNRKIVMYGGWDGKKWLSDVYVLDTISLEWMQLPVTGSVPPP 177
                L   R   +A ++ +  +++ GG         + + +     +  +         
Sbjct: 484 ---KSLSHTRFRHSACSLPDGNVLILGGVTEG---PAMLLYNVTEEIFKDVTPKDEFFQN 537

Query: 178 RCGHTA----TMVEKRLLIYGGRGGGGPIMGDLWALKGLIEEENETPGWTQLKLPGQAPS 233
                      + ++ +++ GG      +       K   + EN T   T +K       
Sbjct: 538 SLVSAGLEFDPVSKQGIILGGGFMDQTTVSDKAIIFK--YDAENATEPITVIKKLQHPLF 595

Query: 234 SRCGHTITS-GGHYLLLFGGHGTGGWLSRYDIYYNDTIILDRLSAQWKRLPIGN----EP 288
            R G  I       LL+ GG    G         N  I LD LS     +PI      + 
Sbjct: 596 QRYGSQIKYITPRKLLIVGGTSPSGLFD----RTNSIISLDPLSETLTSIPISRRIWEDH 651

Query: 289 PPARAYHSMTCL--GSLYLLFGGFDGKSTFGDIW 320
               A  S+     G+++++ GG      FG + 
Sbjct: 652 SLMLAGFSLVSTSMGTIHIIGGGATCYG-FGSVT 684

PyMOL of 2zwa

>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695	Back alignment and structure

>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357	Back alignment and structure

>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357	Back alignment and structure

>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357	Back alignment and structure

>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308	Back alignment and structure

>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308	Back alignment and structure

>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308	Back alignment and structure

>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302	Back alignment and structure

>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302	Back alignment and structure

>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302	Back alignment and structure

>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302	Back alignment and structure

>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301	Back alignment and structure

>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301	Back alignment and structure

>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301	Back alignment and structure

>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306	Back alignment and structure

>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306	Back alignment and structure

>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306	Back alignment and structure

>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306	Back alignment and structure

>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315	Back alignment and structure

>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315	Back alignment and structure

>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318	Back alignment and structure

>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318	Back alignment and structure

>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Length = 656	Back alignment and structure

>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Length = 656	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		483
1zgk_A		308	Kelch-like ECH-associated protein 1; beta-propelle	100.0
2xn4_A		302	Kelch-like protein 2; structural protein, cytoskel	100.0
3ii7_A		306	Kelch-like protein 7; protein-binding, kelch-repea	100.0
2vpj_A		301	Kelch-like protein 12; adaptor protein, WNT signal	100.0
2xn4_A		302	Kelch-like protein 2; structural protein, cytoskel	100.0
1zgk_A		308	Kelch-like ECH-associated protein 1; beta-propelle	100.0
3ii7_A		306	Kelch-like protein 7; protein-binding, kelch-repea	100.0
2vpj_A		301	Kelch-like protein 12; adaptor protein, WNT signal	100.0
2uvk_A		357	YJHT; unknown function, hypothetical protein, sial	100.0
4asc_A		315	Kelch repeat and BTB domain-containing protein 5;	100.0
4asc_A		315	Kelch repeat and BTB domain-containing protein 5;	100.0
2woz_A		318	Kelch repeat and BTB domain-containing protein 10;	100.0
2woz_A		318	Kelch repeat and BTB domain-containing protein 10;	100.0
2zwa_A		695	Leucine carboxyl methyltransferase 2; HET: SAH CIT	100.0
2uvk_A		357	YJHT; unknown function, hypothetical protein, sial	100.0
2zwa_A		695	Leucine carboxyl methyltransferase 2; HET: SAH CIT	100.0
1k3i_A		656	Galactose oxidase precursor; blade beta propeller,	100.0
1k3i_A		656	Galactose oxidase precursor; blade beta propeller,	99.96
3mbr_X		243	Glutamine cyclotransferase; beta-propeller; 1.44A	97.74
3dsm_A		328	Uncharacterized protein bacuni_02894; seven_blated	97.63
3dsm_A		328	Uncharacterized protein bacuni_02894; seven_blated	97.62
3nol_A		262	Glutamine cyclotransferase; beta-propeller, glutam	97.42
3v9f_A		781	Two-component system sensor histidine kinase/RESP	97.37
3mbr_X		243	Glutamine cyclotransferase; beta-propeller; 1.44A	97.29
3q7m_A		376	Lipoprotein YFGL, BAMB; beta-propeller, BAM comple	97.28
4ery_A		312	WD repeat-containing protein 5; WD40, WIN motif, b	97.14
4a2l_A		795	BT_4663, two-component system sensor histidine kin	97.06
3nol_A		262	Glutamine cyclotransferase; beta-propeller, glutam	97.03
4aez_A		401	CDC20, WD repeat-containing protein SLP1; cell cyc	97.02
2iwa_A		266	Glutamine cyclotransferase; pyroglutamate, acyltra	96.95
3nok_A		268	Glutaminyl cyclase; beta-propeller, cyclotransfera	96.94
1k8k_C		372	P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-	96.87
1l0q_A		391	Surface layer protein; SLP, S-layer, 7-bladed beta	96.76
1gxr_A		337	ESG1, transducin-like enhancer protein 1; transcri	96.74
1rwi_B		270	Serine/threonine-protein kinase PKND; beta propell	96.73
2hqs_A		415	Protein TOLB; TOLB, PAL, TOL, transport protein-li	96.72
1q7f_A		286	NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL	96.63
2xbg_A		327	YCF48-like protein; photosynthesis, photosystem II	96.57
3nok_A		268	Glutaminyl cyclase; beta-propeller, cyclotransfera	96.56
3jrp_A		379	Fusion protein of protein transport protein SEC13	96.55
2hqs_A		415	Protein TOLB; TOLB, PAL, TOL, transport protein-li	96.55
2iwa_A		266	Glutamine cyclotransferase; pyroglutamate, acyltra	96.52
2ojh_A		297	Uncharacterized protein ATU1656/AGR_C_3050; TOLB,	96.52
3bws_A		433	Protein LP49; two-domain, immunoglobulin-like, 7-b	96.44
2xbg_A		327	YCF48-like protein; photosynthesis, photosystem II	96.33
3ow8_A		321	WD repeat-containing protein 61; structural genomi	96.32
1l0q_A		391	Surface layer protein; SLP, S-layer, 7-bladed beta	96.31
3v9f_A		781	Two-component system sensor histidine kinase/RESP	96.29
4a2l_A		795	BT_4663, two-component system sensor histidine kin	96.27
3zwl_B		369	Eukaryotic translation initiation factor 3 subuni;	96.23
2z2n_A		299	Virginiamycin B lyase; seven-bladed beta-propeller	96.22
3q7m_A		376	Lipoprotein YFGL, BAMB; beta-propeller, BAM comple	96.18
3bws_A		433	Protein LP49; two-domain, immunoglobulin-like, 7-b	96.16
1p22_A		435	F-BOX/WD-repeat protein 1A; ubiquitination, degrad	96.15
4ery_A		312	WD repeat-containing protein 5; WD40, WIN motif, b	96.13
3ott_A		758	Two-component system sensor histidine kinase; beta	96.1
2z2n_A		299	Virginiamycin B lyase; seven-bladed beta-propeller	96.07
1gxr_A		337	ESG1, transducin-like enhancer protein 1; transcri	96.04
2xdw_A		710	Prolyl endopeptidase; alpha/beta-hydrolase, amnesi	96.02
3ow8_A		321	WD repeat-containing protein 61; structural genomi	95.98
4gga_A		420	P55CDC, cell division cycle protein 20 homolog; ce	95.92
3jro_A		753	Fusion protein of protein transport protein SEC13	95.91
1r5m_A		425	SIR4-interacting protein SIF2; transcription corep	95.88
3vgz_A		353	Uncharacterized protein YNCE; beta-propeller, prot	95.76
2ojh_A		297	Uncharacterized protein ATU1656/AGR_C_3050; TOLB,	95.64
3vgz_A		353	Uncharacterized protein YNCE; beta-propeller, prot	95.6
3azo_A		662	Aminopeptidase; POP family, hydrolase; 2.00A {Stre	95.59
1nir_A		543	Nitrite reductase; hemoprotein, denitrification, d	95.58
1k8k_C		372	P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-	95.57
3e5z_A		296	Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco	95.55
2qc5_A		300	Streptogramin B lactonase; beta propeller, lyase;	95.53
3mkq_A		814	Coatomer beta'-subunit; beta-propeller, alpha-sole	95.44
2z3z_A		706	Dipeptidyl aminopeptidase IV; peptidase family S9,	95.44
2xdw_A		710	Prolyl endopeptidase; alpha/beta-hydrolase, amnesi	95.42
2ovr_B		445	FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40	95.38
2qc5_A		300	Streptogramin B lactonase; beta propeller, lyase;	95.35
1vyh_C		410	Platelet-activating factor acetylhydrolase IB alph	95.31
2z3z_A		706	Dipeptidyl aminopeptidase IV; peptidase family S9,	95.27
3scy_A		361	Hypothetical bacterial 6-phosphogluconolactonase;	95.24
3zwl_B		369	Eukaryotic translation initiation factor 3 subuni;	95.17
3dwl_C		377	Actin-related protein 2/3 complex subunit 1; prope	95.12
4g56_B		357	MGC81050 protein; protein arginine methyltransfera	95.11
3g4e_A		297	Regucalcin; six bladed beta-propeller, gluconolcat	95.07
1kb0_A		677	Quinohemoprotein alcohol dehydrogenase; beta-prope	95.05
1qhu_A		460	Protein (hemopexin); beta propeller, HAEM binding	95.03
2bkl_A		695	Prolyl endopeptidase; mechanistic study, celiac sp	95.01
2ovr_B		445	FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40	94.98
3e5z_A		296	Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco	94.98
1pjx_A		314	Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries	94.98
3hfq_A		347	Uncharacterized protein LP_2219; Q88V64_lacpl, NES	94.96
4gqb_B		344	Methylosome protein 50; TIM barrel, beta-propeller	94.96
3u4y_A		331	Uncharacterized protein; structural genomics, PSI-	94.94
2ecf_A		741	Dipeptidyl peptidase IV; prolyl oligopeptidase fam	94.94
2bkl_A		695	Prolyl endopeptidase; mechanistic study, celiac sp	94.93
3fm0_A		345	Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r	94.89
1rwi_B		270	Serine/threonine-protein kinase PKND; beta propell	94.8
3iuj_A		693	Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas	94.71
1yr2_A		741	Prolyl oligopeptidase; prolyl endopeptidase, mecha	94.7
2ecf_A		741	Dipeptidyl peptidase IV; prolyl oligopeptidase fam	94.7
3hfq_A		347	Uncharacterized protein LP_2219; Q88V64_lacpl, NES	94.68
1p22_A		435	F-BOX/WD-repeat protein 1A; ubiquitination, degrad	94.66
3jrp_A		379	Fusion protein of protein transport protein SEC13	94.56
1qhu_A		460	Protein (hemopexin); beta propeller, HAEM binding	94.5
3mkq_A		814	Coatomer beta'-subunit; beta-propeller, alpha-sole	94.5
1r5m_A		425	SIR4-interacting protein SIF2; transcription corep	94.46
3v7d_B		464	Cell division control protein 4; WD 40 domain, pho	94.44
1vyh_C		410	Platelet-activating factor acetylhydrolase IB alph	94.39
1got_B		340	GT-beta; complex (GTP-binding/transducer), G prote	94.34
2aq5_A		402	Coronin-1A; WD40 repeat, 7-bladed beta-propeller,	94.32
3c5m_A		396	Oligogalacturonate lyase; blade-shaped beta-propel	94.31
1ri6_A		343	Putative isomerase YBHE; 7-bladed propeller, enzym	94.24
3vl1_A		420	26S proteasome regulatory subunit RPN14; beta-prop	94.2
1sq9_A		397	Antiviral protein SKI8; WD repeat, beta-transducin	94.09
2pm7_B		297	Protein transport protein SEC13, protein transport	94.08
3azo_A		662	Aminopeptidase; POP family, hydrolase; 2.00A {Stre	94.07
1pgu_A		615	Actin interacting protein 1; WD repeat, seven-blad	94.05
3fvz_A		329	Peptidyl-glycine alpha-amidating monooxygenase; be	93.83
3ei3_B		383	DNA damage-binding protein 2; UV-damage, DDB, nucl	93.58
4ggc_A		318	P55CDC, cell division cycle protein 20 homolog; ce	93.58
2dg1_A		333	DRP35, lactonase; beta propeller, hydrolase; 1.72A	93.47
1pgu_A		615	Actin interacting protein 1; WD repeat, seven-blad	93.36
2ad6_A		571	Methanol dehydrogenase subunit 1; PQQ configuratio	93.23
2hes_X		330	YDR267CP; beta-propeller, WD40 repeat, biosyntheti	93.2
1qks_A		567	Cytochrome CD1 nitrite reductase; enzyme, oxidored	93.13
4aow_A		340	Guanine nucleotide-binding protein subunit beta-2;	93.09
1pjx_A		314	Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries	93.03
3v7d_B		464	Cell division control protein 4; WD 40 domain, pho	92.94
1ri6_A		343	Putative isomerase YBHE; 7-bladed propeller, enzym	92.92
2pm9_A		416	Protein WEB1, protein transport protein SEC31; bet	92.77
3g4e_A		297	Regucalcin; six bladed beta-propeller, gluconolcat	92.75
1got_B		340	GT-beta; complex (GTP-binding/transducer), G prote	92.74
4e54_B		435	DNA damage-binding protein 2; beta barrel, double	92.69
2ynn_A		304	Coatomer subunit beta'; protein transport, peptide	92.6
4aez_A		401	CDC20, WD repeat-containing protein SLP1; cell cyc	92.55
3pe7_A		388	Oligogalacturonate lyase; seven-bladed beta-propel	92.53
4g56_B		357	MGC81050 protein; protein arginine methyltransfera	92.44
4gqb_B		344	Methylosome protein 50; TIM barrel, beta-propeller	92.11
1yr2_A		741	Prolyl oligopeptidase; prolyl endopeptidase, mecha	92.07
1sq9_A		397	Antiviral protein SKI8; WD repeat, beta-transducin	92.03
4a11_B		408	DNA excision repair protein ERCC-8; DNA binding pr	92.03
2vdu_B		450	TRNA (guanine-N(7)-)-methyltransferase- associated	92.02
1jmx_B		349	Amine dehydrogenase; oxidoreductase; HET: TRQ HEC;	91.98
1yfq_A		342	Cell cycle arrest protein BUB3; WD repeat WD40 rep	91.89
1nir_A		543	Nitrite reductase; hemoprotein, denitrification, d	91.89
3dwl_C		377	Actin-related protein 2/3 complex subunit 1; prope	91.86
3fm0_A		345	Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r	91.73
2dg1_A		333	DRP35, lactonase; beta propeller, hydrolase; 1.72A	91.61
3sfz_A		1249	APAF-1, apoptotic peptidase activating factor 1; a	91.59
3u4y_A		331	Uncharacterized protein; structural genomics, PSI-	91.55
3dr2_A		305	Exported gluconolactonase; gluconolactonase SMP-30	91.25
2vdu_B		450	TRNA (guanine-N(7)-)-methyltransferase- associated	90.91
3bg1_A		316	Protein SEC13 homolog; NPC, transport, WD repeat,	90.9
1xfd_A		723	DIP, dipeptidyl aminopeptidase-like protein 6, dip	90.58
3b7f_A		394	Glycosyl hydrolase, BNR repeat; 7-bladed beta-prop	90.53
2fp8_A		322	Strictosidine synthase; six bladed beta propeller	90.53
3no2_A		276	Uncharacterized protein; six-bladed beta-propeller	90.51
1q7f_A		286	NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL	90.22
3dr2_A		305	Exported gluconolactonase; gluconolactonase SMP-30	90.18
1erj_A		393	Transcriptional repressor TUP1; beta-propeller, tr	90.18
2xyi_A		430	Probable histone-binding protein CAF1; transcripti	90.16
4a11_B		408	DNA excision repair protein ERCC-8; DNA binding pr	90.0
2hes_X		330	YDR267CP; beta-propeller, WD40 repeat, biosyntheti	89.69
2pm9_A		416	Protein WEB1, protein transport protein SEC31; bet	89.58
2aq5_A		402	Coronin-1A; WD40 repeat, 7-bladed beta-propeller,	89.57
3pe7_A		388	Oligogalacturonate lyase; seven-bladed beta-propel	89.5
3jro_A		753	Fusion protein of protein transport protein SEC13	89.34
2pbi_B		354	Guanine nucleotide-binding protein subunit beta 5;	89.26
2ymu_A		577	WD-40 repeat protein; unknown function, two domain	89.26
2gop_A		347	Trilobed protease; beta propeller, open velcro, hy	89.1
3scy_A		361	Hypothetical bacterial 6-phosphogluconolactonase;	88.9
2ghs_A		326	AGR_C_1268P; regucalcin, structural genomics, join	88.84
2pbi_B		354	Guanine nucleotide-binding protein subunit beta 5;	88.83
3c5m_A		396	Oligogalacturonate lyase; blade-shaped beta-propel	88.6
3lrv_A		343	PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu	88.5
3ott_A		758	Two-component system sensor histidine kinase; beta	88.4
1kb0_A		677	Quinohemoprotein alcohol dehydrogenase; beta-prope	88.4
3k26_A		366	Polycomb protein EED; WD40, structural genomics, N	88.32
2fp8_A		322	Strictosidine synthase; six bladed beta propeller	88.3
3sfz_A		1249	APAF-1, apoptotic peptidase activating factor 1; a	88.28
4e54_B		435	DNA damage-binding protein 2; beta barrel, double	88.12
3odt_A		313	Protein DOA1; ubiquitin, nuclear protein; HET: MSE	88.0
2gop_A		347	Trilobed protease; beta propeller, open velcro, hy	87.91
4gga_A		420	P55CDC, cell division cycle protein 20 homolog; ce	87.61
3dm0_A		694	Maltose-binding periplasmic protein fused with RAC	87.28
2p4o_A		306	Hypothetical protein; putative lactonase, structur	87.17
3i2n_A		357	WD repeat-containing protein 92; WD40 repeats, str	86.94
3ei3_B		383	DNA damage-binding protein 2; UV-damage, DDB, nucl	86.27
3no2_A		276	Uncharacterized protein; six-bladed beta-propeller	86.26
1yfq_A		342	Cell cycle arrest protein BUB3; WD repeat WD40 rep	86.04
3o4h_A		582	Acylamino-acid-releasing enzyme; alpha/beta hydrol	85.79
1pex_A		207	Collagenase-3, MMP-13; C-terminal hemopexin-like d	85.29
3vl1_A		420	26S proteasome regulatory subunit RPN14; beta-prop	85.27
3odt_A		313	Protein DOA1; ubiquitin, nuclear protein; HET: MSE	84.87
1itv_A		195	MMP9; adaptive molecular recognition, beta propell	84.32
4aow_A		340	Guanine nucleotide-binding protein subunit beta-2;	83.95
1w6s_A		599	Methanol dehydrogenase subunit 1; anisotropic, ele	83.92
2pm7_B		297	Protein transport protein SEC13, protein transport	83.91
3mmy_A		368	MRNA export factor; mRNA export, nuclear protein;	83.43
3fvz_A		329	Peptidyl-glycine alpha-amidating monooxygenase; be	83.35
3dm0_A		694	Maltose-binding periplasmic protein fused with RAC	83.23
2ad6_A		571	Methanol dehydrogenase subunit 1; PQQ configuratio	83.1
3hxj_A		330	Pyrrolo-quinoline quinone; all beta protein. incom	82.16
3o4h_A		582	Acylamino-acid-releasing enzyme; alpha/beta hydrol	81.94
1itv_A		195	MMP9; adaptive molecular recognition, beta propell	81.74
1kv9_A		668	Type II quinohemoprotein alcohol dehydrogenase; el	81.44
1yiq_A		689	Quinohemoprotein alcohol dehydrogenase; electron t	81.05
3ju4_A		670	Endo-N-acetylneuraminidase; endonf, polysia, high-	80.8
3b7f_A		394	Glycosyl hydrolase, BNR repeat; 7-bladed beta-prop	80.69
3mmy_A		368	MRNA export factor; mRNA export, nuclear protein;	80.33

>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A	Back alignment and structure

Probab=100.00  E-value=3.6e-47  Score=372.48  Aligned_cols=290  Identities=18%  Similarity=0.247  Sum_probs=245.9

Q ss_pred             CCCCCCCcceeEEEECCcEEEEEcccCCCccccceEEEEcCCCcEEeeeecCCCCCCCCCCCCcceeEEEEECCEEEEEc
Q 011542           14 GTVPQPRSGHSAVNIGKSKVVVFGGLVDKRFLSDVVVYDIDNKLWFQPECTGNGSNGQVGPGPRAFHIAVAIDCHMFIFG   93 (483)
Q Consensus        14 g~~p~~R~~h~~~~~~~~~l~v~GG~~~~~~~~~~~~yd~~~~~W~~~~~~~~~~~~~~~p~~R~~h~~~~~~~~iyv~G   93 (483)
                      ++.|.+|.+|+++.++ ++||+|||. +....+++++||+.+++|..++         ++|.+|.+|++++++++||++|
T Consensus         9 ~~~~~~~~~~~~~~~~-~~i~v~GG~-~~~~~~~~~~~d~~~~~W~~~~---------~~p~~r~~~~~~~~~~~lyv~G   77 (308)
T 1zgk_A            9 HSSGLVPRGSHAPKVG-RLIYTAGGY-FRQSLSYLEAYNPSNGTWLRLA---------DLQVPRSGLAGCVVGGLLYAVG   77 (308)
T ss_dssp             ------------CCCC-CCEEEECCB-SSSBCCCEEEEETTTTEEEECC---------CCSSCCBSCEEEEETTEEEEEC
T ss_pred             ccCCeeeCCccccCCC-CEEEEEeCc-CCCCcceEEEEcCCCCeEeECC---------CCCcccccceEEEECCEEEEEC
Confidence            3678899999999888 589999999 5667899999999999999986         4688999999999999999999


Q ss_pred             cc----cCCCCCccEEEEECCCCeEEEeecCCCCCCCCcccEEEEECCcEEEEEecCCCCcCCccEEEEECCCCceEEec
Q 011542           94 GR----FGSRRLGDFWVLDTDIWQWSELTSFGDLPSPRDFAAASAIGNRKIVMYGGWDGKKWLSDVYVLDTISLEWMQLP  169 (483)
Q Consensus        94 G~----~~~~~~~~~~~yd~~t~~W~~l~~~~~~p~~r~~~~~~~~~~~~iyv~GG~~~~~~~~~v~~yd~~t~~W~~i~  169 (483)
                      |.    .+...++++++||+.+++|+++++   +|.+|..|+++++++ +|||+||..+....+++++||+.+++|+.++
T Consensus        78 G~~~~~~~~~~~~~~~~~d~~~~~W~~~~~---~p~~r~~~~~~~~~~-~iyv~GG~~~~~~~~~~~~yd~~~~~W~~~~  153 (308)
T 1zgk_A           78 GRNNSPDGNTDSSALDCYNPMTNQWSPCAP---MSVPRNRIGVGVIDG-HIYAVGGSHGCIHHNSVERYEPERDEWHLVA  153 (308)
T ss_dssp             CEEEETTEEEECCCEEEEETTTTEEEECCC---CSSCCBTCEEEEETT-EEEEECCEETTEECCCEEEEETTTTEEEECC
T ss_pred             CCcCCCCCCeecceEEEECCCCCeEeECCC---CCcCccccEEEEECC-EEEEEcCCCCCcccccEEEECCCCCeEeECC
Confidence            98    445667899999999999999985   899999999999965 9999999988778899999999999999998


Q ss_pred             cCCCCCCCCcCceEEEeCCEEEEEccCCCCCCcccceecccccccccCCCCCeEEeccCCCCCCCCeeeEEEEeCCEEEE
Q 011542          170 VTGSVPPPRCGHTATMVEKRLLIYGGRGGGGPIMGDLWALKGLIEEENETPGWTQLKLPGQAPSSRCGHTITSGGHYLLL  249 (483)
Q Consensus       170 ~~~~~p~~r~~~~~~~~~~~lyv~GG~~~~~~~~~d~~~l~~~~~yd~~~~~W~~~~~~g~~p~~r~~~~~~~~~~~i~v  249 (483)
                         ++|.+|.+|+++.++++|||+||.....       .++.++.||+.+++|+.+.   ++|.+|..|++++.+++||+
T Consensus       154 ---~~p~~r~~~~~~~~~~~iyv~GG~~~~~-------~~~~~~~yd~~~~~W~~~~---~~p~~r~~~~~~~~~~~iyv  220 (308)
T 1zgk_A          154 ---PMLTRRIGVGVAVLNRLLYAVGGFDGTN-------RLNSAECYYPERNEWRMIT---AMNTIRSGAGVCVLHNCIYA  220 (308)
T ss_dssp             ---CCSSCCBSCEEEEETTEEEEECCBCSSC-------BCCCEEEEETTTTEEEECC---CCSSCCBSCEEEEETTEEEE
T ss_pred             ---CCCccccceEEEEECCEEEEEeCCCCCC-------cCceEEEEeCCCCeEeeCC---CCCCccccceEEEECCEEEE
Confidence               8999999999999999999999987654       2577888999999999997   78999999999999999999


Q ss_pred             EcCCCCCCCCcccceeeCcEEEEEcCCCceEEccCCCCCCCCCcceEEEEECCEEEEEccCCCCCccCcEEEEcCCCCcc
Q 011542          250 FGGHGTGGWLSRYDIYYNDTIILDRLSAQWKRLPIGNEPPPARAYHSMTCLGSLYLLFGGFDGKSTFGDIWWLVPEEDPI  329 (483)
Q Consensus       250 ~GG~~~~~~~~~~~~~~~~v~~yd~~~~~W~~v~~~~~~p~~R~~~~~~~~~~~i~v~GG~~~~~~~~d~w~l~~~~d~~  329 (483)
                      +||.+...       ..+++++||+.+++|+.++.   .|.+|..|++++++++|||+||.++...++++|.|+    +.
T Consensus       221 ~GG~~~~~-------~~~~v~~yd~~~~~W~~~~~---~p~~r~~~~~~~~~~~i~v~GG~~~~~~~~~v~~yd----~~  286 (308)
T 1zgk_A          221 AGGYDGQD-------QLNSVERYDVETETWTFVAP---MKHRRSALGITVHQGRIYVLGGYDGHTFLDSVECYD----PD  286 (308)
T ss_dssp             ECCBCSSS-------BCCCEEEEETTTTEEEECCC---CSSCCBSCEEEEETTEEEEECCBCSSCBCCEEEEEE----TT
T ss_pred             EeCCCCCC-------ccceEEEEeCCCCcEEECCC---CCCCccceEEEEECCEEEEEcCcCCCcccceEEEEc----CC
Confidence            99987532       57899999999999999986   466899999999999999999998877888988655    45


Q ss_pred             cceeecCCCCCCCCCC
Q 011542          330 AKRYTESPPKVLPENK  345 (483)
Q Consensus       330 ~~~w~~~~~~~~~~~~  345 (483)
                      +++|+..+.++.++..
T Consensus       287 ~~~W~~~~~~p~~r~~  302 (308)
T 1zgk_A          287 TDTWSEVTRMTSGRSG  302 (308)
T ss_dssp             TTEEEEEEECSSCCBS
T ss_pred             CCEEeecCCCCCCccc
Confidence            7788888666655443

PyMOL of 1zgk

>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens}	Back alignment and structure

>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens}	Back alignment and structure

>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens}	Back alignment and structure

>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens}	Back alignment and structure

>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A	Back alignment and structure

>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens}	Back alignment and structure

>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens}	Back alignment and structure

>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli}	Back alignment and structure

>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens}	Back alignment and structure

>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens}	Back alignment and structure

>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus}	Back alignment and structure

>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus}	Back alignment and structure

>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A*	Back alignment and structure

>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli}	Back alignment and structure

>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A*	Back alignment and structure

>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A	Back alignment and structure

>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A	Back alignment and structure

>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris}	Back alignment and structure

>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis}	Back alignment and structure

>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis}	Back alignment and structure

>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A	Back alignment and structure

>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron}	Back alignment and structure

>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris}	Back alignment and structure

>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A	Back alignment and structure

>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ...	Back alignment and structure

>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A*	Back alignment and structure

>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A	Back alignment and structure

>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe}	Back alignment and structure

>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A*	Back alignment and structure

>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus}	Back alignment and structure

>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C	Back alignment and structure

>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3	Back alignment and structure

>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A	Back alignment and structure

>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A	Back alignment and structure

>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A	Back alignment and structure

>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1	Back alignment and structure

>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus}	Back alignment and structure

>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus}	Back alignment and structure

>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae}	Back alignment and structure

>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A	Back alignment and structure

>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A*	Back alignment and structure

>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str}	Back alignment and structure

>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans}	Back alignment and structure

>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus}	Back alignment and structure

>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens}	Back alignment and structure

>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3	Back alignment and structure

>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron}	Back alignment and structure

>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A*	Back alignment and structure

>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae}	Back alignment and structure

>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A*	Back alignment and structure

>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A	Back alignment and structure

>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans}	Back alignment and structure

>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1	Back alignment and structure

>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ...	Back alignment and structure

>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A	Back alignment and structure

>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A*	Back alignment and structure

>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A	Back alignment and structure

>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A*	Back alignment and structure

>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens}	Back alignment and structure

>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A	Back alignment and structure

>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae}	Back alignment and structure

>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae}	Back alignment and structure

>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A*	Back alignment and structure

>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str}	Back alignment and structure

>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A*	Back alignment and structure

>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A	Back alignment and structure

>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A*	Back alignment and structure

>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C	Back alignment and structure

>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans}	Back alignment and structure

>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii}	Back alignment and structure

>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A	Back alignment and structure

>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A*	Back alignment and structure

>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A*	Back alignment and structure

>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B*	Back alignment and structure

>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii}	Back alignment and structure

>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1	Back alignment and structure

>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A*	Back alignment and structure

>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A	Back alignment and structure

>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae}	Back alignment and structure

>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe}	Back alignment and structure

>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis}	Back alignment and structure

>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B	Back alignment and structure

>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1	Back alignment and structure

>1qhu_A Protein (hemopexin); beta propeller, HAEM binding and transport, iron metabolism, binding protein; HET: HEM; 2.30A {Oryctolagus cuniculus} SCOP: b.66.1.1 b.66.1.1 PDB: 1qjs_A*	Back alignment and structure

>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus}	Back alignment and structure

>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B*	Back alignment and structure

>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans}	Back alignment and structure

>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ...	Back alignment and structure

>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum}	Back alignment and structure

>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens}	Back alignment and structure

>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans}	Back alignment and structure

>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia}	Back alignment and structure

>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus}	Back alignment and structure

>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens}	Back alignment and structure

>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A	Back alignment and structure

>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A*	Back alignment and structure

>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum}	Back alignment and structure

>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia}	Back alignment and structure

>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum}	Back alignment and structure

>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1	Back alignment and structure

>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae}	Back alignment and structure

>1qhu_A Protein (hemopexin); beta propeller, HAEM binding and transport, iron metabolism, binding protein; HET: HEM; 2.30A {Oryctolagus cuniculus} SCOP: b.66.1.1 b.66.1.1 PDB: 1qjs_A*	Back alignment and structure

>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A	Back alignment and structure

>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae}	Back alignment and structure

>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B*	Back alignment and structure

>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1	Back alignment and structure

>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B*	Back alignment and structure

>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A	Back alignment and structure

>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633}	Back alignment and structure

>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1	Back alignment and structure

>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A	Back alignment and structure

>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X	Back alignment and structure

>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A	Back alignment and structure

>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A	Back alignment and structure

>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A	Back alignment and structure

>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A*	Back alignment and structure

>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B*	Back alignment and structure

>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens}	Back alignment and structure

>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A	Back alignment and structure

>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A	Back alignment and structure

>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A*	Back alignment and structure

>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae}	Back alignment and structure

>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A*	Back alignment and structure

>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a	Back alignment and structure

>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ...	Back alignment and structure

>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B*	Back alignment and structure

>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1	Back alignment and structure

>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae}	Back alignment and structure

>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B	Back alignment and structure

>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B*	Back alignment and structure

>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B*	Back alignment and structure

>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A	Back alignment and structure

>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe}	Back alignment and structure

>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp}	Back alignment and structure

>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis}	Back alignment and structure

>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens}	Back alignment and structure

>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum}	Back alignment and structure

>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X	Back alignment and structure

>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens}	Back alignment and structure

>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae}	Back alignment and structure

>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B*	Back alignment and structure

>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A	Back alignment and structure

>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A*	Back alignment and structure

>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe}	Back alignment and structure

>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens}	Back alignment and structure

>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A	Back alignment and structure

>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A*	Back alignment and structure

>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans}	Back alignment and structure

>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV}	Back alignment and structure

>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae}	Back alignment and structure

>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A	Back alignment and structure

>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24	Back alignment and structure

>3b7f_A Glycosyl hydrolase, BNR repeat; 7-bladed beta-propeller fold, structural genomics, joint CEN structural genomics, JCSG; 2.20A {Ralstonia eutropha}	Back alignment and structure

>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A*	Back alignment and structure

>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae}	Back alignment and structure

>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1	Back alignment and structure

>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV}	Back alignment and structure

>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1	Back alignment and structure

>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B	Back alignment and structure

>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens}	Back alignment and structure

>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae}	Back alignment and structure

>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae}	Back alignment and structure

>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A	Back alignment and structure

>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp}	Back alignment and structure

>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae}	Back alignment and structure

>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus}	Back alignment and structure

>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme}	Back alignment and structure

>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus}	Back alignment and structure

>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A	Back alignment and structure

>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1	Back alignment and structure

>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus}	Back alignment and structure

>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633}	Back alignment and structure

>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae}	Back alignment and structure

>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A	Back alignment and structure

>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1	Back alignment and structure

>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A	Back alignment and structure

>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A*	Back alignment and structure

>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A*	Back alignment and structure

>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B*	Back alignment and structure

>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae}	Back alignment and structure

>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus}	Back alignment and structure

>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A	Back alignment and structure

>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli}	Back alignment and structure

>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3	Back alignment and structure

>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens}	Back alignment and structure

>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B*	Back alignment and structure

>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae}	Back alignment and structure

>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A	Back alignment and structure

>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A	Back alignment and structure

>1pex_A Collagenase-3, MMP-13; C-terminal hemopexin-like domain of matrix- metalloproteinase, metalloprotease; 2.70A {Homo sapiens} SCOP: b.66.1.1	Back alignment and structure

>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A	Back alignment and structure

>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae}	Back alignment and structure

>1itv_A MMP9; adaptive molecular recognition, beta propeller, dimer, hydrolase; 1.95A {Homo sapiens} SCOP: b.66.1.1	Back alignment and structure

>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a	Back alignment and structure

>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A*	Back alignment and structure

>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A	Back alignment and structure

>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens}	Back alignment and structure

>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A*	Back alignment and structure

>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli}	Back alignment and structure

>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A*	Back alignment and structure

>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis}	Back alignment and structure

>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A	Back alignment and structure

>1itv_A MMP9; adaptive molecular recognition, beta propeller, dimer, hydrolase; 1.95A {Homo sapiens} SCOP: b.66.1.1	Back alignment and structure

>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1	Back alignment and structure

>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida}	Back alignment and structure

>3ju4_A Endo-N-acetylneuraminidase; endonf, polysia, high-resolution, glycosidase, hydrolase; HET: SLB; 0.98A {Enterobacteria phage K1F} PDB: 3gvl_A* 3gvj_A* 3gvk_A* 1v0e_A 1v0f_A*	Back alignment and structure

>3b7f_A Glycosyl hydrolase, BNR repeat; 7-bladed beta-propeller fold, structural genomics, joint CEN structural genomics, JCSG; 2.20A {Ralstonia eutropha}	Back alignment and structure

>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens}	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		483
d1zgka1		288	b.68.11.1 (A:322-609) Kelch-like ECH-associated pr	2e-11
d1zgka1		288	b.68.11.1 (A:322-609) Kelch-like ECH-associated pr	3e-09
d1zgka1		288	b.68.11.1 (A:322-609) Kelch-like ECH-associated pr	8e-08
d1zgka1		288	b.68.11.1 (A:322-609) Kelch-like ECH-associated pr	2e-07
d1k3ia3		387	b.69.1.1 (A:151-537) Galactose oxidase, central do	4e-07

>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288	Back information, alignment and structure


class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: Kelch motif
family: Kelch motif
domain: Kelch-like ECH-associated protein 1, KEAP1
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 62.6 bits (150), Expect = 2e-11
 Identities = 42/301 (13%), Positives = 89/301 (29%), Gaps = 34/301 (11%)

Query: 27  NIGKSKVVVFGGLVDKRFLSDVVVYDIDNKLWFQPECTGNGSNGQVGPGPRAFHIAVAID 86
            +G+  +   GG   ++ LS +  Y+  N  W +               PR+      + 
Sbjct: 2   KVGR-LIYTAGGY-FRQSLSYLEAYNPSNGTWLR---------LADLQVPRSGLAGCVVG 50

Query: 87  CHMFIFGGRFGSRRLGDFWVLDTDIWQWSELTSFGDLPSPRDFAAASAIGNRKIVMYGGW 146
             ++  GGR  S          + +  ++ +T+     +P                    
Sbjct: 51  GLLYAVGGRNNSPDGNTDS---SALDCYNPMTNQWSPCAPMSVPRNRIGVGVIDGHIYAV 107

Query: 147 DGKKWLSDVYVLDTISLEWMQLPVTGSVPPPRCGHTATMVEKRLLIYGGRGGGGPIMGDL 206
            G         ++    E  +  +   +   R G    ++ + L   GG           
Sbjct: 108 GGSHGCIHHNSVERYEPERDEWHLVAPMLTRRIGVGVAVLNRLLYAVGGF---------- 157

Query: 207 WALKGLIEEENETPGWTQLKLPGQAPSSRCGHTITSGGHYLLLFGGHGTGGWLSRYDIYY 266
                L   E   P   + ++     + R G  +    + +   GG+     L+  + Y 
Sbjct: 158 DGTNRLNSAECYYPERNEWRMITAMNTIRSGAGVCVLHNCIYAAGGYDGQDQLNSVERYD 217

Query: 267 NDTIILDRLSAQWKRLPIGNEPPPARAYHSMTCLGSLYLLFGGFDGKSTFGDIWWLVPEE 326
            +T     ++    R          R+   +T       + GG+DG +    +    P+ 
Sbjct: 218 VETETWTFVAPMKHR----------RSALGITVHQGRIYVLGGYDGHTFLDSVECYDPDT 267

Query: 327 D 327
           D
Sbjct: 268 D 268

PyMOL of d1zgka1

>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288	Back information, alignment and structure

>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288	Back information, alignment and structure

>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288	Back information, alignment and structure

>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		483
d1zgka1		288	Kelch-like ECH-associated protein 1, KEAP1 {Human	100.0
d1zgka1		288	Kelch-like ECH-associated protein 1, KEAP1 {Human	100.0
d1k3ia3		387	Galactose oxidase, central domain {Fungi (Fusarium	100.0
d1k3ia3		387	Galactose oxidase, central domain {Fungi (Fusarium	99.93
d1gxra_		337	Groucho/tle1, C-terminal domain {Human (Homo sapie	95.73
d1nr0a1		311	Actin interacting protein 1 {Nematode (Caenorhabdi	95.72
d1k8kc_		371	Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur	95.36
d2ghsa1		295	Regucalcin {Agrobacterium tumefaciens [TaxId: 358]	94.86
d2ghsa1		295	Regucalcin {Agrobacterium tumefaciens [TaxId: 358]	94.64
d1nr0a2		299	Actin interacting protein 1 {Nematode (Caenorhabdi	93.99
d1k32a3		360	Tricorn protease domain 2 {Archaeon Thermoplasma a	93.89
d1pexa_		192	Collagenase-3 (MMP-13), C-terminal domain {Human (	93.46
d1erja_		388	Tup1, C-terminal domain {Baker's yeast (Saccharomy	92.22
d1q7fa_		279	Brain tumor cg10719-pa {Fruit fly (Drosophila mela	92.14
d1su3a2		195	Collagenase (MMP1), C-terminal domain {Human (Homo	91.81
d1gxra_		337	Groucho/tle1, C-terminal domain {Human (Homo sapie	91.69
d1nr0a1		311	Actin interacting protein 1 {Nematode (Caenorhabdi	91.18
d1nexb2		355	Cdc4 propeller domain {Baker's yeast (Saccharomyce	90.78
d1su3a2		195	Collagenase (MMP1), C-terminal domain {Human (Homo	90.69
d1k32a3		360	Tricorn protease domain 2 {Archaeon Thermoplasma a	90.63
d1pexa_		192	Collagenase-3 (MMP-13), C-terminal domain {Human (	90.37
d1nr0a2		299	Actin interacting protein 1 {Nematode (Caenorhabdi	89.56
d1pjxa_		314	Diisopropylfluorophosphatase (phosphotriesterase,	89.44
d1itva_		195	Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId:	89.11
d1l0qa2		301	Surface layer protein {Archaeon Methanosarcina maz	88.44
d1k8kc_		371	Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur	87.7
d2dg1a1		319	Lactonase Drp35 {Staphylococcus aureus [TaxId: 128	87.57
d1l0qa2		301	Surface layer protein {Archaeon Methanosarcina maz	87.26
d2dg1a1		319	Lactonase Drp35 {Staphylococcus aureus [TaxId: 128	87.18
d1itva_		195	Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId:	86.82
d2ovrb2		342	F-box/WD repeat-containing protein 7, FBXW7 {Human	86.26
d1tbga_		340	beta1-subunit of the signal-transducing G protein	85.2
d1nexb2		355	Cdc4 propeller domain {Baker's yeast (Saccharomyce	83.26
d1v0ea1		516	Endo-alpha-sialidase {Bacteriophage K1F [TaxId: 34	82.68
d1kb0a2		573	Quinoprotein alcohol dehydrogenase, N-terminal dom	81.97
d1jmxb_		346	Quinohemoprotein amine dehydrogenase B chain {Pseu	81.26
d1pgua1		325	Actin interacting protein 1 {Baker's yeast (Saccha	81.13
d2ovrb2		342	F-box/WD repeat-containing protein 7, FBXW7 {Human	80.61

>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: Kelch motif
family: Kelch motif
domain: Kelch-like ECH-associated protein 1, KEAP1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=2.5e-40  Score=317.29  Aligned_cols=274  Identities=18%  Similarity=0.250  Sum_probs=241.1

Q ss_pred             cEEEEEcccCCCccccceEEEEcCCCcEEeeeecCCCCCCCCCCCCcceeEEEEECCEEEEEccccC----CCCCccEEE
Q 011542           31 SKVVVFGGLVDKRFLSDVVVYDIDNKLWFQPECTGNGSNGQVGPGPRAFHIAVAIDCHMFIFGGRFG----SRRLGDFWV  106 (483)
Q Consensus        31 ~~l~v~GG~~~~~~~~~~~~yd~~~~~W~~~~~~~~~~~~~~~p~~R~~h~~~~~~~~iyv~GG~~~----~~~~~~~~~  106 (483)
                      +.||||||.+. ..++++++||+.+++|+.++         ++|.+|.+|++++++++||++||...    ...++++++
T Consensus         5 ~~iyv~GG~~~-~~~~~~~~yd~~t~~W~~~~---------~~p~~R~~~~~~~~~~~iyv~GG~~~~~~~~~~~~~~~~   74 (288)
T d1zgka1           5 RLIYTAGGYFR-QSLSYLEAYNPSNGTWLRLA---------DLQVPRSGLAGCVVGGLLYAVGGRNNSPDGNTDSSALDC   74 (288)
T ss_dssp             CCEEEECCBSS-SBCCCEEEEETTTTEEEECC---------CCSSCCBSCEEEEETTEEEEECCEEEETTEEEECCCEEE
T ss_pred             CEEEEECCcCC-CCCceEEEEECCCCeEEECC---------CCCCccceeEEEEECCEEEEEeCcccCCCCccccchhhh
Confidence            57999999965 56799999999999999986         56889999999999999999999853    345789999


Q ss_pred             EECCCCeEEEeecCCCCCCCCcccEEEEECCcEEEEEecCCCCcCCccEEEEECCCCceEEeccCCCCCCCCcCceEEEe
Q 011542          107 LDTDIWQWSELTSFGDLPSPRDFAAASAIGNRKIVMYGGWDGKKWLSDVYVLDTISLEWMQLPVTGSVPPPRCGHTATMV  186 (483)
Q Consensus       107 yd~~t~~W~~l~~~~~~p~~r~~~~~~~~~~~~iyv~GG~~~~~~~~~v~~yd~~t~~W~~i~~~~~~p~~r~~~~~~~~  186 (483)
                      ||+.+++|.++++   +|.+|..|+++++++ +||++||..+....++++.||+.+++|....   .++.+|.+|+++.+
T Consensus        75 yd~~~~~w~~~~~---~p~~r~~~~~~~~~~-~i~~~gg~~~~~~~~~~~~~~~~~~~~~~~~---~~~~~r~~~~~~~~  147 (288)
T d1zgka1          75 YNPMTNQWSPCAP---MSVPRNRIGVGVIDG-HIYAVGGSHGCIHHNSVERYEPERDEWHLVA---PMLTRRIGVGVAVL  147 (288)
T ss_dssp             EETTTTEEEECCC---CSSCCBTCEEEEETT-EEEEECCEETTEECCCEEEEETTTTEEEECC---CCSSCCBSCEEEEE
T ss_pred             ccccccccccccc---ccceecceeccccce-eeEEecceecccccceeeeeccccCcccccc---ccccccccceeeee
Confidence            9999999999885   999999999999965 9999999988888999999999999999987   88999999999999


Q ss_pred             CCEEEEEccCCCCCCcccceecccccccccCCCCCeEEeccCCCCCCCCeeeEEEEeCCEEEEEcCCCCCCCCcccceee
Q 011542          187 EKRLLIYGGRGGGGPIMGDLWALKGLIEEENETPGWTQLKLPGQAPSSRCGHTITSGGHYLLLFGGHGTGGWLSRYDIYY  266 (483)
Q Consensus       187 ~~~lyv~GG~~~~~~~~~d~~~l~~~~~yd~~~~~W~~~~~~g~~p~~r~~~~~~~~~~~i~v~GG~~~~~~~~~~~~~~  266 (483)
                      ++++|++||.....       .++.++.||+.+++|....   ..+.++..++++..+++|+++||....       ...
T Consensus       148 ~~~~~~~GG~~~~~-------~~~~~~~~d~~~~~~~~~~---~~~~~~~~~~~~~~~~~i~i~GG~~~~-------~~~  210 (288)
T d1zgka1         148 NRLLYAVGGFDGTN-------RLNSAECYYPERNEWRMIT---AMNTIRSGAGVCVLHNCIYAAGGYDGQ-------DQL  210 (288)
T ss_dssp             TTEEEEECCBCSSC-------BCCCEEEEETTTTEEEECC---CCSSCCBSCEEEEETTEEEEECCBCSS-------SBC
T ss_pred             eecceEecCccccc-------ccceEEEeecccccccccc---ccccccccccccceeeeEEEecCcccc-------ccc
Confidence            99999999986543       3466788899999999887   678889999999999999999998764       367


Q ss_pred             CcEEEEEcCCCceEEccCCCCCCCCCcceEEEEECCEEEEEccCCCCCccCcEEEEcCCCCcccceeecCCCCCCCCCC
Q 011542          267 NDTIILDRLSAQWKRLPIGNEPPPARAYHSMTCLGSLYLLFGGFDGKSTFGDIWWLVPEEDPIAKRYTESPPKVLPENK  345 (483)
Q Consensus       267 ~~v~~yd~~~~~W~~v~~~~~~p~~R~~~~~~~~~~~i~v~GG~~~~~~~~d~w~l~~~~d~~~~~w~~~~~~~~~~~~  345 (483)
                      ++.++||+.+++|..++.   .|.+|..|+++.++++|||+||.++...++++|.|    |+.+++|+.++++|.++..
T Consensus       211 ~~~~~~~~~~~~~~~~~~---~p~~r~~~~~~~~~~~l~v~GG~~~~~~~~~v~~y----d~~~~~W~~~~~~p~~R~~  282 (288)
T d1zgka1         211 NSVERYDVETETWTFVAP---MKHRRSALGITVHQGRIYVLGGYDGHTFLDSVECY----DPDTDTWSEVTRMTSGRSG  282 (288)
T ss_dssp             CCEEEEETTTTEEEECCC---CSSCCBSCEEEEETTEEEEECCBCSSCBCCEEEEE----ETTTTEEEEEEECSSCCBS
T ss_pred             cceeeeeecceeeecccC---ccCcccceEEEEECCEEEEEecCCCCeecceEEEE----ECCCCEEEECCCCCCCcEe
Confidence            899999999999999976   46799999999999999999999988889998865    4557789998766666544

PyMOL of d1zgka1

>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]}	Back information, alignment and structure

>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]}	Back information, alignment and structure

>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure

>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure

>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]}	Back information, alignment and structure

>d1pexa_ b.66.1.1 (A:) Collagenase-3 (MMP-13), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1su3a2 b.66.1.1 (A:271-465) Collagenase (MMP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1su3a2 b.66.1.1 (A:271-465) Collagenase (MMP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]}	Back information, alignment and structure

>d1pexa_ b.66.1.1 (A:) Collagenase-3 (MMP-13), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]}	Back information, alignment and structure

>d1itva_ b.66.1.1 (A:) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]}	Back information, alignment and structure

>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]}	Back information, alignment and structure

>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]}	Back information, alignment and structure

>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]}	Back information, alignment and structure

>d1itva_ b.66.1.1 (A:) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1v0ea1 b.68.1.2 (A:245-760) Endo-alpha-sialidase {Bacteriophage K1F [TaxId: 344021]}	Back information, alignment and structure

>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]}	Back information, alignment and structure

>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]}	Back information, alignment and structure

>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure