Citrus Sinensis ID: 011618

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-
MWNLARVAASVLSRSRRFSTAIPGPCMVHKRGTDILHDPWFNKDTGFPLTERDRLGLRGLLPPRVISFEQQYARFMESFRSLEKNTEGQPNKVVSLAKWRILNRLHDRNETLYYRVLIDNIKDFAPIIYTPTVGLVCQNYSGLFRRPRGMYFSAKDKGEMMSMIYNWPAQQVDMIVLTDGSRILGLGDLGVQGIGIPIGKLDVYVAAAGINPQRILPVMLDVGTNNQKLLEDRLYLGLRQPRLEGEEYLSIVDEFMEAVHARWPKAIVQFEDFQMKWAFETLERYRKRFCMFNDDIQGTAGVALAGLLGTVRAQGLSLTDFADQKIVVVGAGSAGLGVLKMAVQAAARMAGNNDAFARNKFFLLDKDGLITKERKNLDPAAAPFAKDPGDFMGLREGASLLEVVRKVKPHVLLGLSGVGGVFNEEVLKAMRESDSVKPAIFAMSNPTMNGLFSCCVTTFFFYLMAARSSFLTSSFVFCLTS
cccHHHHHHHHccccccccccccccEEEccccHHHHccccccccccccHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHccHHHHHHHHHHcHHccccccccccHHHHHHHHHHccccccEEEEEccccccHHHHHHccccccccEEEEEcccEEEccccccccccccccccHHHHHccccccccccccEEEEcccccHHccccccccccccccccHHHHHHHHHHHHHHHHHHccccEEEEccccccHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHccccccccccEEEEEcccHHHHHHHHHHHHHHHHHccccHHHHHccEEEEEccccccccccccccccccccccccccccccccccHHHHHHHccccEEEEcccccccccHHHHHHHHHccccccEEEEccccccccccccccHHHHHHHccccEEEEcccccccccc
cccHHHHccHHccccccccccccccEEEEccHHHHHcccccccHHHccHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHcccHHHHHHHHHHcHHHHHHHHcccHHHHHHHcHHHHccccccEEEEHHHcccHHHHHcccccccccEEEEEccccEcccEccHHHHHHHHHHHHHHHHHHHcccHHHEEEEEEEcccccHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHcccEEEEccccHHHHHHHHHHHcccccEEEHHHHHHHHHHHHHHHHHHHHHccccccHcccEEEEEcccHHHHHHHHHHHHHHHHHccccHHHHHHHEEEEccccEEEcccccccHHHHHHHccccHHcccccccccHHHHccccccEEEEcccccccccHHHHHHHHHccccccEEEEccccccccccccccHHHHHHHccccEEEEcccccccccc
MWNLARVAASVLSRSrrfstaipgpcmvhkrgtdilhdpwfnkdtgfplterdrlglrgllpprviSFEQQYARFMESFRSLekntegqpnkVVSLAKWRILNRLHDRNETLYYRVLIDnikdfapiiytptvglvcqnysglfrrprgmyfsakdKGEMMSMIYNWPAQQVDMIVLTdgsrilglgdlgvqgigipigKLDVYVAaaginpqrilpvmldvgtnnQKLLEDRLYlglrqprlegeeYLSIVDEFMEAVHARWPKAIVQFEDFQMKWAFETLERYRKRFCMFNDDIQGTAGVALAGLLGTVraqglsltdfadqkIVVVGAGSAGLGVLKMAVQAAARMAGNNDAFARNKFflldkdglitkerknldpaaapfakdpgdfmglreGASLLEVVRKVKPHVLlglsgvggvfNEEVLKAMResdsvkpaifamsnptmnglfsCCVTTFFFYLMAARSSFLTSSFVFCLTS
MWNLARVAASvlsrsrrfstaipgpcmvhkrgtdilhdpwfnKDTGFPLTERDRLGLRGLLPPRVISFEQQYARFMESFRSlekntegqpnkvvslakwrilnrlhdrnetLYYRVLIDNIKDFAPIIYTPTVGLVCQNYSGLFRRPRGMYFSAKDKGEMMSMIYNWPAQQVDMIVLTDGSRILGLGDLGVQGIGIPIGKLDVYVAAAGINPQRILPVMLDVGTNNQKLLEDRLYLGLRQPRLEGEEYLSIVDEFMEAVHARWPKAIVQFEDFQMKWAFETLERYRKRFCMFNDDIQGTAGVALAGLLGTVRAQGLSLTDFADQKIVVVGAGSAGLGVLKMAVQAAARMAGNNDAFARNKFFLLDKDGLITKerknldpaaapfakdpgdfMGLREGASLLEVVRKVKPHVllglsgvggvFNEEVLKAMRESDSVKPAIFAMSNPTMNGLFSCCVTTFFFYLMAARSSFLTSSFVFCLTS
MWNlarvaasvlsrsrrFSTAIPGPCMVHKRGTDILHDPWFNKDTGFPLTErdrlglrgllpprVISFEQQYARFMESFRSLEKNTEGQPNKVVSLAKWRILNRLHDRNETLYYRVLIDNIKDFAPIIYTPTVGLVCQNYSGLFRRPRGMYFSAKDKGEMMSMIYNWPAQQVDMIVLTDGSRILGLGDLGVQGIGIPIGKLDVYVAAAGINPQRILPVMLDVGTNNQKLLEDRLYLGLRQPRLEGEEYLSIVDEFMEAVHARWPKAIVQFEDFQMKWAFETLERYRKRFCMFNDDIQgtagvalagllgtvRAQGLSLTDFADQKIvvvgagsaglgvlKMAVQAAARMAGNNDAFARNKFFLLDKDGLITKERKNLDPAAAPFAKDPGDFMGLREGASLLEVVRKVKPHvllglsgvggvFNEEVLKAMRESDSVKPAIFAMSNPTMNGLFSCCVTTFFFYLMAARSSFLTSSFVFCLTS
**********VL***RRFSTAIPGPCMVHKRGTDILHDPWFNKDTGFPLTERDRLGLRGLLPPRVISFEQQYARFMESFR**********NKVVSLAKWRILNRLHDRNETLYYRVLIDNIKDFAPIIYTPTVGLVCQNYSGLFRRPRGMYFSAKDKGEMMSMIYNWPAQQVDMIVLTDGSRILGLGDLGVQGIGIPIGKLDVYVAAAGINPQRILPVMLDVGTNNQKLLEDRLYLGLRQPRLEGEEYLSIVDEFMEAVHARWPKAIVQFEDFQMKWAFETLERYRKRFCMFNDDIQGTAGVALAGLLGTVRAQGLSLTDFADQKIVVVGAGSAGLGVLKMAVQAAARMAGNNDAFARNKFFLLDKDGLITKE***************GDFMGLREGASLLEVVRKVKPHVLLGLSGVGGVFNEEVLKAMRESDSVKPAIFAMSNPTMNGLFSCCVTTFFFYLMAARSSFLTSSFVFCL**
*************************CMVHKRGTDILHDPWFNKDTGFPLTERDRLGLRGLLPPRVISFEQQYARFMESFRSLEKN*EG**NKVVSLAKWRILNRLHDRNETLYYRVLIDNIKDFAPIIYTPTVGLVCQNYSGLFRRPRGMYFSAKDKGEMMSMIYNWPAQQVDMIVLTDGSRILGLGDLGVQGIGIPIGKLDVYVAAAGINPQRILPVMLDVGTNNQKLLEDRLYLGLRQPRLEGEEYLSIVDEFMEAVHARWPKAIVQFEDFQMKWAFETLERYRKRFCMFNDDIQGTAGVALAGLLGTVRAQGLSLTDFADQKIVVVGAGSAGLGVLKMAVQAAARMAGNNDAFARNKFFLLDKDGLITKERKNLDPAAAPFAKDPGDFMGLREGASLLEVVRKVKPHVLLGLSGVGGVFNEEVLKAMRESDSVKPAIFAMSNPTMNGLFSCCVTTFFFYLMAARSSFLTSSFVFCL**
MWNLARVAASVLSRSRRFSTAIPGPCMVHKRGTDILHDPWFNKDTGFPLTERDRLGLRGLLPPRVISFEQQYARFMESFRS********PNKVVSLAKWRILNRLHDRNETLYYRVLIDNIKDFAPIIYTPTVGLVCQNYSGLFRRPRGMYFSAKDKGEMMSMIYNWPAQQVDMIVLTDGSRILGLGDLGVQGIGIPIGKLDVYVAAAGINPQRILPVMLDVGTNNQKLLEDRLYLGLRQPRLEGEEYLSIVDEFMEAVHARWPKAIVQFEDFQMKWAFETLERYRKRFCMFNDDIQGTAGVALAGLLGTVRAQGLSLTDFADQKIVVVGAGSAGLGVLKMAVQAAARMAGNNDAFARNKFFLLDKDGLITKERKNLDPAAAPFAKDPGDFMGLREGASLLEVVRKVKPHVLLGLSGVGGVFNEEVLKAMRESDSVKPAIFAMSNPTMNGLFSCCVTTFFFYLMAARSSFLTSSFVFCLTS
*WN***V*A*VLSRSRRFSTAIPGPCMVHKRGTDILHDPWFNKDTGFPLTERDRLGLRGLLPPRVISFEQQYARFMESFRSLEKNTEGQPNKVVSLAKWRILNRLHDRNETLYYRVLIDNIKDFAPIIYTPTVGLVCQNYSGLFRRPRGMYFSAKDKGEMMSMIYNWPAQQVDMIVLTDGSRILGLGDLGVQGIGIPIGKLDVYVAAAGINPQRILPVMLDVGTNNQKLLEDRLYLGLRQPRLEGEEYLSIVDEFMEAVHARWPKAIVQFEDFQMKWAFETLERYRKRFCMFNDDIQGTAGVALAGLLGTVRAQGLSLTDFADQKIVVVGAGSAGLGVLKMAVQAAARMAGNNDAFARNKFFLLDKDGLITKERKNLDPAAAPFAKDPGDFMGLREGASLLEVVRKVKPHVLLGLSGVGGVFNEEVLKAMRESDSVKPAIFAMSNPTMNGLFSCCVTTFFFYLMAARSSFLTSSF******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MWNLARVAASVLSRSRRFSTAIPGPCMVHKRGTDILHDPWFNKDTGFPLTERDRLGLRGLLPPRVISFEQQYARFMESFRSLEKNTEGQPNKVVSLAKWRILNRLHDRNETLYYRVLIDNIKDFAPIIYTPTVGLVCQNYSGLFRRPRGMYFSAKDKGEMMSMIYNWPAQQVDMIVLTDGSRILGLGDLGVQGIGIPIGKLDVYVAAAGINPQRILPVMLDVGTNNQKLLEDRLYLGLRQPRLEGEEYLSIVDEFMEAVHARWPKAIVQFEDFQMKWAFETLERYRKRFCMFNDDIQGTAGVALAGLLGTVRAQGLSLTDFADQKIVVVGAGSAGLGVLKMAVQAAARMAGNNDAFARNKFFLLDKDGLITKERKNLDPAAAPFAKDPGDFMGLREGASLLEVVRKVKPHVLLGLSGVGGVFNEEVLKAMRESDSVKPAIFAMSNPTMNGLFSCCVTTFFFYLMAARSSFLTSSFVFCLTS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query481 2.2.26 [Sep-21-2011]
P37225 601 NAD-dependent malic enzym N/A no 0.945 0.757 0.841 0.0
Q8L7K9 607 NAD-dependent malic enzym yes no 0.898 0.711 0.821 0.0
Q9SIU0 623 NAD-dependent malic enzym no no 0.954 0.736 0.638 1e-174
P37221 626 NAD-dependent malic enzym N/A no 0.968 0.744 0.647 1e-171
P37224 623 NAD-dependent malic enzym N/A no 0.912 0.704 0.635 1e-166
Q6TU48 544 NADP-dependent malic enzy yes no 0.825 0.729 0.465 1e-101
P06801 572 NADP-dependent malic enzy yes no 0.879 0.739 0.430 1e-101
Q8BMF3 604 NADP-dependent malic enzy no no 0.931 0.741 0.416 1e-100
P13697 572 NADP-dependent malic enzy yes no 0.879 0.739 0.428 1e-100
P27443 643 NAD-dependent malic enzym N/A no 0.825 0.617 0.453 3e-99
>sp|P37225|MAON_SOLTU NAD-dependent malic enzyme 59 kDa isoform, mitochondrial OS=Solanum tuberosum PE=1 SV=1 Back     alignment and function desciption
 Score =  801 bits (2070), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/462 (84%), Positives = 419/462 (90%), Gaps = 7/462 (1%)

Query: 1   MWNLARVAASVLSRSRRFSTAIPGPCMVHKRGTDILHDPWFNKDTGFPLTERDRLGLRGL 60
           MW +AR AAS   R+RR STAI  PC+VHKRG DILHDPWFNKDTGFP+TERDRLGLRGL
Sbjct: 1   MWRVARSAASTFRRTRRLSTAISAPCIVHKRGADILHDPWFNKDTGFPMTERDRLGLRGL 60

Query: 61  LPPRVISFEQQYARFMESFRSLEKNTEGQPNKVVSLAKWRILNRLHDRNETLYYRVLIDN 120
           LPPRVISFEQQY RFMESFRSLEKNTEGQP+ VVSLAKWRILNRLHDRNETLYYRVLIDN
Sbjct: 61  LPPRVISFEQQYDRFMESFRSLEKNTEGQPDSVVSLAKWRILNRLHDRNETLYYRVLIDN 120

Query: 121 IKDFAPIIYTPTVGLVCQNYSGLFRRPRGMYFSAKDKGEMMSMIYNWPAQQVDMIVLTDG 180
           IKDFAPIIYTPTVGLVCQNYSGLFRRPRGMYFSAKDKGEMMSMI+NWP+ QVDMIVLTDG
Sbjct: 121 IKDFAPIIYTPTVGLVCQNYSGLFRRPRGMYFSAKDKGEMMSMIFNWPSTQVDMIVLTDG 180

Query: 181 SRILGLGDLGVQGIGIPIGKLDVYVAAAGINPQRILPVMLDVGTNNQKLLEDRLYLGLRQ 240
           SRILGLGDLGVQGIGIPIGKLD+YVAAAGINPQR+LPVMLDVGTNNQKLLED LYLGLRQ
Sbjct: 181 SRILGLGDLGVQGIGIPIGKLDMYVAAAGINPQRVLPVMLDVGTNNQKLLEDPLYLGLRQ 240

Query: 241 PRLEGEEYLSIVDEFMEAVHARWPKAIVQFEDFQMKWAFETLERYRKRFCMFNDDIQGTA 300
           PRLEGEEYLSIVDEF+EAVHARWPKA+VQFEDFQ KWAFETL+RYRK+FCMFNDDIQGTA
Sbjct: 241 PRLEGEEYLSIVDEFVEAVHARWPKAVVQFEDFQAKWAFETLDRYRKKFCMFNDDIQGTA 300

Query: 301 GVALAGLLGTVRAQGLSLTDFADQKIVVVGAGSAGLGVLKMAVQAAARMAGNNDAFARNK 360
           GVALAGLLGTVRAQG  LTDFA+QKIVVVGAGSAGLGVLKMA+QA +RM G +   A   
Sbjct: 301 GVALAGLLGTVRAQGRPLTDFANQKIVVVGAGSAGLGVLKMALQAVSRMTGPS---ADPH 357

Query: 361 FFLLDKDGLITKERKNLDPAAAPFAKDPGDF--MGLREGASLLEVVRKVKPHVLLGLSGV 418
           FFLLDK+GLITK+RK++DPAA PFAK   +   +GL+EGA L EVV+KVKPHVLLGLSGV
Sbjct: 358 FFLLDKNGLITKDRKDIDPAALPFAKAHHEIEGLGLQEGAGLAEVVKKVKPHVLLGLSGV 417

Query: 419 GGVFNEEVLKAMRESDSVKPAIFAMSNPTMNGLFSCCVTTFF 460
           GG+F+EEVL+AM+ESDSV+PAIFAMSNPT N    CC    F
Sbjct: 418 GGIFHEEVLRAMKESDSVRPAIFAMSNPTNNA--ECCPVDAF 457

Solanum tuberosum (taxid: 4113)
EC: 1EC: .EC: 1EC: .EC: 1EC: .EC: 3EC: 9
>sp|Q8L7K9|MAO2_ARATH NAD-dependent malic enzyme 2, mitochondrial OS=Arabidopsis thaliana GN=NAD-ME2 PE=1 SV=1 Back     alignment and function description
>sp|Q9SIU0|MAO1_ARATH NAD-dependent malic enzyme 1, mitochondrial OS=Arabidopsis thaliana GN=NAD-ME1 PE=1 SV=1 Back     alignment and function description
>sp|P37221|MAOM_SOLTU NAD-dependent malic enzyme 62 kDa isoform, mitochondrial OS=Solanum tuberosum PE=1 SV=1 Back     alignment and function description
>sp|P37224|MAOM_AMAHP NAD-dependent malic enzyme 65 kDa isoform, mitochondrial OS=Amaranthus hypochondriacus PE=1 SV=1 Back     alignment and function description
>sp|Q6TU48|MAOX_DICDI NADP-dependent malic enzyme OS=Dictyostelium discoideum GN=malA PE=2 SV=1 Back     alignment and function description
>sp|P06801|MAOX_MOUSE NADP-dependent malic enzyme OS=Mus musculus GN=Me1 PE=1 SV=2 Back     alignment and function description
>sp|Q8BMF3|MAON_MOUSE NADP-dependent malic enzyme, mitochondrial OS=Mus musculus GN=Me3 PE=1 SV=2 Back     alignment and function description
>sp|P13697|MAOX_RAT NADP-dependent malic enzyme OS=Rattus norvegicus GN=Me1 PE=1 SV=2 Back     alignment and function description
>sp|P27443|MAOM_ASCSU NAD-dependent malic enzyme, mitochondrial (Fragment) OS=Ascaris suum PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query481
255541510 602 malic enzyme, putative [Ricinus communis 0.950 0.759 0.878 0.0
224063997 607 predicted protein [Populus trichocarpa] 0.956 0.757 0.875 0.0
356520442 604 PREDICTED: NAD-dependent malic enzyme 59 0.952 0.758 0.859 0.0
356504809 604 PREDICTED: NAD-dependent malic enzyme 59 0.933 0.743 0.873 0.0
224127578 607 predicted protein [Populus trichocarpa] 0.933 0.739 0.878 0.0
357514633 604 Malic enzyme [Medicago truncatula] gi|35 0.952 0.758 0.852 0.0
225454087 605 PREDICTED: NAD-dependent malic enzyme 59 0.912 0.725 0.879 0.0
357507187 601 Malic enzyme [Medicago truncatula] gi|35 0.929 0.743 0.853 0.0
357507189527 Malic enzyme [Medicago truncatula] gi|35 0.929 0.848 0.853 0.0
356568348 600 PREDICTED: NAD-dependent malic enzyme 59 0.950 0.761 0.837 0.0
>gi|255541510|ref|XP_002511819.1| malic enzyme, putative [Ricinus communis] gi|223548999|gb|EEF50488.1| malic enzyme, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  838 bits (2164), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/460 (87%), Positives = 425/460 (92%), Gaps = 3/460 (0%)

Query: 1   MWNLARVAASVLSRSRRFSTAIPGPCMVHKRGTDILHDPWFNKDTGFPLTERDRLGLRGL 60
           MW LAR A S   RSRRFSTAIPGPC+VHKRG DILHDPWFNKDTGFPLTERDRLGLRGL
Sbjct: 1   MWKLARFATS-RCRSRRFSTAIPGPCIVHKRGADILHDPWFNKDTGFPLTERDRLGLRGL 59

Query: 61  LPPRVISFEQQYARFMESFRSLEKNTEGQPNKVVSLAKWRILNRLHDRNETLYYRVLIDN 120
           LPPRVISFE QY RFMES+RSLEKNT+GQP+ VVSLAKWRILNRLHDRNETLYYRVLIDN
Sbjct: 60  LPPRVISFEHQYDRFMESYRSLEKNTQGQPDSVVSLAKWRILNRLHDRNETLYYRVLIDN 119

Query: 121 IKDFAPIIYTPTVGLVCQNYSGLFRRPRGMYFSAKDKGEMMSMIYNWPAQQVDMIVLTDG 180
           IKDFAPIIYTPTVGLVCQNYSGLFRRPRGMYFSAKDKGEMMSMIYNWPA+QVDMIVLTDG
Sbjct: 120 IKDFAPIIYTPTVGLVCQNYSGLFRRPRGMYFSAKDKGEMMSMIYNWPAEQVDMIVLTDG 179

Query: 181 SRILGLGDLGVQGIGIPIGKLDVYVAAAGINPQRILPVMLDVGTNNQKLLEDRLYLGLRQ 240
           SRILGLGDLGVQGIGIPIGKLD+YVAAAGINPQRILPVMLDVGTNNQKLLEDRLYLGLRQ
Sbjct: 180 SRILGLGDLGVQGIGIPIGKLDMYVAAAGINPQRILPVMLDVGTNNQKLLEDRLYLGLRQ 239

Query: 241 PRLEGEEYLSIVDEFMEAVHARWPKAIVQFEDFQMKWAFETLERYRKRFCMFNDDIQGTA 300
           PRLEGEEYLSIVDEFMEAV  RWPKAIVQFEDFQMKWAFETL+RYRKRFCMFNDDIQGTA
Sbjct: 240 PRLEGEEYLSIVDEFMEAVFTRWPKAIVQFEDFQMKWAFETLQRYRKRFCMFNDDIQGTA 299

Query: 301 GVALAGLLGTVRAQGLSLTDFADQKIVVVGAGSAGLGVLKMAVQAAARMAGNNDAFARNK 360
           GVALAGLLGTVRAQG  L+DF  QKIVVVGAGSAGLGVL MA+QA +RM+GNN+A   N 
Sbjct: 300 GVALAGLLGTVRAQGRPLSDFVKQKIVVVGAGSAGLGVLNMAIQAVSRMSGNNEASVNNN 359

Query: 361 FFLLDKDGLITKERKNLDPAAAPFAKDPGDFMGLREGASLLEVVRKVKPHVLLGLSGVGG 420
           FFLLDKDGLITKERKN+DPAAAPFAKD  D  GLREGA+L+EVV+K+KPHVLLGLSGVGG
Sbjct: 360 FFLLDKDGLITKERKNIDPAAAPFAKDLKDVEGLREGATLVEVVKKLKPHVLLGLSGVGG 419

Query: 421 VFNEEVLKAMRESDSVKPAIFAMSNPTMNGLFSCCVTTFF 460
           +FN+EVLKAMR+SD +KPAIFAMSNPTMN    C  T  F
Sbjct: 420 IFNDEVLKAMRDSDCIKPAIFAMSNPTMNA--ECTATDAF 457

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224063997|ref|XP_002301340.1| predicted protein [Populus trichocarpa] gi|222843066|gb|EEE80613.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356520442|ref|XP_003528871.1| PREDICTED: NAD-dependent malic enzyme 59 kDa isoform, mitochondrial-like [Glycine max] Back     alignment and taxonomy information
>gi|356504809|ref|XP_003521187.1| PREDICTED: NAD-dependent malic enzyme 59 kDa isoform, mitochondrial-like [Glycine max] Back     alignment and taxonomy information
>gi|224127578|ref|XP_002320109.1| predicted protein [Populus trichocarpa] gi|222860882|gb|EEE98424.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357514633|ref|XP_003627605.1| Malic enzyme [Medicago truncatula] gi|355521627|gb|AET02081.1| Malic enzyme [Medicago truncatula] Back     alignment and taxonomy information
>gi|225454087|ref|XP_002266697.1| PREDICTED: NAD-dependent malic enzyme 59 kDa isoform, mitochondrial [Vitis vinifera] gi|297745211|emb|CBI40291.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|357507187|ref|XP_003623882.1| Malic enzyme [Medicago truncatula] gi|355498897|gb|AES80100.1| Malic enzyme [Medicago truncatula] Back     alignment and taxonomy information
>gi|357507189|ref|XP_003623883.1| Malic enzyme [Medicago truncatula] gi|355498898|gb|AES80101.1| Malic enzyme [Medicago truncatula] Back     alignment and taxonomy information
>gi|356568348|ref|XP_003552373.1| PREDICTED: NAD-dependent malic enzyme 59 kDa isoform, mitochondrial-like isoform 1 [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query481
TAIR|locus:2127038 607 NAD-ME2 "AT4G00570" [Arabidops 0.891 0.706 0.710 2.3e-165
TAIR|locus:2054085 623 NAD-ME1 "AT2G13560" [Arabidops 0.883 0.682 0.579 1.9e-131
ZFIN|ZDB-GENE-041111-294 603 me3 "malic enzyme 3, NADP(+)-d 0.887 0.708 0.373 4.6e-73
MGI|MGI:97043 572 Me1 "malic enzyme 1, NADP(+)-d 0.827 0.695 0.385 5.9e-73
MGI|MGI:1916679 604 Me3 "malic enzyme 3, NADP(+)-d 0.839 0.668 0.389 1.2e-72
RGD|3074 572 Me1 "malic enzyme 1, NADP(+)-d 0.827 0.695 0.383 2.5e-72
UNIPROTKB|P13697 572 Me1 "NADP-dependent malic enzy 0.827 0.695 0.383 2.5e-72
UNIPROTKB|F1PQ35 604 ME3 "Malic enzyme" [Canis lupu 0.848 0.675 0.392 5.3e-72
UNIPROTKB|E9PMB9 581 ME3 "Malic enzyme" [Homo sapie 0.839 0.695 0.391 5.3e-72
UNIPROTKB|Q16798 604 ME3 "NADP-dependent malic enzy 0.839 0.668 0.391 5.3e-72
TAIR|locus:2127038 NAD-ME2 "AT4G00570" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1609 (571.5 bits), Expect = 2.3e-165, P = 2.3e-165
 Identities = 307/432 (71%), Positives = 345/432 (79%)

Query:    18 FSTAIPGPCMVHKRGTDILHDPWFNKDTGFPLTEXXXXXXXXXXXXXVISFEQQYARFME 77
             FSTAIPGPC+VHKRG DILHDPWFNKDTGFPLTE             V++  QQ  RF+E
Sbjct:    25 FSTAIPGPCIVHKRGADILHDPWFNKDTGFPLTERDRLGIRGLLPPRVMTCVQQCDRFIE 84

Query:    78 SFRSLEKNTEGQPNKVVSLAKWRILNRLHDRNETLYYRVLIDNIKDFAPIIYTPTVGLVC 137
             SFRSLE NT+G+P  VV+LAKWR+LNRLHDRNETLYYRVLIDNIKDFAPIIYTPTVGLVC
Sbjct:    85 SFRSLENNTKGEPENVVALAKWRMLNRLHDRNETLYYRVLIDNIKDFAPIIYTPTVGLVC 144

Query:   138 QNYSGLFRRPRGMYFSAKDKGEMMSMIYNWPAQQVDMIVLTDGSRILGLGDLGVQGIGIP 197
             QNYSGL+RRPRGMYFSAKDKGEMMSMIYNWPA QVDMIV+TDGSRILGLGDLGVQGIGIP
Sbjct:   145 QNYSGLYRRPRGMYFSAKDKGEMMSMIYNWPAPQVDMIVITDGSRILGLGDLGVQGIGIP 204

Query:   198 IGKLDVYVAAAGINPQRILPVMLDVGTNNQKLLEDRLYLGLRQPRLEGEEYLSIVDEFME 257
             IGKLD+YVAAAGINPQR+LP+MLDVGTNN+KLL++ LYLG+RQPRLEGEEYL I+DEFME
Sbjct:   205 IGKLDMYVAAAGINPQRVLPIMLDVGTNNEKLLQNDLYLGVRQPRLEGEEYLEIIDEFME 264

Query:   258 AVHARWPKAIVQFEDFQMKWAFETLERYRKRFCMFNDDIQXXXXXXXXXXXXXXRAQGLS 317
             A   RWPKA+VQFEDFQ KWAF TLERYRK+FCMFNDD+Q              RAQG  
Sbjct:   265 AAFTRWPKAVVQFEDFQAKWAFGTLERYRKKFCMFNDDVQGTAGVALAGLLGTVRAQGRP 324

Query:   318 LTDFADQKIXXXXXXXXXXXXXKMAVQAAARMAGNNDAFARNKFFLLDKDGLITKERKNL 377
             ++DF +QKI             KMAVQA ARMAG +++ A   F+L+DKDGL+T ER  L
Sbjct:   325 ISDFVNQKIVVVGAGSAGLGVTKMAVQAVARMAGISESEATKNFYLIDKDGLVTTERTKL 384

Query:   378 DPAAAPFAKDPGDFMGLREGASLLEVVRKVKPHXXXXXXXXXXXFNEEVLKAMRESDSVK 437
             DP A  FAK+P +   +REGAS++EVV+KV+PH           FNEEVLKAMRESDS K
Sbjct:   385 DPGAVLFAKNPAE---IREGASIVEVVKKVRPHVLLGLSGVGGIFNEEVLKAMRESDSCK 441

Query:   438 PAIFAMSNPTMN 449
             PAIFAMSNPT+N
Sbjct:   442 PAIFAMSNPTLN 453
GO:0004470 "malic enzyme activity" evidence=ISS
GO:0005739 "mitochondrion" evidence=ISM;IDA
GO:0006108 "malate metabolic process" evidence=IEA;ISS;IDA
GO:0016652 "oxidoreductase activity, acting on NAD(P)H, NAD(P) as acceptor" evidence=ISS
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0009507 "chloroplast" evidence=IDA
GO:0005524 "ATP binding" evidence=IDA
GO:0004471 "malate dehydrogenase (decarboxylating) activity" evidence=IDA
GO:0008948 "oxaloacetate decarboxylase activity" evidence=IDA
GO:0042803 "protein homodimerization activity" evidence=IDA
GO:0008270 "zinc ion binding" evidence=IDA
GO:0050897 "cobalt ion binding" evidence=IDA
GO:0005515 "protein binding" evidence=IPI
TAIR|locus:2054085 NAD-ME1 "AT2G13560" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-041111-294 me3 "malic enzyme 3, NADP(+)-dependent, mitochondrial" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:97043 Me1 "malic enzyme 1, NADP(+)-dependent, cytosolic" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
MGI|MGI:1916679 Me3 "malic enzyme 3, NADP(+)-dependent, mitochondrial" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|3074 Me1 "malic enzyme 1, NADP(+)-dependent, cytosolic" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P13697 Me1 "NADP-dependent malic enzyme" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1PQ35 ME3 "Malic enzyme" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E9PMB9 ME3 "Malic enzyme" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q16798 ME3 "NADP-dependent malic enzyme, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8L7K9MAO2_ARATH1, ., 1, ., 1, ., 3, 90.82110.89810.7116yesno
P37225MAON_SOLTU1, ., 1, ., 1, ., 3, 90.84190.94590.7570N/Ano

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.1.10.976
3rd Layer1.1.1.390.991

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query481
PLN03129 581 PLN03129, PLN03129, NADP-dependent malic enzyme; P 0.0
PRK13529 563 PRK13529, PRK13529, malate dehydrogenase; Provisio 0.0
PTZ00317 559 PTZ00317, PTZ00317, NADP-dependent malic enzyme; P 0.0
pfam00390182 pfam00390, malic, Malic enzyme, N-terminal domain 1e-105
COG0281432 COG0281, SfcA, Malic enzyme [Energy production and 3e-75
cd05312 279 cd05312, NAD_bind_1_malic_enz, NAD(P) binding doma 9e-56
pfam03949255 pfam03949, Malic_M, Malic enzyme, NAD binding doma 4e-53
smart00919231 smart00919, Malic_M, Malic enzyme, NAD binding dom 2e-42
cd00762254 cd00762, NAD_bind_malic_enz, NAD(P) binding domain 2e-28
PRK12862 763 PRK12862, PRK12862, malic enzyme; Reviewed 3e-17
PRK07232 752 PRK07232, PRK07232, bifunctional malic enzyme oxid 2e-16
cd05311226 cd05311, NAD_bind_2_malic_enz, NAD(P) binding doma 4e-14
PRK12861 764 PRK12861, PRK12861, malic enzyme; Reviewed 2e-10
cd01620317 cd01620, Ala_dh_like, Alanine dehydrogenase and re 0.003
>gnl|CDD|215594 PLN03129, PLN03129, NADP-dependent malic enzyme; Provisional Back     alignment and domain information 
 Score =  734 bits (1898), Expect = 0.0
 Identities = 245/444 (55%), Positives = 296/444 (66%), Gaps = 22/444 (4%)

Query: 8   AASVLSRSRRFSTAIPGPCMVHKRGTDILHDPWFNKDTGFPLTERDRLGLRGLLPPRVIS 67
              V             P +    G D+L DP +NK   F  TERDRLGLRGLLPP V+S
Sbjct: 18  VEDVYGEDAATEEQPVTPWVRVASGYDLLRDPRYNKGLAFTETERDRLGLRGLLPPAVLS 77

Query: 68  FEQQYARFMESFRSLEKNTEGQPNKVVSLAKWRILNRLHDRNETLYYRVLIDNIKDFAPI 127
            E Q  RFME+ R+LE            LAK+R L  L +RNE L+YRVLIDNI++  PI
Sbjct: 78  QELQVKRFMENLRALE----------SPLAKYRALMDLQERNERLFYRVLIDNIEELLPI 127

Query: 128 IYTPTVGLVCQNYSGLFRRPRGMYFSAKDKGEMMSMIYNWPAQQVDMIVLTDGSRILGLG 187
           +YTPTVG  CQ Y  LFRRPRG+Y S KDKG ++SM+ NWP + V +IV+TDG RILGLG
Sbjct: 128 VYTPTVGEACQKYGSLFRRPRGLYISLKDKGRVLSMLKNWPERDVQVIVVTDGERILGLG 187

Query: 188 DLGVQGIGIPIGKLDVYVAAAGINPQRILPVMLDVGTNNQKLLEDRLYLGLRQPRLEGEE 247
           DLGVQG+GIP+GKLD+Y AA GI P  +LPV +DVGTNN+KLL D  Y+GLRQPRL GEE
Sbjct: 188 DLGVQGMGIPVGKLDLYTAAGGIRPSAVLPVCIDVGTNNEKLLNDPFYIGLRQPRLTGEE 247

Query: 248 YLSIVDEFMEAVHARW-PKAIVQFEDFQMKWAFETLERYRKRFCMFNDDIQGTAGVALAG 306
           Y  +VDEFMEAV  RW PK +VQFEDF  K AF  L+RYR     FNDDIQGTA VALAG
Sbjct: 248 YDELVDEFMEAVKQRWGPKVLVQFEDFANKNAFRLLQRYRTTHLCFNDDIQGTAAVALAG 307

Query: 307 LLGTVRAQGLSLTDFADQKIVVVGAGSAGLGVLKMAVQAAARMAGNNDAFARNKFFLLDK 366
           LL  +RA G    D ADQ+I+  GAG AG G+ ++   A +R  G ++  AR + +L+D 
Sbjct: 308 LLAALRATG---GDLADQRILFAGAGEAGTGIAELIALAMSRQTGISEEEARKRIWLVDS 364

Query: 367 DGLITKERKN-LDPAAAPFAKDPGDFMGLREGASLLEVVRKVKPHVLLGLSGVGGVFNEE 425
            GL+TK RK+ L P   PFA D         GASLLE V+ +KP VL+GLSGVGG F +E
Sbjct: 365 KGLVTKSRKDSLQPFKKPFAHD------HEPGASLLEAVKAIKPTVLIGLSGVGGTFTKE 418

Query: 426 VLKAMRESDSVKPAIFAMSNPTMN 449
           VL+AM  S + +P IFA+SNPT  
Sbjct: 419 VLEAM-ASLNERPIIFALSNPTSK 441

Length = 581
>gnl|CDD|237414 PRK13529, PRK13529, malate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|240357 PTZ00317, PTZ00317, NADP-dependent malic enzyme; Provisional Back     alignment and domain information
>gnl|CDD|215894 pfam00390, malic, Malic enzyme, N-terminal domain Back     alignment and domain information
>gnl|CDD|223358 COG0281, SfcA, Malic enzyme [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|133454 cd05312, NAD_bind_1_malic_enz, NAD(P) binding domain of malic enzyme (ME), subgroup 1 Back     alignment and domain information
>gnl|CDD|217809 pfam03949, Malic_M, Malic enzyme, NAD binding domain Back     alignment and domain information
>gnl|CDD|214912 smart00919, Malic_M, Malic enzyme, NAD binding domain Back     alignment and domain information
>gnl|CDD|133442 cd00762, NAD_bind_malic_enz, NAD(P) binding domain of malic enzyme Back     alignment and domain information
>gnl|CDD|183799 PRK12862, PRK12862, malic enzyme; Reviewed Back     alignment and domain information
>gnl|CDD|235976 PRK07232, PRK07232, bifunctional malic enzyme oxidoreductase/phosphotransacetylase; Reviewed Back     alignment and domain information
>gnl|CDD|133453 cd05311, NAD_bind_2_malic_enz, NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>gnl|CDD|183798 PRK12861, PRK12861, malic enzyme; Reviewed Back     alignment and domain information
>gnl|CDD|240621 cd01620, Ala_dh_like, Alanine dehydrogenase and related dehydrogenases Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 481
KOG1257 582 consensus NADP+-dependent malic enzyme [Energy pro 100.0
PRK13529 563 malate dehydrogenase; Provisional 100.0
PTZ00317 559 NADP-dependent malic enzyme; Provisional 100.0
PLN03129 581 NADP-dependent malic enzyme; Provisional 100.0
COG0281432 SfcA Malic enzyme [Energy production and conversio 100.0
PRK12862 763 malic enzyme; Reviewed 100.0
PRK07232 752 bifunctional malic enzyme oxidoreductase/phosphotr 100.0
PRK12861 764 malic enzyme; Reviewed 100.0
PF00390182 malic: Malic enzyme, N-terminal domain; InterPro: 100.0
PF03949255 Malic_M: Malic enzyme, NAD binding domain; InterPr 100.0
cd00762254 NAD_bind_malic_enz NAD(P) binding domain of malic 100.0
cd05312 279 NAD_bind_1_malic_enz NAD(P) binding domain of mali 100.0
cd05311226 NAD_bind_2_malic_enz NAD(P) binding domain of mali 99.97
cd0519186 NAD_bind_amino_acid_DH NAD(P) binding domain of am 98.85
PRK05476425 S-adenosyl-L-homocysteine hydrolase; Provisional 97.85
TIGR00936406 ahcY adenosylhomocysteinase. This enzyme hydrolyze 97.36
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 97.17
cd05211217 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of 97.09
TIGR01035 417 hemA glutamyl-tRNA reductase. This enzyme, togethe 97.06
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain 97.05
PRK14982340 acyl-ACP reductase; Provisional 96.93
PLN02494 477 adenosylhomocysteinase 96.84
PRK00045 423 hemA glutamyl-tRNA reductase; Reviewed 96.79
PTZ00075476 Adenosylhomocysteinase; Provisional 96.75
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 96.75
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 96.56
PLN02477410 glutamate dehydrogenase 96.51
PRK14192283 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.38
PF00670162 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase 96.01
PRK00676338 hemA glutamyl-tRNA reductase; Validated 95.96
COG0373 414 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] 95.91
PTZ00079454 NADP-specific glutamate dehydrogenase; Provisional 95.91
PRK13940 414 glutamyl-tRNA reductase; Provisional 95.88
PLN00203 519 glutamyl-tRNA reductase 95.86
PRK14030445 glutamate dehydrogenase; Provisional 95.84
cd01076227 NAD_bind_1_Glu_DH NAD(P) binding domain of glutama 95.74
PRK14031444 glutamate dehydrogenase; Provisional 95.67
PRK08306296 dipicolinate synthase subunit A; Reviewed 95.64
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 95.52
PRK14175286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.5
PLN00106 323 malate dehydrogenase 95.47
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 95.37
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 95.36
PRK09414445 glutamate dehydrogenase; Provisional 95.33
cd05313254 NAD_bind_2_Glu_DH NAD(P) binding domain of glutama 94.97
PRK08328231 hypothetical protein; Provisional 94.71
cd05197 425 GH4_glycoside_hydrolases Glycoside Hydrases Family 94.33
PTZ00117 319 malate dehydrogenase; Provisional 94.1
PTZ00082 321 L-lactate dehydrogenase; Provisional 94.01
cd05212140 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding dom 93.94
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 93.94
PRK12549284 shikimate 5-dehydrogenase; Reviewed 93.94
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 93.86
PRK14191285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.82
PTZ00325 321 malate dehydrogenase; Provisional 93.75
cd05296 419 GH4_P_beta_glucosidase Glycoside Hydrolases Family 93.4
PLN02928347 oxidoreductase family protein 93.35
PRK09424 509 pntA NAD(P) transhydrogenase subunit alpha; Provis 93.28
PRK12749288 quinate/shikimate dehydrogenase; Reviewed 93.05
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 92.96
PRK12475 338 thiamine/molybdopterin biosynthesis MoeB-like prot 92.82
PF00208244 ELFV_dehydrog: Glutamate/Leucine/Phenylalanine/Val 92.8
PF00056141 Ldh_1_N: lactate/malate dehydrogenase, NAD binding 92.8
cd00650 263 LDH_MDH_like NAD-dependent, lactate dehydrogenase- 92.78
cd05291 306 HicDH_like L-2-hydroxyisocapronate dehydrogenases 92.7
PF01262168 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal 92.61
PRK08762376 molybdopterin biosynthesis protein MoeB; Validated 92.59
PRK14027283 quinate/shikimate dehydrogenase; Provisional 92.55
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 92.51
PRK10792285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 92.48
PRK14176287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 92.4
TIGR01809282 Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO 92.4
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 92.35
PF0380796 F420_oxidored: NADP oxidoreductase coenzyme F420-d 92.24
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 92.22
PRK05086 312 malate dehydrogenase; Provisional 92.18
PRK00066 315 ldh L-lactate dehydrogenase; Reviewed 92.08
PRK00257 381 erythronate-4-phosphate dehydrogenase; Validated 92.06
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 92.05
PRK14194301 bifunctional 5,10-methylene-tetrahydrofolate dehyd 91.99
TIGR01763 305 MalateDH_bact malate dehydrogenase, NAD-dependent. 91.98
PRK12548289 shikimate 5-dehydrogenase; Provisional 91.74
cd01079197 NAD_bind_m-THF_DH NAD binding domain of methylene- 91.67
PRK14189285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 91.58
PRK02842427 light-independent protochlorophyllide reductase su 91.33
cd00757228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 91.28
TIGR02355240 moeB molybdopterin synthase sulfurylase MoeB. This 91.18
PRK00258278 aroE shikimate 5-dehydrogenase; Reviewed 91.08
COG0169283 AroE Shikimate 5-dehydrogenase [Amino acid transpo 91.07
PRK08293 287 3-hydroxybutyryl-CoA dehydrogenase; Validated 91.01
PRK07066 321 3-hydroxybutyryl-CoA dehydrogenase; Validated 90.95
PRK12921 305 2-dehydropantoate 2-reductase; Provisional 90.93
PRK06223 307 malate dehydrogenase; Reviewed 90.9
PRK14851 679 hypothetical protein; Provisional 90.82
TIGR00872 298 gnd_rel 6-phosphogluconate dehydrogenase (decarbox 90.62
PF02882160 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cycl 90.62
TIGR00561 511 pntA NAD(P) transhydrogenase, alpha subunit. In so 90.38
PRK14190284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 90.25
PRK14183281 bifunctional 5,10-methylene-tetrahydrofolate dehyd 90.24
PRK14178279 bifunctional 5,10-methylene-tetrahydrofolate dehyd 90.13
PRK08605332 D-lactate dehydrogenase; Validated 89.96
PRK15438 378 erythronate-4-phosphate dehydrogenase PdxB; Provis 89.88
PRK08644212 thiamine biosynthesis protein ThiF; Provisional 89.67
PRK06129 308 3-hydroxyacyl-CoA dehydrogenase; Validated 89.59
cd05298 437 GH4_GlvA_pagL_like Glycoside Hydrolases Family 4; 89.57
PRK08374 336 homoserine dehydrogenase; Provisional 89.56
cd00704 323 MDH Malate dehydrogenase. Malate dehydrogenase (MD 89.44
KOG0029 501 consensus Amine oxidase [Secondary metabolites bio 89.36
PRK14179284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 89.27
PRK05442 326 malate dehydrogenase; Provisional 89.16
PRK12550272 shikimate 5-dehydrogenase; Reviewed 89.15
cd01336 325 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosoli 89.06
PRK14174295 bifunctional 5,10-methylene-tetrahydrofolate dehyd 88.65
PRK00094 325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr 88.65
cd05294 309 LDH-like_MDH_nadp A lactate dehydrogenases-like st 88.63
COG1486 442 CelF Alpha-galactosidases/6-phospho-beta-glucosida 88.55
PRK14619 308 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 88.5
PRK08410311 2-hydroxyacid dehydrogenase; Provisional 88.46
PF02056183 Glyco_hydro_4: Family 4 glycosyl hydrolase; InterP 88.44
PRK15076 431 alpha-galactosidase; Provisional 88.41
PLN03139386 formate dehydrogenase; Provisional 88.35
PRK12480330 D-lactate dehydrogenase; Provisional 88.3
KOG0685 498 consensus Flavin-containing amine oxidase [Coenzym 88.28
cd01485198 E1-1_like Ubiquitin activating enzyme (E1), repeat 87.96
TIGR02992326 ectoine_eutC ectoine utilization protein EutC. Mem 87.9
PRK14184286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 87.87
cd01337 310 MDH_glyoxysomal_mitochondrial Glyoxysomal and mito 87.86
PRK09260 288 3-hydroxybutyryl-CoA dehydrogenase; Validated 87.81
PRK14177284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 87.8
PRK14172278 bifunctional 5,10-methylene-tetrahydrofolate dehyd 87.77
cd05297 423 GH4_alpha_glucosidase_galactosidase Glycoside Hydr 87.71
PRK14170284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 87.36
PRK07688 339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 87.33
PRK05690245 molybdopterin biosynthesis protein MoeB; Provision 87.33
PLN02602 350 lactate dehydrogenase 87.26
PRK06436303 glycerate dehydrogenase; Provisional 87.12
PRK09599 301 6-phosphogluconate dehydrogenase-like protein; Rev 87.1
PRK08223287 hypothetical protein; Validated 87.09
PRK12439 341 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 86.87
PRK14188296 bifunctional 5,10-methylene-tetrahydrofolate dehyd 86.75
TIGR01772 312 MDH_euk_gproteo malate dehydrogenase, NAD-dependen 86.66
PF07992201 Pyr_redox_2: Pyridine nucleotide-disulphide oxidor 86.65
cd01483143 E1_enzyme_family Superfamily of activating enzymes 86.6
PF01113124 DapB_N: Dihydrodipicolinate reductase, N-terminus; 86.57
cd00755231 YgdL_like Family of activating enzymes (E1) of ubi 86.56
PRK06153393 hypothetical protein; Provisional 86.53
PRK14166282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 86.5
PRK07574385 formate dehydrogenase; Provisional 86.43
PRK05600 370 thiamine biosynthesis protein ThiF; Validated 86.42
TIGR01381 664 E1_like_apg7 E1-like protein-activating enzyme Gsa 86.42
COG0039 313 Mdh Malate/lactate dehydrogenases [Energy producti 86.39
PRK06522 304 2-dehydropantoate 2-reductase; Reviewed 86.35
PRK14187294 bifunctional 5,10-methylene-tetrahydrofolate dehyd 86.27
cd01492197 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit 86.23
TIGR03140 515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 86.16
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily o 86.13
cd01979396 Pchlide_reductase_N Pchlide_reductase_N: N protein 86.07
PRK08229 341 2-dehydropantoate 2-reductase; Provisional 86.06
PRK15469312 ghrA bifunctional glyoxylate/hydroxypyruvate reduc 85.98
PRK13243333 glyoxylate reductase; Reviewed 85.91
PRK07680 273 late competence protein ComER; Validated 85.72
COG0111324 SerA Phosphoglycerate dehydrogenase and related de 85.59
cd05293 312 LDH_1 A subgroup of L-lactate dehydrogenases. L-la 85.52
PTZ00345 365 glycerol-3-phosphate dehydrogenase; Provisional 85.48
cd01339 300 LDH-like_MDH L-lactate dehydrogenase-like malate d 85.13
PRK07634245 pyrroline-5-carboxylate reductase; Reviewed 85.05
PRK14169282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 84.94
PRK06932314 glycerate dehydrogenase; Provisional 84.94
PRK14171288 bifunctional 5,10-methylene-tetrahydrofolate dehyd 84.9
PRK14193284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 84.83
PLN02516299 methylenetetrahydrofolate dehydrogenase (NADP+) 84.78
PRK15317 517 alkyl hydroperoxide reductase subunit F; Provision 84.7
PRK14168297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 84.7
PRK05597 355 molybdopterin biosynthesis protein MoeB; Validated 84.67
TIGR00507270 aroE shikimate 5-dehydrogenase. This model finds p 84.52
TIGR01758 324 MDH_euk_cyt malate dehydrogenase, NAD-dependent. T 84.38
PRK06487317 glycerate dehydrogenase; Provisional 84.1
PRK15116268 sulfur acceptor protein CsdL; Provisional 83.87
PRK12490 299 6-phosphogluconate dehydrogenase-like protein; Rev 83.84
PRK14182282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 83.78
PRK14173287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 83.72
PRK13581 526 D-3-phosphoglycerate dehydrogenase; Provisional 83.68
PRK09310477 aroDE bifunctional 3-dehydroquinate dehydratase/sh 83.62
KOG0069336 consensus Glyoxylate/hydroxypyruvate reductase (D- 83.57
PRK14180282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 83.56
cd01338 322 MDH_choloroplast_like Chloroplast-like malate dehy 83.31
PRK10886196 DnaA initiator-associating protein DiaA; Provision 83.24
PRK14181287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 83.18
TIGR01759 323 MalateDH-SF1 malate dehydrogenase. This model repr 82.9
PRK11790 409 D-3-phosphoglycerate dehydrogenase; Provisional 82.63
KOG2337 669 consensus Ubiquitin activating E1 enzyme-like prot 82.3
PRK07411 390 hypothetical protein; Validated 82.16
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 81.92
PRK14620 326 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 81.71
PRK14167297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 81.61
PLN02616364 tetrahydrofolate dehydrogenase/cyclohydrolase, put 81.58
PRK07878 392 molybdopterin biosynthesis-like protein MoeZ; Vali 81.3
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 81.05
PRK07502 307 cyclohexadienyl dehydrogenase; Validated 80.94
PRK14186297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 80.83
PRK07679 279 pyrroline-5-carboxylate reductase; Reviewed 80.48
COG0334411 GdhA Glutamate dehydrogenase/leucine dehydrogenase 80.43
cd05290 307 LDH_3 A subgroup of L-lactate dehydrogenases. L-la 80.41
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 80.28
TIGR02279 503 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa 80.27
TIGR01915219 npdG NADPH-dependent F420 reductase. This model re 80.22
TIGR03376 342 glycerol3P_DH glycerol-3-phosphate dehydrogenase ( 80.05
>KOG1257 consensus NADP+-dependent malic enzyme [Energy production and conversion] Back     alignment and domain information 
Probab=100.00  E-value=1.1e-175  Score=1364.28  Aligned_cols=428  Identities=53%  Similarity=0.907  Sum_probs=419.9

Q ss_pred             ceeeccCccccccCCCCCcCCCCChHhhhccCcCCCCCCccccHHHHHHHHHHHHhccccccCCCCCCCCchhHHHHHHH
Q 011618           25 PCMVHKRGTDILHDPWFNKDTGFPLTERDRLGLRGLLPPRVISFEQQYARFMESFRSLEKNTEGQPNKVVSLAKWRILNR  104 (481)
Q Consensus        25 ~~~~~~~G~~~l~~p~~NKgtaFt~~ER~~lgl~GLLPp~v~tle~Q~~R~~~~~~~~~~~~~~~~~~~~~l~Ky~~L~~  104 (481)
                      ++..+++|+++|+||++|||+|||.+||++|||||||||.|.|+|+|+.||+.+|++++          +||+||+||+.
T Consensus        24 ~~~~~~~g~~ll~~p~~NKglAFTl~ERq~l~i~GLLPp~v~t~d~Q~~r~~~~l~~~~----------~~l~ky~~L~~   93 (582)
T KOG1257|consen   24 PVESKKRGYDLLRDPRYNKGLAFTLEERQRLGIHGLLPPVVRTQDEQALRCMNNLRSLT----------SPLAKYIYLMD   93 (582)
T ss_pred             ccccccCChhhccCCCcccccccCHHHHHhhCccccCCccccCHHHHHHHHHHHHHhcc----------chHHHHHHHHH
Confidence            45567899999999999999999999999999999999999999999999999999999          89999999999


Q ss_pred             hhcccceeeeeeeccCcccccccccchhhHHHHHHHhhcccCCCccccccCChhhHHHHHhcCCCCCeeEEEEecCceee
Q 011618          105 LHDRNETLYYRVLIDNIKDFAPIIYTPTVGLVCQNYSGLFRRPRGMYFSAKDKGEMMSMIYNWPAQQVDMIVLTDGSRIL  184 (481)
Q Consensus       105 L~~rNe~LFy~ll~~~~~e~lpiiYTPtVg~ac~~~s~~~rrprGlyis~~d~g~i~~~l~nwp~~~v~viVVTDG~rIL  184 (481)
                      ||+|||+|||+++++|++|+||||||||||+|||+||++||+|+|||||++|+|||.++|+|||.++|++||||||+|||
T Consensus        94 L~~rNerLfY~~l~~nie~~~PIvYTPTvG~acq~y~~i~r~p~Glfisi~D~Ghi~~~l~nWp~~~V~~IvVTDGerIL  173 (582)
T KOG1257|consen   94 LQDRNERLFYRLLIDNIEELLPIVYTPTVGLACQQYGLIFRRPQGLFISIKDKGHIKQVLKNWPERNVKAIVVTDGERIL  173 (582)
T ss_pred             HHHhhhHHHHHHHHhhHHHhCCeeecCcHHHHHHHhhhhhccCceeEEEecccchHHHHHHhCCccceeEEEEeCCCcee
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccCCCCCccccccchhhhhhhhhcCCCCCceecEEeeccCCccccccCcccccccccCCChhhhhHhHHHHHHHHHHhC-
Q 011618          185 GLGDLGVQGIGIPIGKLDVYVAAAGINPQRILPVMLDVGTNNQKLLEDRLYLGLRQPRLEGEEYLSIVDEFMEAVHARW-  263 (481)
Q Consensus       185 GLGDlG~~Gm~I~iGKl~LY~a~gGI~P~~~LPV~LDvGTnN~~LL~Dp~YlG~r~~R~~g~~Y~~~vdefv~av~~~~-  263 (481)
                      ||||||++|||||+||++||||||||+|++|||||||||||||+||+||+|+|+|++|++|++||+|+||||+||+++| 
T Consensus       174 GLGDlG~~GmgIpvgKL~Lyta~~GI~P~~cLPV~LDVGTNNe~Ll~DplYiGLr~~R~~g~eYd~~~dEFm~Av~~~yG  253 (582)
T KOG1257|consen  174 GLGDLGVNGMGIPVGKLALYTALGGIRPSRCLPVCLDVGTNNEKLLNDPLYIGLRQRRVRGKEYDEFLDEFMEAVVQRYG  253 (582)
T ss_pred             cccccccCcccceecHHHHHHHhcCCChhhceeEEEeccCChHHHhcCccccccccccccccHHHHHHHHHHHHHHHHhC
Confidence            9999999999999999999999999999999999999999999999999999999999999999999999999999999 


Q ss_pred             CceEEEeecCCCchHHHHHHHHhhcCCccccCcchhHHHHHHHHHHHHHHhCCCCCCCCCceEEEeCccHHHHHHHHHHH
Q 011618          264 PKAIVQFEDFQMKWAFETLERYRKRFCMFNDDIQGTAGVALAGLLGTVRAQGLSLTDFADQKIVVVGAGSAGLGVLKMAV  343 (481)
Q Consensus       264 P~~~IqfEDf~~~naf~iL~ryr~~~~~FNDDiQGTaaV~LAgll~Alr~~g~~l~dl~~~riv~~GAGsAg~GiA~ll~  343 (481)
                      |+++||||||+++|||++|+|||+++|||||||||||||+|||||+|+|++|++|+|   ++|||+|||+||+|||+||+
T Consensus       254 ~~~lIqFEDF~~~nAfrlL~kYr~~~c~FNDDIQGTaaValAgllaa~rit~~~lsd---~~ilf~GAG~A~~GIA~l~v  330 (582)
T KOG1257|consen  254 PNTLIQFEDFANHNAFRLLEKYRNKYCMFNDDIQGTAAVALAGLLAALRITGKPLSD---HVILFLGAGEAALGIANLIV  330 (582)
T ss_pred             cceEEEehhccchhHHHHHHHhccccceecccccchhHHHHHHHHHHHHHhCCcccc---ceEEEecCchHHhhHHHHHH
Confidence            999999999999999999999999999999999999999999999999999999999   99999999999999999999


Q ss_pred             HHHHHHcCCChhhhcCeEEEEeccceeecCCC-CCChhhhccccccCCcCCcCCCCCHHHHhcccCCcEEEeecCCCCCC
Q 011618          344 QAAARMAGNNDAFARNKFFLLDKDGLITKERK-NLDPAAAPFAKDPGDFMGLREGASLLEVVRKVKPHVLLGLSGVGGVF  422 (481)
Q Consensus       344 ~~~~~~~Gls~eeA~~~i~lvD~~GLi~~~r~-~l~~~k~~fA~~~~~~~~~~~~~~L~e~V~~vkptvLIG~S~~~g~F  422 (481)
                      .+|+ ++|+|+|||+++|||+|++|||+++|+ +++++|++|||+++++      .+|+|||+.||||||||+|++||+|
T Consensus       331 ~~m~-~~Gl~~eeA~kkIwlvD~~GLi~~~r~~~l~~~~~~fAk~~~~~------~~L~e~V~~vKPtvLiG~S~~~g~F  403 (582)
T KOG1257|consen  331 MAMV-KEGLSEEEARKKIWLVDSKGLITKGRKASLTEEKKPFAKDHEEI------KDLEEAVKEVKPTVLIGASGVGGAF  403 (582)
T ss_pred             HHHH-HcCCCHHHHhccEEEEecCceeeccccCCCChhhccccccChHH------HHHHHHHHhcCCcEEEecccCCccC
Confidence            9999 679999999999999999999999996 9999999999998754      5899999999999999999999999


Q ss_pred             CHHHHHHhhhcCCCCCEEEecCCCCCCCCCCCCHHHHHhcccCCccccccCcee
Q 011618          423 NEEVLKAMRESDSVKPAIFAMSNPTMNGLFSCCVTTFFFYLMAARSSFLTSSFV  476 (481)
Q Consensus       423 t~evv~~Ma~~~~erPIIFaLSNPt~~aE~~~t~eda~~wt~g~r~~f~~~~~~  476 (481)
                      ||||||+|++ +|||||||||||||+++|  |||||||+||+| ||+|++|||.
T Consensus       404 teevl~~Ma~-~~erPiIFalSNPT~~aE--Ctae~ay~~t~G-r~ifaSGSPF  453 (582)
T KOG1257|consen  404 TEEVLRAMAK-SNERPIIFALSNPTSKAE--CTAEQAYKWTKG-RAIFASGSPF  453 (582)
T ss_pred             CHHHHHHHHh-cCCCceEEecCCCccccc--cCHHHHhhhcCC-cEEEecCCCC
Confidence            9999999975 999999999999999999  999999999996 9999999985

>PRK13529 malate dehydrogenase; Provisional Back     alignment and domain information
>PTZ00317 NADP-dependent malic enzyme; Provisional Back     alignment and domain information
>PLN03129 NADP-dependent malic enzyme; Provisional Back     alignment and domain information
>COG0281 SfcA Malic enzyme [Energy production and conversion] Back     alignment and domain information
>PRK12862 malic enzyme; Reviewed Back     alignment and domain information
>PRK07232 bifunctional malic enzyme oxidoreductase/phosphotransacetylase; Reviewed Back     alignment and domain information
>PRK12861 malic enzyme; Reviewed Back     alignment and domain information
>PF00390 malic: Malic enzyme, N-terminal domain; InterPro: IPR012301 Malic enzymes (malate oxidoreductases) catalyse the oxidative decarboxylation of malate to form pyruvate [], a reaction important in a number of metabolic pathways - e Back     alignment and domain information
>PF03949 Malic_M: Malic enzyme, NAD binding domain; InterPro: IPR012302 Malic enzymes (malate oxidoreductases) catalyse the oxidative decarboxylation of malate to form pyruvate [], a reaction important in a number of metabolic pathways - e Back     alignment and domain information
>cd00762 NAD_bind_malic_enz NAD(P) binding domain of malic enzyme Back     alignment and domain information
>cd05312 NAD_bind_1_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 1 Back     alignment and domain information
>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>TIGR00936 ahcY adenosylhomocysteinase Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>TIGR01035 hemA glutamyl-tRNA reductase Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>PRK14982 acyl-ACP reductase; Provisional Back     alignment and domain information
>PLN02494 adenosylhomocysteinase Back     alignment and domain information
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>PTZ00075 Adenosylhomocysteinase; Provisional Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PLN02477 glutamate dehydrogenase Back     alignment and domain information
>PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 Back     alignment and domain information
>PRK00676 hemA glutamyl-tRNA reductase; Validated Back     alignment and domain information
>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] Back     alignment and domain information
>PTZ00079 NADP-specific glutamate dehydrogenase; Provisional Back     alignment and domain information
>PRK13940 glutamyl-tRNA reductase; Provisional Back     alignment and domain information
>PLN00203 glutamyl-tRNA reductase Back     alignment and domain information
>PRK14030 glutamate dehydrogenase; Provisional Back     alignment and domain information
>cd01076 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 1 Back     alignment and domain information
>PRK14031 glutamate dehydrogenase; Provisional Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PLN00106 malate dehydrogenase Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>PRK09414 glutamate dehydrogenase; Provisional Back     alignment and domain information
>cd05313 NAD_bind_2_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 2 Back     alignment and domain information
>PRK08328 hypothetical protein; Provisional Back     alignment and domain information
>cd05197 GH4_glycoside_hydrolases Glycoside Hydrases Family 4 Back     alignment and domain information
>PTZ00117 malate dehydrogenase; Provisional Back     alignment and domain information
>PTZ00082 L-lactate dehydrogenase; Provisional Back     alignment and domain information
>cd05212 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>PRK14191 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PTZ00325 malate dehydrogenase; Provisional Back     alignment and domain information
>cd05296 GH4_P_beta_glucosidase Glycoside Hydrolases Family 4; Phospho-beta-glucosidase Back     alignment and domain information
>PLN02928 oxidoreductase family protein Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>PRK12749 quinate/shikimate dehydrogenase; Reviewed Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>PF00208 ELFV_dehydrog: Glutamate/Leucine/Phenylalanine/Valine dehydrogenase; InterPro: IPR006096 Glutamate, leucine, phenylalanine and valine dehydrogenases are structurally and functionally related Back     alignment and domain information
>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] Back     alignment and domain information
>cd00650 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 Back     alignment and domain information
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK14027 quinate/shikimate dehydrogenase; Provisional Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>PRK10792 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14176 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>PRK05086 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK00066 ldh L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>PRK00257 erythronate-4-phosphate dehydrogenase; Validated Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>PRK14194 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>cd01079 NAD_bind_m-THF_DH NAD binding domain of methylene-tetrahydrofolate dehydrogenase Back     alignment and domain information
>PRK14189 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK02842 light-independent protochlorophyllide reductase subunit N; Provisional Back     alignment and domain information
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA Back     alignment and domain information
>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK12921 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK06223 malate dehydrogenase; Reviewed Back     alignment and domain information
>PRK14851 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PF02882 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain; InterPro: IPR020631 Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF) Back     alignment and domain information
>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit Back     alignment and domain information
>PRK14190 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14183 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14178 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK08605 D-lactate dehydrogenase; Validated Back     alignment and domain information
>PRK15438 erythronate-4-phosphate dehydrogenase PdxB; Provisional Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>cd05298 GH4_GlvA_pagL_like Glycoside Hydrolases Family 4; GlvA- and pagL-like glycosidases Back     alignment and domain information
>PRK08374 homoserine dehydrogenase; Provisional Back     alignment and domain information
>cd00704 MDH Malate dehydrogenase Back     alignment and domain information
>KOG0029 consensus Amine oxidase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK14179 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK05442 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK12550 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>cd01336 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosolic Malate dehydrogenases Back     alignment and domain information
>PRK14174 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>cd05294 LDH-like_MDH_nadp A lactate dehydrogenases-like structure with malate dehydrogenase enzymatic activity Back     alignment and domain information
>COG1486 CelF Alpha-galactosidases/6-phospho-beta-glucosidases, family 4 of glycosyl hydrolases [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK08410 2-hydroxyacid dehydrogenase; Provisional Back     alignment and domain information
>PF02056 Glyco_hydro_4: Family 4 glycosyl hydrolase; InterPro: IPR001088 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PRK15076 alpha-galactosidase; Provisional Back     alignment and domain information
>PLN03139 formate dehydrogenase; Provisional Back     alignment and domain information
>PRK12480 D-lactate dehydrogenase; Provisional Back     alignment and domain information
>KOG0685 consensus Flavin-containing amine oxidase [Coenzyme transport and metabolism] Back     alignment and domain information
>cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like Back     alignment and domain information
>TIGR02992 ectoine_eutC ectoine utilization protein EutC Back     alignment and domain information
>PRK14184 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd01337 MDH_glyoxysomal_mitochondrial Glyoxysomal and mitochondrial malate dehydrogenases Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK14177 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14172 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd05297 GH4_alpha_glucosidase_galactosidase Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases Back     alignment and domain information
>PRK14170 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>PLN02602 lactate dehydrogenase Back     alignment and domain information
>PRK06436 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PRK08223 hypothetical protein; Validated Back     alignment and domain information
>PRK12439 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK14188 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR01772 MDH_euk_gproteo malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] Back     alignment and domain information
>cd00755 YgdL_like Family of activating enzymes (E1) of ubiquitin-like proteins related to the E Back     alignment and domain information
>PRK06153 hypothetical protein; Provisional Back     alignment and domain information
>PRK14166 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK07574 formate dehydrogenase; Provisional Back     alignment and domain information
>PRK05600 thiamine biosynthesis protein ThiF; Validated Back     alignment and domain information
>TIGR01381 E1_like_apg7 E1-like protein-activating enzyme Gsa7p/Apg7p Back     alignment and domain information
>COG0039 Mdh Malate/lactate dehydrogenases [Energy production and conversion] Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information
>PRK14187 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>cd01487 E1_ThiF_like E1_ThiF_like Back     alignment and domain information
>cd01979 Pchlide_reductase_N Pchlide_reductase_N: N protein of the NB protein complex of Protochlorophyllide (Pchlide)_reductase Back     alignment and domain information
>PRK08229 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>PRK07680 late competence protein ComER; Validated Back     alignment and domain information
>COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>cd05293 LDH_1 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PTZ00345 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>cd01339 LDH-like_MDH L-lactate dehydrogenase-like malate dehydrogenase proteins Back     alignment and domain information
>PRK07634 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK14169 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK06932 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK14171 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14193 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PLN02516 methylenetetrahydrofolate dehydrogenase (NADP+) Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>PRK14168 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>TIGR00507 aroE shikimate 5-dehydrogenase Back     alignment and domain information
>TIGR01758 MDH_euk_cyt malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PRK06487 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK15116 sulfur acceptor protein CsdL; Provisional Back     alignment and domain information
>PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PRK14182 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14173 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK09310 aroDE bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase protein; Reviewed Back     alignment and domain information
>KOG0069 consensus Glyoxylate/hydroxypyruvate reductase (D-isomer-specific 2-hydroxy acid dehydrogenase superfamily) [Energy production and conversion] Back     alignment and domain information
>PRK14180 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd01338 MDH_choloroplast_like Chloroplast-like malate dehydrogenases Back     alignment and domain information
>PRK10886 DnaA initiator-associating protein DiaA; Provisional Back     alignment and domain information
>PRK14181 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR01759 MalateDH-SF1 malate dehydrogenase Back     alignment and domain information
>PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>KOG2337 consensus Ubiquitin activating E1 enzyme-like protein [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK07411 hypothetical protein; Validated Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK14167 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PLN02616 tetrahydrofolate dehydrogenase/cyclohydrolase, putative Back     alignment and domain information
>PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>PRK07502 cyclohexadienyl dehydrogenase; Validated Back     alignment and domain information
>PRK14186 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK07679 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>COG0334 GdhA Glutamate dehydrogenase/leucine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>cd05290 LDH_3 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC Back     alignment and domain information
>TIGR01915 npdG NADPH-dependent F420 reductase Back     alignment and domain information
>TIGR03376 glycerol3P_DH glycerol-3-phosphate dehydrogenase (NAD(+)) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query481
1llq_A 605 Crystal Structure Of Malic Enzyme From Ascaris Suum 3e-79
2aw5_A 575 Crystal Structure Of A Human Malic Enzyme Length = 1e-76
1gq2_A 555 Malic Enzyme From Pigeon Liver Length = 555 6e-73
1gz3_A 554 Molecular Mechanism For The Regulation Of Human Mit 2e-67
1qr6_A 584 Human Mitochondrial Nad(P)-Dependent Malic Enzyme L 6e-66
1efk_A 584 Structure Of Human Malic Enzyme In Complex With Ket 7e-66
1do8_A 564 Crystal Structure Of A Closed Form Of Human Mitocho 9e-66
1gz4_A 551 Molecular Mechanism Of The Regulation Of Human Mito 2e-65
>pdb|1LLQ|A Chain A, Crystal Structure Of Malic Enzyme From Ascaris Suum Complexed With Nicotinamide Adenine Dinucleotide Length = 605 Back     alignment and structure 
Iteration: 1

 Score =  292 bits (747), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 164/421 (38%), Positives = 236/421 (56%), Gaps = 24/421 (5%)
Query: 30  KRGTDILHDPWFNKDTGFPLTEXXXXXXXXXXXXXVISFEQQYARFMESFRSLEKNTEGQ 89
           KR  ++L +P  NK  GF L E              ++ EQQ  R +   R        Q
Sbjct: 37  KRSAELLKEPRLNKGMGFSLYERQYLGLHGLLPPAFMTQEQQAYRVITKLRE-------Q 89
Query: 90  PNKVVSLAKWRILNRLHDRNETLYYRVLIDNIKDFAPIIYTPTVGLVCQNYSGLFRRPRG 149
           PN    LA++  L+ L DRNE L+YRV+ D++K+  PI+YTPTVGL CQN+  ++R+P+G
Sbjct: 90  PN---DLARYIQLDGLQDRNEKLFYRVVCDHVKELMPIVYTPTVGLACQNFGYIYRKPKG 146
Query: 150 MYFSAKDKG--EMMSMIYNWPAQQVDMIVLTDGSRILGLGDLGVQGIGIPIGKLDVYVAA 207
           +Y +  D    ++  ++ NW  + V  IV+TDG RILGLGDLG  GIGIP+GKL +YVA 
Sbjct: 147 LYITINDNSVSKIYQILSNWHEEDVRAIVVTDGERILGLGDLGAYGIGIPVGKLALYVAL 206
Query: 208 AGINPQRILPVMLDVGTNNQKLLEDRLYLGLRQPRLEGEEYLSIVDEFMEAVHARW-PKA 266
            G+ P+  LPV+LDVGTNN  LL D  Y+GLR  R+ G++Y +++D FM+A   ++  K 
Sbjct: 207 GGVQPKWCLPVLLDVGTNNMDLLNDPFYIGLRHKRVRGKDYDTLLDNFMKACTKKYGQKT 266
Query: 267 IVQFEDFQMKWAFETLERYRKRFCMFNDDIQXXXXXXXXXXXXXXRAQGLSLTDFADQKI 326
           ++QFEDF    AF  L++Y+ ++ MFNDDIQ              R   ++    + +K 
Sbjct: 267 LIQFEDFANPNAFRLLDKYQDKYTMFNDDIQGTASVIVAGLLTCTR---VTKKLVSQEKY 323
Query: 327 XXXXXXXXXXXXXKMAVQAAARMAGNNDAFARNKFFLLDKDGLITKERKNLDPAAAPFAK 386
                        +M V    +  G +   A N+ +L+D DGL+TK RK ++P    FAK
Sbjct: 324 LFFGAGAASTGIAEMIVH-QMQNEGISKEEACNRIYLMDIDGLVTKNRKEMNPRHVQFAK 382
Query: 387 DPGDFMGLREGASLLEVVRKVKPHXXXXXXXXXXXFNEEVLKAMRESDSVKPAIFAMSNP 446
           D      + E  S+LEV+R  +P            FNEEV++AM E +  +P IFA+SNP
Sbjct: 383 D------MPETTSILEVIRAARPGALIGASTVRGAFNEEVIRAMAEINE-RPIIFALSNP 435
Query: 447 T 447
           T
Sbjct: 436 T 436
>pdb|2AW5|A Chain A, Crystal Structure Of A Human Malic Enzyme Length = 575 Back     alignment and structure
>pdb|1GQ2|A Chain A, Malic Enzyme From Pigeon Liver Length = 555 Back     alignment and structure
>pdb|1GZ3|A Chain A, Molecular Mechanism For The Regulation Of Human Mitochondrial Nad(P)+-Dependent Malic Enzyme By Atp And Fumarate Length = 554 Back     alignment and structure
>pdb|1QR6|A Chain A, Human Mitochondrial Nad(P)-Dependent Malic Enzyme Length = 584 Back     alignment and structure
>pdb|1EFK|A Chain A, Structure Of Human Malic Enzyme In Complex With Ketomalonate Length = 584 Back     alignment and structure
>pdb|1DO8|A Chain A, Crystal Structure Of A Closed Form Of Human Mitochondrial Nad(P)+-Dependent Malic Enzyme Length = 564 Back     alignment and structure
>pdb|1GZ4|A Chain A, Molecular Mechanism Of The Regulation Of Human Mitochondrial Nad(P)+-Dependent Malic Enzyme By Atp And Fumarate Length = 551 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query481
1gq2_A 555 Malic enzyme; oxidoreductase, pigeon liver, NADP-d 0.0
1pj3_A 564 NAD-dependent malic enzyme, mitochondrial; oxidati 0.0
1o0s_A 605 NAD-ME, NAD-dependent malic enzyme; oxidoreductase 0.0
3nv9_A 487 Malic enzyme; rossmann fold, oxidoreductase; 2.25A 3e-25
2a9f_A398 Putative malic enzyme ((S)-malate:NAD+ oxidoreduct 4e-22
1vl6_A388 Malate oxidoreductase; TM0542, NAD-dependent malic 1e-21
2dvm_A 439 Malic enzyme, 439AA long hypothetical malate oxido 5e-19
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-04
>1gq2_A Malic enzyme; oxidoreductase, pigeon liver, NADP-dependent, NAD-NADP selectivity, decarboxylase, malate, Mn2+; HET: NAP; 2.5A {Columba livia} SCOP: c.2.1.7 c.58.1.3 PDB: 2aw5_A Length = 555 Back     alignment and structure
 Score =  581 bits (1500), Expect = 0.0
 Identities = 180/421 (42%), Positives = 261/421 (61%), Gaps = 22/421 (5%)

Query: 30  KRGTDILHDPWFNKDTGFPLTERDRLGLRGLLPPRVISFEQQYARFMESFRSLEKNTEGQ 89
           K+G ++L DP  NK   F L ER +L + GLLPP  +  + Q    +++F  L  +    
Sbjct: 1   KKGYEVLRDPHLNKGMAFTLEERQQLNIHGLLPPCFLGQDAQVYSILKNFERLTSD---- 56

Query: 90  PNKVVSLAKWRILNRLHDRNETLYYRVLIDNIKDFAPIIYTPTVGLVCQNYSGLFRRPRG 149
                 L ++ +L  L DRNE L+Y+VL  +I+ F PI+YTPTVGL CQ+Y   FRRPRG
Sbjct: 57  ------LDRYILLMSLQDRNEKLFYKVLTSDIERFMPIVYTPTVGLACQHYGLAFRRPRG 110

Query: 150 MYFSAKDKGEMMSMIYNWPAQQVDMIVLTDGSRILGLGDLGVQGIGIPIGKLDVYVAAAG 209
           ++ +  D+G + +M+ +WP   +  IV+TDG RILGLGDLG  G+GIP+GKL +Y A  G
Sbjct: 111 LFITIHDRGHIATMLQSWPESVIKAIVVTDGERILGLGDLGCYGMGIPVGKLALYTACGG 170

Query: 210 INPQRILPVMLDVGTNNQKLLEDRLYLGLRQPRLEGEEYLSIVDEFMEAVHARWP-KAIV 268
           + P + LPVMLDVGT+N+ LL+D LY+GLR  R+ G+ Y  ++DEFMEAV +R+    ++
Sbjct: 171 VKPHQCLPVMLDVGTDNETLLKDPLYIGLRHKRIRGQAYDDLLDEFMEAVTSRYGMNCLI 230

Query: 269 QFEDFQMKWAFETLERYRKRFCMFNDDIQGTAGVALAGLLGTVRAQGLSLTDFADQKIVV 328
           QFEDF    AF  L +YR ++C FNDDIQGTA VA+AGLL  +R     L+   D  ++ 
Sbjct: 231 QFEDFANANAFRLLHKYRNKYCTFNDDIQGTASVAVAGLLAALRITKNRLS---DHTVLF 287

Query: 329 VGAGSAGLGVLKMAVQAAARMAGNNDAFARNKFFLLDKDGLITKERKNLDPAAAPFAKDP 388
            GAG A LG+  + V A  +  G +   A  + +++D  GLI K R +L P    FA + 
Sbjct: 288 QGAGEAALGIANLIVMAMQKE-GVSKEEAIKRIWMVDSKGLIVKGRASLTPEKEHFAHEH 346

Query: 389 GDFMGLREGASLLEVVRKVKPHVLLGLSGVGGVFNEEVLKAMRESDSVKPAIFAMSNPTM 448
                  E  +L ++V+ +KP VL+G++ +GG F +++L+ M   +  +P IFA+SNPT 
Sbjct: 347 ------CEMKNLEDIVKDIKPTVLIGVAAIGGAFTQQILQDMAAFNK-RPIIFALSNPTS 399

Query: 449 N 449
            
Sbjct: 400 K 400
>1pj3_A NAD-dependent malic enzyme, mitochondrial; oxidative decarboxylase, oxidoreductase; HET: NAD; 2.10A {Homo sapiens} SCOP: c.2.1.7 c.58.1.3 PDB: 1pj2_A* 1do8_A* 1pj4_A* 1qr6_A* 1efl_A* 1pjl_A* 1efk_A* 1gz4_A* 1gz3_A* Length = 564 Back     alignment and structure
>1o0s_A NAD-ME, NAD-dependent malic enzyme; oxidoreductase, oxidative decarboxylase, rossmann fold, MAla dehydrogenase; HET: NAI; 2.00A {Ascaris suum} SCOP: c.2.1.7 c.58.1.3 PDB: 1llq_A* Length = 605 Back     alignment and structure
>3nv9_A Malic enzyme; rossmann fold, oxidoreductase; 2.25A {Entamoeba histolytica} Length = 487 Back     alignment and structure
>2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} Length = 398 Back     alignment and structure
>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Length = 388 Back     alignment and structure
>2dvm_A Malic enzyme, 439AA long hypothetical malate oxidoreductase; NAD, structural genomics, NPPSFA; HET: NAD MES; 1.60A {Pyrococcus horikoshii} PDB: 1ww8_A* Length = 439 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query481
1gq2_A 555 Malic enzyme; oxidoreductase, pigeon liver, NADP-d 100.0
1pj3_A 564 NAD-dependent malic enzyme, mitochondrial; oxidati 100.0
1o0s_A 605 NAD-ME, NAD-dependent malic enzyme; oxidoreductase 100.0
3nv9_A 487 Malic enzyme; rossmann fold, oxidoreductase; 2.25A 100.0
2a9f_A398 Putative malic enzyme ((S)-malate:NAD+ oxidoreduct 100.0
1vl6_A388 Malate oxidoreductase; TM0542, NAD-dependent malic 100.0
2dvm_A 439 Malic enzyme, 439AA long hypothetical malate oxido 100.0
3gvp_A435 Adenosylhomocysteinase 3; protein CO-factor comple 98.75
3h9u_A 436 Adenosylhomocysteinase; NAD CO-factor complex, str 98.75
1x13_A401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 98.66
3ond_A 488 Adenosylhomocysteinase; plant protein, enzyme-subs 98.09
3n58_A464 Adenosylhomocysteinase; ssgcid, hydrolase, structu 97.76
1l7d_A384 Nicotinamide nucleotide transhydrogenase, subunit 97.6
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 97.17
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 96.75
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 96.7
1a4i_A301 Methylenetetrahydrofolate dehydrogenase / methenyl 96.19
3k92_A424 NAD-GDH, NAD-specific glutamate dehydrogenase; ROC 96.18
4fcc_A450 Glutamate dehydrogenase; protein complex, rossmann 96.1
3l07_A285 Bifunctional protein fold; structural genomics, ID 95.98
3p2o_A285 Bifunctional protein fold; structural genomics, ce 95.96
3r3j_A456 Glutamate dehydrogenase; rossman fold, oxidoreduct 95.88
4a5o_A286 Bifunctional protein fold; oxidoreductase, hydrola 95.77
3aoe_E419 Glutamate dehydrogenase; rossmann fold, NADH, oxid 95.69
3ngx_A276 Bifunctional protein fold; methylenetetrahydrofola 95.63
3aog_A440 Glutamate dehydrogenase; NAD(H), oxidoreducta; HET 95.53
1b0a_A288 Protein (fold bifunctional protein); folate, dehyd 95.49
1v8b_A 479 Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2 95.44
4a26_A300 Putative C-1-tetrahydrofolate synthase, cytoplasm; 95.35
1edz_A320 5,10-methylenetetrahydrofolate dehydrogenase; nucl 95.15
2yfq_A421 Padgh, NAD-GDH, NAD-specific glutamate dehydrogena 95.09
1gpj_A 404 Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro 94.98
3don_A277 Shikimate dehydrogenase; alpha-beta structure, ros 94.57
2bma_A470 Glutamate dehydrogenase (NADP+); malaria, drug des 94.54
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 94.43
2c2x_A281 Methylenetetrahydrofolate dehydrogenase- methenylt 94.4
3d64_A494 Adenosylhomocysteinase; structural genomics, ssgci 94.38
3ce6_A494 Adenosylhomocysteinase; protein-substrate complex, 94.21
1pzg_A 331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 93.49
1c1d_A355 L-phenylalanine dehydrogenase; amino acid dehydrog 93.49
2tmg_A415 Protein (glutamate dehydrogenase); metabolic role, 93.46
3fbt_A282 Chorismate mutase and shikimate 5-dehydrogenase fu 93.35
3jyo_A283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 93.34
3u95_A 477 Glycoside hydrolase, family 4; hydrolysis, cytosol 93.3
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 93.29
3t4e_A312 Quinate/shikimate dehydrogenase; structural genomi 93.2
2o4c_A 380 Erythronate-4-phosphate dehydrogenase; erythronate 93.14
3o8q_A281 Shikimate 5-dehydrogenase I alpha; structural geno 92.98
3tum_A269 Shikimate dehydrogenase family protein; rossmann-f 92.93
3dtt_A245 NADP oxidoreductase; structural genomics, joint ce 92.83
3h8v_A 292 Ubiquitin-like modifier-activating enzyme 5; rossm 92.67
2rir_A300 Dipicolinate synthase, A chain; structural genomic 92.63
3u62_A253 Shikimate dehydrogenase; shikimate pathway, oxidor 92.58
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 92.48
3pwz_A272 Shikimate dehydrogenase 3; alpha-beta, oxidoreduct 92.47
2ekl_A313 D-3-phosphoglycerate dehydrogenase; structural gen 92.46
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 92.4
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 92.3
3mw9_A 501 GDH 1, glutamate dehydrogenase 1; allostery, inhib 92.26
1bgv_A449 Glutamate dehydrogenase; oxidoreductase; HET: GLU; 92.09
3rui_A 340 Ubiquitin-like modifier-activating enzyme ATG7; au 92.09
4e21_A 358 6-phosphogluconate dehydrogenase (decarboxylating; 92.0
2ewd_A 317 Lactate dehydrogenase,; protein-substrate_cofactor 91.9
1v9l_A421 Glutamate dehydrogenase; protein-NAD complex, oxid 91.79
1mld_A 314 Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D 91.77
2rcy_A 262 Pyrroline carboxylate reductase; malaria, structur 91.63
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 91.56
2gcg_A330 Glyoxylate reductase/hydroxypyruvate reductase; NA 91.52
3oet_A 381 Erythronate-4-phosphate dehydrogenase; structural 91.44
2zyd_A 480 6-phosphogluconate dehydrogenase, decarboxylating; 91.44
1wwk_A307 Phosphoglycerate dehydrogenase; riken structural g 91.4
1hyh_A 309 L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 91.28
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 91.26
3tri_A 280 Pyrroline-5-carboxylate reductase; amino acid bios 91.25
3i83_A 320 2-dehydropantoate 2-reductase; structural genomics 91.24
3k5p_A 416 D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, 91.19
1t2d_A 322 LDH-P, L-lactate dehydrogenase; ternary complex, o 91.08
3kkj_A 336 Amine oxidase, flavin-containing; oxidoreductase, 90.98
2dbq_A334 Glyoxylate reductase; D-3-phosphoglycerate dehydro 90.95
1leh_A364 Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi 90.93
1txg_A 335 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid 90.87
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 90.78
1x0v_A 354 GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase 90.77
2hk9_A275 Shikimate dehydrogenase; shikimate pathway, drug d 90.75
1y6j_A 318 L-lactate dehydrogenase; southeast collaboratory f 90.58
1ez4_A 318 Lactate dehydrogenase; rossmann fold, oxidoreducta 90.57
2zqz_A 326 L-LDH, L-lactate dehydrogenase; oxidoreductase, ro 90.52
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 90.45
2v6b_A 304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 90.35
2hjr_A 328 Malate dehydrogenase; malaria, structural genomics 90.35
2j6i_A364 Formate dehydrogenase; oxidoreductase, D-specific- 90.34
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 90.21
1o6z_A 303 MDH, malate dehydrogenase; halophilic, ION-binding 90.0
1obb_A 480 Maltase, alpha-glucosidase; glycosidase, sulfinic 90.0
4gsl_A 615 Ubiquitin-like modifier-activating enzyme ATG7; ub 89.99
2izz_A 322 Pyrroline-5-carboxylate reductase 1; amino-acid bi 89.87
2i6t_A 303 Ubiquitin-conjugating enzyme E2-like isoform A; L- 89.82
1gtm_A419 Glutamate dehydrogenase; oxidoreductase, NAD, NADP 89.77
3d1l_A 266 Putative NADP oxidoreductase BF3122; structural ge 89.7
1yj8_A 375 Glycerol-3-phosphate dehydrogenase; SGPP, structur 89.66
1b8p_A 329 Protein (malate dehydrogenase); oxidoreductase; 1. 89.58
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 89.53
2h78_A 302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 89.46
3ado_A 319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 89.27
1s6y_A 450 6-phospho-beta-glucosidase; hydrolase, structural 89.22
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 89.18
1sc6_A 404 PGDH, D-3-phosphoglycerate dehydrogenase; alloster 89.14
2p4q_A 497 6-phosphogluconate dehydrogenase, decarboxylating; 89.02
3fef_A 450 Putative glucosidase LPLD; gulosidase, structural 88.81
3ba1_A333 HPPR, hydroxyphenylpyruvate reductase; two domain 88.74
1up7_A 417 6-phospho-beta-glucosidase; hydrolase, family4 hyd 88.65
1zud_1251 Adenylyltransferase THIF; thiamin, thiazole, prote 88.64
1u8x_X 472 Maltose-6'-phosphate glucosidase; structural genom 88.58
3vh1_A 598 Ubiquitin-like modifier-activating enzyme ATG7; au 88.57
1ks9_A 291 KPA reductase;, 2-dehydropantoate 2-reductase; PAN 88.56
3vku_A 326 L-LDH, L-lactate dehydrogenase; rossmann fold, NAD 88.46
3qsg_A 312 NAD-binding phosphogluconate dehydrogenase-like P; 88.3
2pgd_A 482 6-phosphogluconate dehydrogenase; oxidoreductase ( 88.17
3h5n_A353 MCCB protein; ubiquitin-activating enzyme, microci 88.09
3pef_A 287 6-phosphogluconate dehydrogenase, NAD-binding; gam 87.99
1oju_A 294 MDH, malate dehydrogenase; hyperthermophilic, oxid 87.94
2ew2_A 316 2-dehydropantoate 2-reductase, putative; alpha-str 87.93
3k96_A 356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 87.89
4gwg_A 484 6-phosphogluconate dehydrogenase, decarboxylating; 87.86
4g2n_A345 D-isomer specific 2-hydroxyacid dehydrogenase, Na; 87.81
1ldn_A 316 L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA 87.74
1a5z_A 319 L-lactate dehydrogenase; oxidoreductase, glycolysi 87.69
4fgw_A 391 Glycerol-3-phosphate dehydrogenase [NAD(+)] 1; oxi 87.63
1bg6_A 359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 87.48
1x7d_A350 Ornithine cyclodeaminase; binds NAD+, binds L-orni 87.23
3gvx_A290 Glycerate dehydrogenase related protein; NYSGXRC, 87.19
3jtm_A351 Formate dehydrogenase, mitochondrial; mitochondrio 87.17
3ggo_A 314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 87.12
4dll_A 320 2-hydroxy-3-oxopropionate reductase; structural ge 87.1
1npy_A271 Hypothetical shikimate 5-dehydrogenase-like protei 87.07
1smk_A 326 Malate dehydrogenase, glyoxysomal; tricarboxylic c 86.99
2iz1_A 474 6-phosphogluconate dehydrogenase, decarboxylating; 86.91
1ur5_A 309 Malate dehydrogenase; oxidoreductase, tricarboxyli 86.79
2xxj_A 310 L-LDH, L-lactate dehydrogenase; oxidoreductase, hy 86.78
3gt0_A247 Pyrroline-5-carboxylate reductase; structural geno 86.76
4hy3_A365 Phosphoglycerate oxidoreductase; PSI-biology, stru 86.65
2qrj_A394 Saccharopine dehydrogenase, NAD+, L-lysine- formin 86.61
1y8q_A 346 Ubiquitin-like 1 activating enzyme E1A; SUMO, hete 86.5
3g0o_A 303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 86.41
3doj_A 310 AT3G25530, dehydrogenase-like protein; gamma-hydro 86.37
1pgj_A 478 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; o 86.33
2d0i_A333 Dehydrogenase; structural genomics, NPPSFA, nation 86.2
1nvt_A287 Shikimate 5'-dehydrogenase; structural genomics, P 86.09
3b1f_A 290 Putative prephenate dehydrogenase; enzyme, 4-hydro 86.08
2d4a_B 308 Malate dehydrogenase; archaea, hyperthermophIle, o 85.84
3hg7_A324 D-isomer specific 2-hydroxyacid dehydrogenase FAM 85.8
2cuk_A311 Glycerate dehydrogenase/glyoxylate reductase; stru 85.76
1guz_A 310 Malate dehydrogenase; oxidoreductase, tricarboxyli 85.57
3cky_A 301 2-hydroxymethyl glutarate dehydrogenase; rossmann 85.39
1xdw_A331 NAD+-dependent (R)-2-hydroxyglutarate dehydrogenas 85.29
3vrd_B 401 FCCB subunit, flavocytochrome C flavin subunit; su 85.23
3evt_A324 Phosphoglycerate dehydrogenase; structural genomic 85.1
3hn2_A 312 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str 85.02
3pdu_A 287 3-hydroxyisobutyrate dehydrogenase family protein; 84.98
2d5c_A263 AROE, shikimate 5-dehydrogenase; substrate, dimer, 84.9
2g76_A335 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor 84.72
3c24_A 286 Putative oxidoreductase; YP_511008.1, structural g 84.72
4huj_A220 Uncharacterized protein; PSI-biology, nysgrc, stru 84.63
4dgs_A340 Dehydrogenase; structural genomics, PSI-biology, N 84.55
3ghy_A 335 Ketopantoate reductase protein; oxidoreductase, NA 84.39
1mx3_A347 CTBP1, C-terminal binding protein 1; nuclear prote 84.24
2nac_A393 NAD-dependent formate dehydrogenase; oxidoreductas 84.15
3d0o_A 317 L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly 84.08
1qp8_A303 Formate dehydrogenase; oxidoreductase; HET: NDP; 2 83.97
1hyu_A 521 AHPF, alkyl hydroperoxide reductase subunit F; thi 83.87
2i99_A312 MU-crystallin homolog; thyroid hormine binding pro 83.73
1lld_A 319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 83.62
3fi9_A 343 Malate dehydrogenase; structural genomics, oxidore 83.6
2cvz_A 289 Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; 83.58
3l6d_A 306 Putative oxidoreductase; structural genomics, prot 83.48
3qha_A 296 Putative oxidoreductase; seattle structural genomi 83.27
1vpd_A 299 Tartronate semialdehyde reductase; structural geno 83.1
1j4a_A333 D-LDH, D-lactate dehydrogenase; NAD-dependent dehy 82.9
3tl2_A 315 Malate dehydrogenase; center for structural genomi 82.78
2yq5_A343 D-isomer specific 2-hydroxyacid dehydrogenase; oxi 82.78
1tt5_B 434 Ubiquitin-activating enzyme E1C isoform 1; cell cy 82.63
3gvi_A 324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 82.62
3pp8_A315 Glyoxylate/hydroxypyruvate reductase A; structural 82.47
2uyy_A 316 N-PAC protein; long-chain dehydrogenase, cytokine; 82.4
3nep_X 314 Malate dehydrogenase; halophIle, molecular adpatat 82.25
2g5c_A 281 Prephenate dehydrogenase; TYRA, oxidoreductase; HE 82.22
4hb9_A 412 Similarities with probable monooxygenase; flavin, 82.1
1dxy_A333 D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxyc 82.05
2f1k_A 279 Prephenate dehydrogenase; tyrosine synthesis, X-RA 81.62
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 81.57
2x0j_A 294 Malate dehydrogenase; oxidoreductase, hyperthermop 81.33
2w2k_A348 D-mandelate dehydrogenase; 2-hydroxyacid dehydroge 81.25
1yb4_A 295 Tartronic semialdehyde reductase; structural genom 81.17
2pi1_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 81.14
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 81.08
3pqe_A 326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 80.99
3p7m_A 321 Malate dehydrogenase; putative dehydrogenase, enzy 80.82
4b4u_A303 Bifunctional protein fold; oxidoreductase; HET: NA 80.55
3fbs_A 297 Oxidoreductase; structural genomics, PSI2, MCSG, p 80.54
4egb_A 346 DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce 80.47
3m6i_A363 L-arabinitol 4-dehydrogenase; medium chain dehydro 80.24
1hye_A 313 L-lactate/malate dehydrogenase; nucleotide binding 80.2
>1gq2_A Malic enzyme; oxidoreductase, pigeon liver, NADP-dependent, NAD-NADP selectivity, decarboxylase, malate, Mn2+; HET: NAP; 2.5A {Columba livia} SCOP: c.2.1.7 c.58.1.3 PDB: 2aw5_A Back     alignment and structure
Probab=100.00  E-value=3e-167  Score=1320.98  Aligned_cols=421  Identities=43%  Similarity=0.829  Sum_probs=413.8

Q ss_pred             CccccccCCCCCcCCCCChHhhhccCcCCCCCCccccHHHHHHHHHHHHhccccccCCCCCCCCchhHHHHHHHhhcccc
Q 011618           31 RGTDILHDPWFNKDTGFPLTERDRLGLRGLLPPRVISFEQQYARFMESFRSLEKNTEGQPNKVVSLAKWRILNRLHDRNE  110 (481)
Q Consensus        31 ~G~~~l~~p~~NKgtaFt~~ER~~lgl~GLLPp~v~tle~Q~~R~~~~~~~~~~~~~~~~~~~~~l~Ky~~L~~L~~rNe  110 (481)
                      +|.++|+||++|||||||.+||++|||+|||||+|+|+|+|++|+|+||++++          ++|+||+||++||++||
T Consensus         2 ~G~~lL~~p~~NKGtAFt~~ER~~l~l~GLLPp~v~t~e~Q~~r~~~~~~~~~----------~~l~k~~~L~~L~~~Ne   71 (555)
T 1gq2_A            2 KGYEVLRDPHLNKGMAFTLEERQQLNIHGLLPPCFLGQDAQVYSILKNFERLT----------SDLDRYILLMSLQDRNE   71 (555)
T ss_dssp             CTTHHHHCTTTCCGGGSCHHHHHHTTCTTSSCSCBCCHHHHHHHHHHHHHHCC----------CHHHHHHHHHHHHHHCH
T ss_pred             ChhhhccCCcccCCCCCCHHHHHHCCCccCCCCCcCCHHHHHHHHHHHHhcCC----------CcHHHHHHHHHhcCcce
Confidence            69999999999999999999999999999999999999999999999999999          89999999999999999


Q ss_pred             eeeeeeeccCcccccccccchhhHHHHHHHhhcccCCCccccccCChhhHHHHHhcCCCCCeeEEEEecCceeeccCCCC
Q 011618          111 TLYYRVLIDNIKDFAPIIYTPTVGLVCQNYSGLFRRPRGMYFSAKDKGEMMSMIYNWPAQQVDMIVLTDGSRILGLGDLG  190 (481)
Q Consensus       111 ~LFy~ll~~~~~e~lpiiYTPtVg~ac~~~s~~~rrprGlyis~~d~g~i~~~l~nwp~~~v~viVVTDG~rILGLGDlG  190 (481)
                      +||||++++|++|+|||+||||||++|++||++||+|+|||||++|+|+++++++|||.++|+|||||||||||||||||
T Consensus        72 ~Lfy~ll~~~~~e~lpivYTP~V~~ac~~~s~i~~~p~g~yis~~d~~~i~~~l~n~~~~~~~v~VVTDG~~ILGLGD~G  151 (555)
T 1gq2_A           72 KLFYKVLTSDIERFMPIVYTPTVGLACQHYGLAFRRPRGLFITIHDRGHIATMLQSWPESVIKAIVVTDGERILGLGDLG  151 (555)
T ss_dssp             HHHHHHHHHTHHHHHHHHSTTHHHHHHHTHHHHCSSCCSEEEEGGGTTCHHHHHHTSSCSCCCEEEEECSSSCGGGCCCG
T ss_pred             eeehhhHhhhHHHhcCcccCchHHHHHHHHHHHhcChhhhhcccCCHHHHHHHHhcCCCCCcEEEEEEccccccccCCCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CccccccchhhhhhhhhcCCCCCceecEEeeccCCccccccCcccccccccCCChhhhhHhHHHHHHHHHHhC-CceEEE
Q 011618          191 VQGIGIPIGKLDVYVAAAGINPQRILPVMLDVGTNNQKLLEDRLYLGLRQPRLEGEEYLSIVDEFMEAVHARW-PKAIVQ  269 (481)
Q Consensus       191 ~~Gm~I~iGKl~LY~a~gGI~P~~~LPV~LDvGTnN~~LL~Dp~YlG~r~~R~~g~~Y~~~vdefv~av~~~~-P~~~Iq  269 (481)
                      ++||+|||||++|||+||||||++|||||||+|||||+||+||+||||||+|++|++||+|+||||++|+.+| |+++||
T Consensus       152 ~~g~~ipvGKl~Ly~~~aGIdP~~~lPI~LD~GTnn~~LL~DplYlG~r~~Rv~g~eyd~fvdefv~av~~~fGp~~~I~  231 (555)
T 1gq2_A          152 CYGMGIPVGKLALYTACGGVKPHQCLPVMLDVGTDNETLLKDPLYIGLRHKRIRGQAYDDLLDEFMEAVTSRYGMNCLIQ  231 (555)
T ss_dssp             GGGGHHHHHHHHHHHHTTCCCGGGEEEEEEESCCCCHHHHHCTTCCSCSSCCCCTHHHHHHHHHHHHHHHHHHCTTCEEE
T ss_pred             CCccccchhHHHHhHhccCCChhheeeeEeecCCCchhhcCCCccCCcCCCCCchHHHHHHHHHHHHHHHHhhCCCcEEe
Confidence            9999999999999999999999999999999999999999999999999999999999999999999999999 899999


Q ss_pred             eecCCCchHHHHHHHHhhcCCccccCcchhHHHHHHHHHHHHHHhCCCCCCCCCceEEEeCccHHHHHHHHHHHHHHHHH
Q 011618          270 FEDFQMKWAFETLERYRKRFCMFNDDIQGTAGVALAGLLGTVRAQGLSLTDFADQKIVVVGAGSAGLGVLKMAVQAAARM  349 (481)
Q Consensus       270 fEDf~~~naf~iL~ryr~~~~~FNDDiQGTaaV~LAgll~Alr~~g~~l~dl~~~riv~~GAGsAg~GiA~ll~~~~~~~  349 (481)
                      ||||+++|||+||+|||++||||||||||||+|+||||+||+|++|++|+|   |||||+|||+||+|||+||+++|+ +
T Consensus       232 ~EDf~~~~af~il~ryr~~ipvFnDDiqGTa~V~lAgllnAlki~gk~l~d---~riv~~GAGaAg~gia~ll~~~~~-~  307 (555)
T 1gq2_A          232 FEDFANANAFRLLHKYRNKYCTFNDDIQGTASVAVAGLLAALRITKNRLSD---HTVLFQGAGEAALGIANLIVMAMQ-K  307 (555)
T ss_dssp             ECSCCHHHHHHHHHHHTTTSEEEETTTHHHHHHHHHHHHHHHHHHTSCGGG---CCEEEECCSHHHHHHHHHHHHHHH-H
T ss_pred             ecccCCccHHHHHHHHhccCCEecCccchHHHHHHHHHHHHHHHhCCChhh---cEEEEECCCHHHHHHHHHHHHHHH-H
Confidence            999999999999999999999999999999999999999999999999999   999999999999999999999999 6


Q ss_pred             cCCChhhhcCeEEEEeccceeecCCCCCChhhhccccccCCcCCcCCCCCHHHHhcccCCcEEEeecCCCCCCCHHHHHH
Q 011618          350 AGNNDAFARNKFFLLDKDGLITKERKNLDPAAAPFAKDPGDFMGLREGASLLEVVRKVKPHVLLGLSGVGGVFNEEVLKA  429 (481)
Q Consensus       350 ~Gls~eeA~~~i~lvD~~GLi~~~r~~l~~~k~~fA~~~~~~~~~~~~~~L~e~V~~vkptvLIG~S~~~g~Ft~evv~~  429 (481)
                      +|+|+|||++||||||++|||+++|++|+++|++||+++++      .++|+|||+++|||||||+|++||+||+|||++
T Consensus       308 ~G~~~eeA~~~i~~~D~~Gli~~~r~~l~~~k~~~A~~~~~------~~~L~eav~~vkp~vlIG~S~~~g~ft~evv~~  381 (555)
T 1gq2_A          308 EGVSKEEAIKRIWMVDSKGLIVKGRASLTPEKEHFAHEHCE------MKNLEDIVKDIKPTVLIGVAAIGGAFTQQILQD  381 (555)
T ss_dssp             HTCCHHHHHTTEEEEETTEECBTTCSSCCTTGGGGCBSCCC------CCCHHHHHHHHCCSEEEECSCCTTCSCHHHHHH
T ss_pred             cCCChHHHhCcEEEEECCCeeeCCCCCchHHHHHHHhhcCC------CCCHHHHHhhcCCCEEEEecCCCCCCCHHHHHH
Confidence            79999999999999999999999998899999999998742      358999999999999999999999999999999


Q ss_pred             hhhcCCCCCEEEecCCCCCCCCCCCCHHHHHhcccCCccccccCce
Q 011618          430 MRESDSVKPAIFAMSNPTMNGLFSCCVTTFFFYLMAARSSFLTSSF  475 (481)
Q Consensus       430 Ma~~~~erPIIFaLSNPt~~aE~~~t~eda~~wt~g~r~~f~~~~~  475 (481)
                      |++ +|+|||||||||||+++|  |+||||++||+| |++|+|||+
T Consensus       382 Ma~-~~~~PIIFaLSNPt~~aE--~~pe~a~~~t~G-~aivATGsp  423 (555)
T 1gq2_A          382 MAA-FNKRPIIFALSNPTSKAE--CTAEQLYKYTEG-RGIFASGSP  423 (555)
T ss_dssp             HHH-HCSSCEEEECCSSGGGCS--SCHHHHHHHTTT-CCEEEESSC
T ss_pred             HHh-cCCCCEEEECCCCCCccC--cCHHHHHHhccC-CEEEEeCCC
Confidence            985 999999999999999999  999999999996 999999997
>1pj3_A NAD-dependent malic enzyme, mitochondrial; oxidative decarboxylase, oxidoreductase; HET: NAD; 2.10A {Homo sapiens} SCOP: c.2.1.7 c.58.1.3 PDB: 1pj2_A* 1do8_A* 1pj4_A* 1qr6_A* 1efl_A* 1pjl_A* 1efk_A* 1gz4_A* 1gz3_A* Back     alignment and structure
>1o0s_A NAD-ME, NAD-dependent malic enzyme; oxidoreductase, oxidative decarboxylase, rossmann fold, MAla dehydrogenase; HET: NAI; 2.00A {Ascaris suum} SCOP: c.2.1.7 c.58.1.3 PDB: 1llq_A* Back     alignment and structure
>3nv9_A Malic enzyme; rossmann fold, oxidoreductase; 2.25A {Entamoeba histolytica} Back     alignment and structure
>2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} Back     alignment and structure
>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Back     alignment and structure
>2dvm_A Malic enzyme, 439AA long hypothetical malate oxidoreductase; NAD, structural genomics, NPPSFA; HET: NAD MES; 1.60A {Pyrococcus horikoshii} PDB: 1ww8_A* Back     alignment and structure
>3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* Back     alignment and structure
>3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure
>3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>1a4i_A Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase...; THF, bifunctional, oxidoreductase; HET: NDP; 1.50A {Homo sapiens} SCOP: c.2.1.7 c.58.1.2 PDB: 1dia_A* 1dib_A* 1dig_A* Back     alignment and structure
>3k92_A NAD-GDH, NAD-specific glutamate dehydrogenase; ROCG, oxidoreductase; 2.30A {Bacillus subtilis} PDB: 3k8z_A Back     alignment and structure
>4fcc_A Glutamate dehydrogenase; protein complex, rossmann fold, metabolic role, NAD, NADP, oxidoreductase; 2.00A {Escherichia coli O157} PDB: 4fhn_X 2yfg_A 3sbo_A 2yfg_E Back     alignment and structure
>3l07_A Bifunctional protein fold; structural genomics, IDP01849, methylenetetrahydrofolate dehydrogenase; 1.88A {Francisella tularensis} Back     alignment and structure
>3p2o_A Bifunctional protein fold; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta-alpha sandwich; HET: NAD; 2.23A {Campylobacter jejuni subsp} Back     alignment and structure
>3r3j_A Glutamate dehydrogenase; rossman fold, oxidoreductase, apicoplast; 3.10A {Plasmodium falciparum} Back     alignment and structure
>4a5o_A Bifunctional protein fold; oxidoreductase, hydrolase; 2.20A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>3aoe_E Glutamate dehydrogenase; rossmann fold, NADH, oxidoreductase; 2.60A {Thermus thermophilus} Back     alignment and structure
>3ngx_A Bifunctional protein fold; methylenetetrahydrofolate dehydrogenase/cyclohydrolase; 2.30A {Thermoplasma acidophilum} PDB: 3ngl_A Back     alignment and structure
>3aog_A Glutamate dehydrogenase; NAD(H), oxidoreducta; HET: GLU; 2.10A {Thermus thermophilus HB27} PDB: 3aoe_A Back     alignment and structure
>1b0a_A Protein (fold bifunctional protein); folate, dehydrogenase, cyclcohydrolase, channeling, oxidoreductase,hydrolase; 2.56A {Escherichia coli K12} SCOP: c.2.1.7 c.58.1.2 Back     alignment and structure
>1v8b_A Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2.40A {Plasmodium falciparum} SCOP: c.2.1.4 c.23.12.3 Back     alignment and structure
>4a26_A Putative C-1-tetrahydrofolate synthase, cytoplasm; oxidoreductase, hydrolase, leishmaniasis; 2.70A {Leishmania major} Back     alignment and structure
>1edz_A 5,10-methylenetetrahydrofolate dehydrogenase; nucleotide-binding domain, monofunctional, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: c.2.1.7 c.58.1.2 PDB: 1ee9_A* Back     alignment and structure
>2yfq_A Padgh, NAD-GDH, NAD-specific glutamate dehydrogenase; oxidoreductase; 2.94A {Peptoniphilus asaccharolyticus} Back     alignment and structure
>1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>2bma_A Glutamate dehydrogenase (NADP+); malaria, drug design, analysis, oligomer organization, oxidoreductase; 2.7A {Plasmodium falciparum} Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>2c2x_A Methylenetetrahydrofolate dehydrogenase- methenyltetrahydrofolate cyclohydrolase; NADP; 2.0A {Mycobacterium tuberculosis} PDB: 2c2y_A Back     alignment and structure
>3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A* Back     alignment and structure
>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>1c1d_A L-phenylalanine dehydrogenase; amino acid dehydrogenase, oxidative deamination mechanism, oxidoreductase; HET: PHE NAD; 1.25A {Rhodococcus SP} SCOP: c.2.1.7 c.58.1.1 PDB: 1bw9_A* 1c1x_A* 1bw9_B* 1c1d_B* 1c1x_B* 1bxg_B* 1bxg_A* Back     alignment and structure
>2tmg_A Protein (glutamate dehydrogenase); metabolic role, mutant, oxidoreductase; 2.90A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.1 PDB: 1b26_A 1b3b_A Back     alignment and structure
>3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>3u95_A Glycoside hydrolase, family 4; hydrolysis, cytosol; 2.00A {Thermotoga neapolitana} PDB: 1vjt_A* Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* Back     alignment and structure
>2o4c_A Erythronate-4-phosphate dehydrogenase; erythronate-4-phsphate, NAD, tartrate, phosph oxidoreductase; HET: NAD TLA; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} Back     alignment and structure
>2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3mw9_A GDH 1, glutamate dehydrogenase 1; allostery, inhibition, oxidoreducta; HET: GLU GTP NAD; 2.40A {Bos taurus} SCOP: c.2.1.7 c.58.1.1 PDB: 3mvo_A* 3mvq_A* 3qmu_A* 3etd_A* 3ete_A* 3etg_A* 1l1f_A 1nr1_A 1nr7_A 1nqt_A 1hwx_A* 1hwy_A* 1hwz_A* Back     alignment and structure
>1bgv_A Glutamate dehydrogenase; oxidoreductase; HET: GLU; 1.90A {Clostridium symbiosum} SCOP: c.2.1.7 c.58.1.1 PDB: 1hrd_A 1k89_A 1aup_A 2yfh_A Back     alignment and structure
>3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>1v9l_A Glutamate dehydrogenase; protein-NAD complex, oxidoreductase; HET: NAD; 2.80A {Pyrobaculum islandicum} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>1mld_A Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D)); HET: CIT; 1.83A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 2dfd_A* Back     alignment and structure
>2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Back     alignment and structure
>3oet_A Erythronate-4-phosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.36A {Salmonella enterica subsp} Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Back     alignment and structure
>1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Back     alignment and structure
>1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>1x0v_A GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic; two independent domains, GXGXXG motif, oxidoreductase; 2.30A {Homo sapiens} PDB: 1x0x_A* 1wpq_A* 2pla_A* Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure
>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>1ez4_A Lactate dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.30A {Lactobacillus pentosus} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>2zqz_A L-LDH, L-lactate dehydrogenase; oxidoreductase, rossmann fold, cytoplasm, glycolysis, NAD, phosphoprotein; 2.50A {Lactobacillus casei} PDB: 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>1o6z_A MDH, malate dehydrogenase; halophilic, ION-binding, protein-solvent interaction, oxidoreductase; HET: NAD; 1.95A {Haloarcula marismortui} SCOP: c.2.1.5 d.162.1.1 PDB: 1gt2_A* 2x0r_A* 2j5k_A 2j5q_A 2j5r_A 1d3a_A 1hlp_A* 2hlp_A Back     alignment and structure
>1obb_A Maltase, alpha-glucosidase; glycosidase, sulfinic acid, NAD+, maltose, hydrolase; HET: MAL NAD; 1.90A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>4gsl_A Ubiquitin-like modifier-activating enzyme ATG7; ubiquitin-like protein activation enzyme, ubiquitin-like Pro transfer enzyme, protein transport; 2.70A {Saccharomyces cerevisiae} PDB: 3vh2_A 4gsk_A 3vh1_A Back     alignment and structure
>2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* Back     alignment and structure
>2i6t_A Ubiquitin-conjugating enzyme E2-like isoform A; L-lactate dehydrogenase, oxidoreductase, ubiquitin-protein L unknown function; 2.10A {Homo sapiens} PDB: 3dl2_A Back     alignment and structure
>1gtm_A Glutamate dehydrogenase; oxidoreductase, NAD, NADP; 2.20A {Pyrococcus furiosus} SCOP: c.2.1.7 c.58.1.1 PDB: 1bvu_A 1euz_A Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Back     alignment and structure
>1yj8_A Glycerol-3-phosphate dehydrogenase; SGPP, structural genomics, PSI; 2.85A {Plasmodium falciparum} Back     alignment and structure
>1b8p_A Protein (malate dehydrogenase); oxidoreductase; 1.90A {Aquaspirillum arcticum} SCOP: c.2.1.5 d.162.1.1 PDB: 1b8u_A* 1b8v_A* 3d5t_A Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>1s6y_A 6-phospho-beta-glucosidase; hydrolase, structural genomics, PSI, protein structure initi midwest center for structural genomics; 2.31A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* Back     alignment and structure
>2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} Back     alignment and structure
>3fef_A Putative glucosidase LPLD; gulosidase, structural genomics, unknown function, glycosidase, hydrolase, manganese, metal-binding, NAD, PSI- 2; 2.20A {Bacillus subtilis} Back     alignment and structure
>3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* Back     alignment and structure
>1up7_A 6-phospho-beta-glucosidase; hydrolase, family4 hydrolase, Na dependent; HET: G6P NAD; 2.4A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.2 PDB: 1up6_A* 1up4_A Back     alignment and structure
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Back     alignment and structure
>1u8x_X Maltose-6'-phosphate glucosidase; structural genomics, PSI, protein structure initiative, MCSG glucosidase, NAD-dependent; HET: G6P NAD; 2.05A {Bacillus subtilis} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>3vh1_A Ubiquitin-like modifier-activating enzyme ATG7; autophagy, zinc binding, metal binding protein; 3.00A {Saccharomyces cerevisiae} PDB: 3vh2_A Back     alignment and structure
>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* Back     alignment and structure
>3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* Back     alignment and structure
>3h5n_A MCCB protein; ubiquitin-activating enzyme, microcin, protein structure, MCCC7, peptide antibiotics, N-P bond formation, transferase; HET: ATP; 1.90A {Escherichia coli} PDB: 3h5r_A 3h9g_A 3h9j_A* 3h9q_A 3h5a_A Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A* Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A Back     alignment and structure
>4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP} Back     alignment and structure
>1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* Back     alignment and structure
>1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>4fgw_A Glycerol-3-phosphate dehydrogenase [NAD(+)] 1; oxidoreductase; 2.45A {Saccharomyces cerevisiae} Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>1x7d_A Ornithine cyclodeaminase; binds NAD+, binds L-ornithine, binds L-proline, 2 bundle, beta barrel, rossmann fold, lyase; HET: NAD ORN MES; 1.60A {Pseudomonas putida} SCOP: c.2.1.13 PDB: 1u7h_A* Back     alignment and structure
>3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} Back     alignment and structure
>3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>1npy_A Hypothetical shikimate 5-dehydrogenase-like protein HI0607; structural genomics, PSI, protein structure initiative; 1.75A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>1smk_A Malate dehydrogenase, glyoxysomal; tricarboxylic cycle, glyoxysome, NAD, glyoxylate bypass, oxidoreductase; HET: CIT; 2.50A {Citrullus lanatus} PDB: 1sev_A Back     alignment and structure
>2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* Back     alignment and structure
>1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* Back     alignment and structure
>2xxj_A L-LDH, L-lactate dehydrogenase; oxidoreductase, hyperthermophIle; HET: NAD; 1.964A {Thermus thermophilus} PDB: 2xxb_A* 3zzn_A* 2v7p_A* 2e37_A* 2v6m_A* 2xxe_A 4a73_A Back     alignment and structure
>3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} Back     alignment and structure
>4hy3_A Phosphoglycerate oxidoreductase; PSI-biology, structural genomics, protein structure initiati acid transport and metabolism, NAD binding domain.; 2.80A {Rhizobium etli} Back     alignment and structure
>2qrj_A Saccharopine dehydrogenase, NAD+, L-lysine- forming; sulfate, rossmann fold, alpha-aminoadipate pathway, fungal lysine biosynthesis; 1.60A {Saccharomyces cerevisiae} PDB: 2qrk_A* 2qrl_A* 2q99_A 3ugk_A 3uh1_A* 3uha_A* Back     alignment and structure
>1y8q_A Ubiquitin-like 1 activating enzyme E1A; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_A* 3kyc_A* 3kyd_A* Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>1pgj_A 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; oxidoreductase, CHOH(D)-NADP+(B); 2.82A {Trypanosoma brucei} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} Back     alignment and structure
>1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A Back     alignment and structure
>2d4a_B Malate dehydrogenase; archaea, hyperthermophIle, oxidoreductase; 2.87A {Aeropyrum pernix} Back     alignment and structure
>3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} Back     alignment and structure
>2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structur genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus} Back     alignment and structure
>1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Back     alignment and structure
>1xdw_A NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans} Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} Back     alignment and structure
>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* Back     alignment and structure
>2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} Back     alignment and structure
>1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepresso transcription repressor; HET: NAD; 1.95A {Homo sapiens} SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A* 3ga0_A 2ome_A* Back     alignment and structure
>2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* 3fn4_A Back     alignment and structure
>3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* Back     alignment and structure
>1qp8_A Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A {Pyrobaculum aerophilum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>2i99_A MU-crystallin homolog; thyroid hormine binding protein, oxidoreductase; HET: NDP; 2.60A {Homo sapiens} Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} Back     alignment and structure
>2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>1j4a_A D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp} SCOP: c.2.1.4 c.23.12.1 PDB: 1j49_A* 2dld_A* Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>2yq5_A D-isomer specific 2-hydroxyacid dehydrogenase; oxidoreductase; HET: NAD; 2.75A {Lactobacillus delbrueckii subsp} PDB: 2yq4_A* Back     alignment and structure
>1tt5_B Ubiquitin-activating enzyme E1C isoform 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbl_B 3dbr_B 3dbh_B 3gzn_B* 1yov_B 1r4m_B 1r4n_B* Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>3nep_X Malate dehydrogenase; halophIle, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle; 1.55A {Salinibacter ruber} Back     alignment and structure
>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>1dxy_A D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarboxylate dehydrogenase, D-lactate dehydrogenas oxidoreductase; HET: NAD; 1.86A {Lactobacillus casei} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>2x0j_A Malate dehydrogenase; oxidoreductase, hyperthermophilic, tricarboxylic acid cycle; HET: ENA; 2.79A {Archaeoglobus fulgidus dsm 4304} PDB: 2x0i_A* Back     alignment and structure
>2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B Back     alignment and structure
>1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Back     alignment and structure
>4b4u_A Bifunctional protein fold; oxidoreductase; HET: NAP; 1.45A {Acinetobacter baumannii atcc 19606} PDB: 4b4v_A* 4b4w_A* Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} Back     alignment and structure
>3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} Back     alignment and structure
>1hye_A L-lactate/malate dehydrogenase; nucleotide binding domain, oxidoreductase; HET: NAP; 1.90A {Methanocaldococcus jannaschii} SCOP: c.2.1.5 d.162.1.1 PDB: 1hyg_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 481
d1gq2a2257 c.58.1.3 (A:23-279) Mitochondrial NAD(P)-dependent 1e-130
d1pj3a2259 c.58.1.3 (A:21-279) Mitochondrial NAD(P)-dependent 1e-130
d1o0sa2294 c.58.1.3 (A:2-295) Mitochondrial NAD(P)-dependent 1e-130
d1o0sa1 308 c.2.1.7 (A:296-603) Mitochondrial NAD(P)-dependent 8e-31
d1pj3a1 294 c.2.1.7 (A:280-573) Mitochondrial NAD(P)-dependent 1e-28
d1gq2a1 298 c.2.1.7 (A:280-580) Mitochondrial NAD(P)-dependent 6e-28
d1vl6a1222 c.2.1.7 (A:155-376) Malate oxidoreductase (malic e 2e-19
d1vl6a2154 c.58.1.3 (A:1-154) Malate oxidoreductase (malic en 2e-06
>d1gq2a2 c.58.1.3 (A:23-279) Mitochondrial NAD(P)-dependent malic enzyme {Domestic pigeon (Columba livia) [TaxId: 8932]} Length = 257 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Aminoacid dehydrogenase-like, N-terminal domain
superfamily: Aminoacid dehydrogenase-like, N-terminal domain
family: Malic enzyme N-domain
domain: Mitochondrial NAD(P)-dependent malic enzyme
species: Domestic pigeon (Columba livia) [TaxId: 8932]

 Score =  376 bits (967), Expect = e-130
 Identities = 125/267 (46%), Positives = 175/267 (65%), Gaps = 11/267 (4%)

Query: 30  KRGTDILHDPWFNKDTGFPLTERDRLGLRGLLPPRVISFEQQYARFMESFRSLEKNTEGQ 89
           K+G ++L DP  NK   F L ER +L + GLLPP  +  + Q    +++F  L  +    
Sbjct: 1   KKGYEVLRDPHLNKGMAFTLEERQQLNIHGLLPPCFLGQDAQVYSILKNFERLTSD---- 56

Query: 90  PNKVVSLAKWRILNRLHDRNETLYYRVLIDNIKDFAPIIYTPTVGLVCQNYSGLFRRPRG 149
                 L ++ +L  L DRNE L+Y+VL  +I+ F PI+YTPTVGL CQ+Y   FRRPRG
Sbjct: 57  ------LDRYILLMSLQDRNEKLFYKVLTSDIERFMPIVYTPTVGLACQHYGLAFRRPRG 110

Query: 150 MYFSAKDKGEMMSMIYNWPAQQVDMIVLTDGSRILGLGDLGVQGIGIPIGKLDVYVAAAG 209
           ++ +  D+G + +M+ +WP   +  IV+TDG RILGLGDLG  G+GIP+GKL +Y A  G
Sbjct: 111 LFITIHDRGHIATMLQSWPESVIKAIVVTDGERILGLGDLGCYGMGIPVGKLALYTACGG 170

Query: 210 INPQRILPVMLDVGTNNQKLLEDRLYLGLRQPRLEGEEYLSIVDEFMEAVHARWP-KAIV 268
           + P + LPVMLDVGT+N+ LL+D LY+GLR  R+ G+ Y  ++DEFMEAV +R+    ++
Sbjct: 171 VKPHQCLPVMLDVGTDNETLLKDPLYIGLRHKRIRGQAYDDLLDEFMEAVTSRYGMNCLI 230

Query: 269 QFEDFQMKWAFETLERYRKRFCMFNDD 295
           QFEDF    AF  L +YR ++C FNDD
Sbjct: 231 QFEDFANANAFRLLHKYRNKYCTFNDD 257
>d1pj3a2 c.58.1.3 (A:21-279) Mitochondrial NAD(P)-dependent malic enzyme {Human (Homo sapiens) [TaxId: 9606]} Length = 259 Back     information, alignment and structure
>d1o0sa2 c.58.1.3 (A:2-295) Mitochondrial NAD(P)-dependent malic enzyme {Pig roundworm (Ascaris suum) [TaxId: 6253]} Length = 294 Back     information, alignment and structure
>d1o0sa1 c.2.1.7 (A:296-603) Mitochondrial NAD(P)-dependent malic enzyme {Pig roundworm (Ascaris suum) [TaxId: 6253]} Length = 308 Back     information, alignment and structure
>d1pj3a1 c.2.1.7 (A:280-573) Mitochondrial NAD(P)-dependent malic enzyme {Human (Homo sapiens) [TaxId: 9606]} Length = 294 Back     information, alignment and structure
>d1gq2a1 c.2.1.7 (A:280-580) Mitochondrial NAD(P)-dependent malic enzyme {Domestic pigeon (Columba livia) [TaxId: 8932]} Length = 298 Back     information, alignment and structure
>d1vl6a1 c.2.1.7 (A:155-376) Malate oxidoreductase (malic enzyme) {Thermotoga maritima [TaxId: 2336]} Length = 222 Back     information, alignment and structure
>d1vl6a2 c.58.1.3 (A:1-154) Malate oxidoreductase (malic enzyme) {Thermotoga maritima [TaxId: 2336]} Length = 154 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query481
d1gq2a2257 Mitochondrial NAD(P)-dependent malic enzyme {Domes 100.0
d1pj3a2259 Mitochondrial NAD(P)-dependent malic enzyme {Human 100.0
d1o0sa2294 Mitochondrial NAD(P)-dependent malic enzyme {Pig r 100.0
d1pj3a1 294 Mitochondrial NAD(P)-dependent malic enzyme {Human 100.0
d1gq2a1 298 Mitochondrial NAD(P)-dependent malic enzyme {Domes 100.0
d1o0sa1 308 Mitochondrial NAD(P)-dependent malic enzyme {Pig r 100.0
d1vl6a1222 Malate oxidoreductase (malic enzyme) {Thermotoga m 100.0
d1vl6a2154 Malate oxidoreductase (malic enzyme) {Thermotoga m 100.0
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 98.1
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 96.52
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 96.31
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 96.14
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 95.88
d1c1da1201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 95.88
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 95.84
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 95.79
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 95.69
d1b26a1234 Glutamate dehydrogenase {Thermotoga maritima [TaxI 95.65
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 95.59
d1v9la1242 Glutamate dehydrogenase {Pyrobaculum islandicum [T 95.36
d1sc6a1188 Phosphoglycerate dehydrogenase {Escherichia coli [ 95.19
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 94.94
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 94.69
d1bgva1255 Glutamate dehydrogenase {Clostridium symbiosum [Ta 94.53
d1obba1171 Alpha-glucosidase AglA {Thermotoga maritima [TaxId 94.47
d1s6ya1169 6-phospho-beta-glucosidase {Bacillus stearothermop 94.46
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 94.39
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 94.27
d1vjta1193 Putative alpha-glucosidase TM0752 {Thermotoga mari 94.15
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 94.09
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 93.95
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 93.85
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 93.73
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 93.72
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 93.52
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 93.5
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 93.35
d1u8xx1167 Maltose-6'-phosphate glucosidase GlvA {Bacillus su 93.34
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 93.23
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 93.13
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 92.99
d1b5qa1 347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 92.91
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 92.74
d1gtma1239 Glutamate dehydrogenase {Archaeon Pyrococcus furio 92.72
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 92.68
d1c0pa1 268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 92.59
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 92.54
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 92.45
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 92.36
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 92.02
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 91.86
d1leha1230 Leucine dehydrogenase {Bacillus sphaericus [TaxId: 91.67
d1seza1 373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 91.54
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 91.53
d1up7a1162 6-phospho-beta-glucosidase {Thermotoga maritima [T 91.3
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 91.24
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 91.13
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 91.13
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 90.99
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 90.97
d2iida1 370 L-aminoacid oxidase {Malayan pit viper (Calloselas 90.82
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 90.76
d2voua1 265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 90.75
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 90.48
d2dw4a2 449 Lysine-specific histone demethylase 1, LSD1 {Human 90.39
d1gdha1191 D-glycerate dehydrogenase {Hyphomicrobium methylov 89.64
d1hwxa1 293 Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 89.51
d1ygya1184 Phosphoglycerate dehydrogenase {Mycobacterium tube 89.24
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 88.9
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 88.47
d2bi7a1 314 UDP-galactopyranose mutase, N-terminal domain {Kle 88.13
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 88.03
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 87.43
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 87.25
d1b0aa1166 Methylenetetrahydrofolate dehydrogenase/cyclohydro 87.14
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 87.09
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 87.07
d1d5ta1 336 Guanine nucleotide dissociation inhibitor, GDI {Co 87.04
d2ivda1 347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 87.0
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 86.76
d1a4ia1170 Methylenetetrahydrofolate dehydrogenase/cyclohydro 86.46
d1w4xa1 298 Phenylacetone monooxygenase {Thermobifida fusca [T 86.44
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 86.34
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 86.28
d2bcgg1 297 Guanine nucleotide dissociation inhibitor, GDI {Ba 86.15
d1pj5a2 305 N,N-dimethylglycine oxidase {Arthrobacter globifor 85.94
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 85.91
d3c96a1 288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 85.49
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 85.33
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 85.1
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 84.83
d1pn0a1 360 Phenol hydroxylase {Soil-living yeast (Trichosporo 84.78
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 84.71
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 84.62
d1k0ia1 292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 84.55
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 84.48
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 84.44
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 84.2
d1diha1162 Dihydrodipicolinate reductase {Escherichia coli [T 84.2
d2gv8a1 335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 83.79
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 83.73
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 83.3
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 83.21
d1i8ta1 298 UDP-galactopyranose mutase, N-terminal domain {Esc 82.48
d2v5za1 383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 81.99
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 81.49
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 81.31
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 80.93
d1ryia1 276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 80.72
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 80.57
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 80.5
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 80.47
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 80.01
>d1gq2a2 c.58.1.3 (A:23-279) Mitochondrial NAD(P)-dependent malic enzyme {Domestic pigeon (Columba livia) [TaxId: 8932]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Aminoacid dehydrogenase-like, N-terminal domain
superfamily: Aminoacid dehydrogenase-like, N-terminal domain
family: Malic enzyme N-domain
domain: Mitochondrial NAD(P)-dependent malic enzyme
species: Domestic pigeon (Columba livia) [TaxId: 8932]

Probab=100.00  E-value=5.7e-117  Score=859.80  Aligned_cols=256  Identities=49%  Similarity=0.967  Sum_probs=254.1

Q ss_pred             cCccccccCCCCCcCCCCChHhhhccCcCCCCCCccccHHHHHHHHHHHHhccccccCCCCCCCCchhHHHHHHHhhccc
Q 011618           30 KRGTDILHDPWFNKDTGFPLTERDRLGLRGLLPPRVISFEQQYARFMESFRSLEKNTEGQPNKVVSLAKWRILNRLHDRN  109 (481)
Q Consensus        30 ~~G~~~l~~p~~NKgtaFt~~ER~~lgl~GLLPp~v~tle~Q~~R~~~~~~~~~~~~~~~~~~~~~l~Ky~~L~~L~~rN  109 (481)
                      ++|.++|++|.+|||||||.+||++|||+|||||+|+|+|+|++|||.|+++++          ++|+||+||++||++|
T Consensus         1 krG~~lL~~p~~NKGtAFt~~ER~~l~l~GLLP~~v~tle~Qv~r~~~~~~~~~----------~~l~Ky~yL~~L~~~N   70 (257)
T d1gq2a2           1 KKGYEVLRDPHLNKGMAFTLEERQQLNIHGLLPPCFLGQDAQVYSILKNFERLT----------SDLDRYILLMSLQDRN   70 (257)
T ss_dssp             CCTTHHHHCTTTCCGGGSCHHHHHHTTCTTSSCSCBCCHHHHHHHHHHHHHHCC----------CHHHHHHHHHHHHHHC
T ss_pred             CChHHHhcCCCccCccCCCHHHHHHcCCccCCCCCccCHHHHHHHHHHHHHhcC----------CcHHHHHHHHHHHHhC
Confidence            489999999999999999999999999999999999999999999999999999          8999999999999999


Q ss_pred             ceeeeeeeccCcccccccccchhhHHHHHHHhhcccCCCccccccCChhhHHHHHhcCCCCCeeEEEEecCceeeccCCC
Q 011618          110 ETLYYRVLIDNIKDFAPIIYTPTVGLVCQNYSGLFRRPRGMYFSAKDKGEMMSMIYNWPAQQVDMIVLTDGSRILGLGDL  189 (481)
Q Consensus       110 e~LFy~ll~~~~~e~lpiiYTPtVg~ac~~~s~~~rrprGlyis~~d~g~i~~~l~nwp~~~v~viVVTDG~rILGLGDl  189 (481)
                      |+|||+++++|++||||||||||||+||++||++||+|||||||++|+|+|+++++|||.++|++||||||+||||||||
T Consensus        71 e~LFY~ll~~~~~e~~PivYTPTVG~Ac~~ys~~yr~prGlyis~~d~g~i~~il~nwp~~~V~~iVVTDG~rILGlGD~  150 (257)
T d1gq2a2          71 EKLFYKVLTSDIERFMPIVYTPTVGLACQHYGLAFRRPRGLFITIHDRGHIATMLQSWPESVIKAIVVTDGERILGLGDL  150 (257)
T ss_dssp             HHHHHHHHHHTHHHHHHHHSTTHHHHHHHTHHHHCSSCCSEEEEGGGTTCHHHHHHTSSCSCCCEEEEECSSSCGGGCCC
T ss_pred             hHHHHHHHHHHHHHhcCcccCccHHHHHHHHhhhhccccceeeccCChHHHHHHHHhCCCCCeeEEEEecCceeeecCCc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCccccccchhhhhhhhhcCCCCCceecEEeeccCCccccccCcccccccccCCChhhhhHhHHHHHHHHHHhCC-ceEE
Q 011618          190 GVQGIGIPIGKLDVYVAAAGINPQRILPVMLDVGTNNQKLLEDRLYLGLRQPRLEGEEYLSIVDEFMEAVHARWP-KAIV  268 (481)
Q Consensus       190 G~~Gm~I~iGKl~LY~a~gGI~P~~~LPV~LDvGTnN~~LL~Dp~YlG~r~~R~~g~~Y~~~vdefv~av~~~~P-~~~I  268 (481)
                      |+||||||+||++|||+||||||++|||||||||||||+||+||+|+|+||+|++|+||++||||||+||+++|| +++|
T Consensus       151 G~~Gm~I~~gKl~lyta~~Gi~P~~~LPv~LDvGTnNe~LL~DP~YlG~R~~R~~g~eY~~fvdefv~av~~~~p~~~~i  230 (257)
T d1gq2a2         151 GCYGMGIPVGKLALYTACGGVKPHQCLPVMLDVGTDNETLLKDPLYIGLRHKRIRGQAYDDLLDEFMEAVTSRYGMNCLI  230 (257)
T ss_dssp             GGGGGHHHHHHHHHHHHTTCCCGGGEEEEEEESCCCCHHHHHCTTCCSCSSCCCCTHHHHHHHHHHHHHHHHHHCTTCEE
T ss_pred             CcCccchhhhHHHHHHHhcCCCHhhcCCeeecCCCChHHHhcCcccccccCCCCcchHHHHHHHHHHHHHHHhCCCCCEE
Confidence            999999999999999999999999999999999999999999999999999999999999999999999999997 8999


Q ss_pred             EeecCCCchHHHHHHHHhhcCCccccC
Q 011618          269 QFEDFQMKWAFETLERYRKRFCMFNDD  295 (481)
Q Consensus       269 qfEDf~~~naf~iL~ryr~~~~~FNDD  295 (481)
                      |||||+++|||++|+|||+++||||||
T Consensus       231 ~~EDf~~~na~~~L~~yr~~~~~FNDD  257 (257)
T d1gq2a2         231 QFEDFANANAFRLLHKYRNKYCTFNDD  257 (257)
T ss_dssp             EECSCCHHHHHHHHHHHTTTSEEEETT
T ss_pred             ehhhcCCchHHHHHHHHccCCCccCCC
Confidence            999999999999999999999999999
>d1pj3a2 c.58.1.3 (A:21-279) Mitochondrial NAD(P)-dependent malic enzyme {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o0sa2 c.58.1.3 (A:2-295) Mitochondrial NAD(P)-dependent malic enzyme {Pig roundworm (Ascaris suum) [TaxId: 6253]} Back     information, alignment and structure
>d1pj3a1 c.2.1.7 (A:280-573) Mitochondrial NAD(P)-dependent malic enzyme {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gq2a1 c.2.1.7 (A:280-580) Mitochondrial NAD(P)-dependent malic enzyme {Domestic pigeon (Columba livia) [TaxId: 8932]} Back     information, alignment and structure
>d1o0sa1 c.2.1.7 (A:296-603) Mitochondrial NAD(P)-dependent malic enzyme {Pig roundworm (Ascaris suum) [TaxId: 6253]} Back     information, alignment and structure
>d1vl6a1 c.2.1.7 (A:155-376) Malate oxidoreductase (malic enzyme) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vl6a2 c.58.1.3 (A:1-154) Malate oxidoreductase (malic enzyme) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1b26a1 c.2.1.7 (A:179-412) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v9la1 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bgva1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} Back     information, alignment and structure
>d1obba1 c.2.1.5 (A:2-172) Alpha-glucosidase AglA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1s6ya1 c.2.1.5 (A:4-172) 6-phospho-beta-glucosidase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1u8xx1 c.2.1.5 (X:3-169) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1gtma1 c.2.1.7 (A:181-419) Glutamate dehydrogenase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1up7a1 c.2.1.5 (A:1-162) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1a4ia1 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1diha1 c.2.1.3 (A:2-130,A:241-273) Dihydrodipicolinate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure