Citrus Sinensis ID: 011684
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 479 | ||||||
| 449434630 | 487 | PREDICTED: dihydrolipoyllysine-residue a | 0.964 | 0.948 | 0.759 | 0.0 | |
| 225423947 | 488 | PREDICTED: dihydrolipoyllysine-residue a | 0.979 | 0.961 | 0.747 | 0.0 | |
| 15230922 | 480 | 2-oxoacid dehydrogenases acyltransferase | 0.964 | 0.962 | 0.754 | 0.0 | |
| 255576459 | 483 | Dihydrolipoyllysine-residue acetyltransf | 0.979 | 0.971 | 0.776 | 0.0 | |
| 297814808 | 482 | hypothetical protein ARALYDRAFT_904762 [ | 0.954 | 0.948 | 0.752 | 1e-180 | |
| 9279589 | 432 | dihydrolipoamide S-acetyltransferase [Ar | 0.889 | 0.986 | 0.793 | 1e-178 | |
| 224099359 | 467 | predicted protein [Populus trichocarpa] | 0.960 | 0.985 | 0.749 | 1e-178 | |
| 224111700 | 435 | predicted protein [Populus trichocarpa] | 0.874 | 0.963 | 0.819 | 1e-177 | |
| 356575530 | 472 | PREDICTED: dihydrolipoyllysine-residue a | 0.897 | 0.911 | 0.776 | 1e-175 | |
| 356498274 | 461 | PREDICTED: dihydrolipoyllysine-residue a | 0.951 | 0.989 | 0.759 | 1e-175 |
| >gi|449434630|ref|XP_004135099.1| PREDICTED: dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex-like [Cucumis sativus] gi|449523744|ref|XP_004168883.1| PREDICTED: dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Score = 652 bits (1681), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 378/498 (75%), Positives = 407/498 (81%), Gaps = 36/498 (7%)
Query: 5 SPFLSKTPLSNTPT---ISFSSSISTPLKWKSITSFSPSGSSSSRSRRRIFIVQSKIREI 61
SPFLS+ LS+ T SFS S+S+ L W S S + S + RRR+ ++QSKIREI
Sbjct: 3 SPFLSRAALSSNTTSVPFSFSYSVSSRLPWSSSRSHT---SVPANYRRRLPVIQSKIREI 59
Query: 62 FMPALSSTMTEGKIVSWIKSEGDVLSKGESVVVVESDKADMDVETFYDGILAAIVVPEGE 121
FMPALSSTMTEGKIVSW+KSEGDVLSKGESVVVVESDKADMDVETFYDGILAAIVV EGE
Sbjct: 60 FMPALSSTMTEGKIVSWVKSEGDVLSKGESVVVVESDKADMDVETFYDGILAAIVVGEGE 119
Query: 122 SAPVGAAIGILAETEAEVAQAKAKAASAGAAAPASHPVTSTPVPAVSPPEPKK-VAESAP 180
+APVGA IG+LAETE EVA+AKAKAAS +APA+ +P P P +++S+P
Sbjct: 120 TAPVGAPIGLLAETEEEVAEAKAKAASKSTSAPAAPAAAVSPSPPPPSSSPAPAISQSSP 179
Query: 181 --SGPRKTVATPYAKKLLKQHKVDINSVVGTGPFGRITPEDVEKAAGIAPSK-------- 230
GP+K VATP AKKL KQHKVDI SV GTGPFGRITP DVE AAGIAPSK
Sbjct: 180 PSDGPKKIVATPQAKKLAKQHKVDIGSVTGTGPFGRITPADVEAAAGIAPSKPAVSNVAS 239
Query: 231 ---------SVAPSAAPAALPKPAPAAAPAAPLLPGSTVVPFTTMQAAVSKNMIESLSVP 281
SAAP+ LP P +PGSTVVPFTTMQAAVSKNM+ESLSVP
Sbjct: 240 PVAAEAAAVPSKASAAPSNLPPP----------VPGSTVVPFTTMQAAVSKNMVESLSVP 289
Query: 282 TFRVGYPIITDALDALYEKVKPKGVTMTALLAKAAAMALVQHPVVNASCKDGKSFTYNAN 341
TFRVGYP+ TDALDALYEKVKPKGVTMTALLAKAAAMAL QHPVVNASCKDGKSFTYN+N
Sbjct: 290 TFRVGYPVSTDALDALYEKVKPKGVTMTALLAKAAAMALAQHPVVNASCKDGKSFTYNSN 349
Query: 342 INIAVAVAINGGLITPVLQDADKLDLYLLSQKWKELVEKARSKQLQPHEYNSGTFTLSNL 401
INIAVAVAINGGLITPVLQDADKLDLYLLSQKWKELVEKARSKQLQPHEYNSGTFTLSNL
Sbjct: 350 INIAVAVAINGGLITPVLQDADKLDLYLLSQKWKELVEKARSKQLQPHEYNSGTFTLSNL 409
Query: 402 GMFGVDRFDAILPPGQGAIMAVGASKPTVVADADGFFGVKSKMLVNVTADHRIIYGADLA 461
GMFGVD+FDAILPPGQGAIMAVGASKPTVV DADGFF VKSKMLVNVTADHRI+YGADLA
Sbjct: 410 GMFGVDKFDAILPPGQGAIMAVGASKPTVVTDADGFFSVKSKMLVNVTADHRIVYGADLA 469
Query: 462 AFLQTFSKIVENPESLTL 479
AFLQTF+KIVENPESLTL
Sbjct: 470 AFLQTFAKIVENPESLTL 487
|
Source: Cucumis sativus Species: Cucumis sativus Genus: Cucumis Family: Cucurbitaceae Order: Cucurbitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225423947|ref|XP_002282287.1| PREDICTED: dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|15230922|ref|NP_189215.1| 2-oxoacid dehydrogenases acyltransferase family protein [Arabidopsis thaliana] gi|5881963|gb|AAD55139.1|AF066079_1 dihydrolipoamide S-acetyltransferase [Arabidopsis thaliana] gi|14335166|gb|AAK59863.1| AT3g25860/MPE11_1 [Arabidopsis thaliana] gi|26983848|gb|AAN86176.1| putative dihydrolipoamide S-acetyltransferase [Arabidopsis thaliana] gi|332643559|gb|AEE77080.1| 2-oxoacid dehydrogenases acyltransferase family protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|255576459|ref|XP_002529121.1| Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase, putative [Ricinus communis] gi|223531400|gb|EEF33234.1| Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|297814808|ref|XP_002875287.1| hypothetical protein ARALYDRAFT_904762 [Arabidopsis lyrata subsp. lyrata] gi|297321125|gb|EFH51546.1| hypothetical protein ARALYDRAFT_904762 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|9279589|dbj|BAB01047.1| dihydrolipoamide S-acetyltransferase [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|224099359|ref|XP_002311453.1| predicted protein [Populus trichocarpa] gi|222851273|gb|EEE88820.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224111700|ref|XP_002315946.1| predicted protein [Populus trichocarpa] gi|222864986|gb|EEF02117.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356575530|ref|XP_003555893.1| PREDICTED: dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356498274|ref|XP_003517978.1| PREDICTED: dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex-like [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 479 | ||||||
| TAIR|locus:2092070 | 480 | LTA2 "AT3G25860" [Arabidopsis | 0.889 | 0.887 | 0.674 | 4.8e-142 | |
| TAIR|locus:2009273 | 465 | EMB3003 "AT1G34430" [Arabidops | 0.603 | 0.621 | 0.59 | 7.5e-120 | |
| GENEDB_PFALCIPARUM|PF10_0407 | 640 | PF10_0407 "dihydrolipoamide ac | 0.436 | 0.326 | 0.345 | 1.4e-50 | |
| UNIPROTKB|Q8IJJ4 | 640 | PF10_0407 "Dihydrolipoamide ac | 0.436 | 0.326 | 0.345 | 1.4e-50 | |
| TIGR_CMR|NSE_0953 | 403 | NSE_0953 "pyruvate dehydrogena | 0.440 | 0.523 | 0.345 | 6.2e-48 | |
| TIGR_CMR|SPO_2242 | 437 | SPO_2242 "pyruvate dehydrogena | 0.256 | 0.281 | 0.487 | 4e-45 | |
| MGI|MGI:2385311 | 642 | Dlat "dihydrolipoamide S-acety | 0.459 | 0.342 | 0.298 | 5.9e-44 | |
| UNIPROTKB|H0YDD4 | 479 | DLAT "Dihydrolipoyllysine-resi | 0.265 | 0.265 | 0.437 | 1.7e-43 | |
| RGD|619859 | 632 | Dlat "dihydrolipoamide S-acety | 0.455 | 0.344 | 0.296 | 1.8e-43 | |
| TIGR_CMR|ECH_0098 | 416 | ECH_0098 "pyruvate dehydrogena | 0.434 | 0.5 | 0.308 | 6.3e-43 |
| TAIR|locus:2092070 LTA2 "AT3G25860" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1389 (494.0 bits), Expect = 4.8e-142, P = 4.8e-142
Identities = 290/430 (67%), Positives = 307/430 (71%)
Query: 54 VQSKIREIFMPALSSTMTEGKIVSWIKSEGDVLSKGESVVVVESDKADMDVETFYDGILA 113
V+SKIREIFMPALSSTMTEGKIVSWIK+EG+ L+KGESVVVVESDKADMDVETFYDG LA
Sbjct: 51 VRSKIREIFMPALSSTMTEGKIVSWIKTEGEKLAKGESVVVVESDKADMDVETFYDGYLA 110
Query: 114 AIVVPEGESAPVGAAIGILXXXXXXXXXXXXXXXXXXXXXXXSHXXXX---XXXXXXXXX 170
AIVV EGE+APVGAAIG+L
Sbjct: 111 AIVVGEGETAPVGAAIGLLAETEAEIEEAKSKAASKSSSSVAEAVVPSPPPVTSSPAPAI 170
Query: 171 XXXXXXESAPSGPRKTVATPYAKKLLKQHKVDINSVVGTGPFGRITPEDVEKAAGIXXXX 230
+ GPRKTVATPYAKKL KQHKVDI SV GTGPFGRIT DVE AAGI
Sbjct: 171 AQPAPVTAVSDGPRKTVATPYAKKLAKQHKVDIESVAGTGPFGRITASDVETAAGIAPSK 230
Query: 231 XXXXXXXXXXXXXXXXXXXXXXXXXX-GSTVVPFTTMQAAVSKNMIESLSVPTFRVGYPI 289
S++VPFT MQ+AVSKNMIESLSVPTFRVGYP+
Sbjct: 231 SSIAPPPPPPPPVTAKATTTNLPPLLPDSSIVPFTAMQSAVSKNMIESLSVPTFRVGYPV 290
Query: 290 ITDALDALYEKVKPKGVTMTXXXXXXXXXXXVQHPVVNASCKDGKSFTYXXXXXXXXXXX 349
TDALDALYEKVKPKGVTMT QHPVVNASCKDGKSF+Y
Sbjct: 291 NTDALDALYEKVKPKGVTMTALLAKAAGMALAQHPVVNASCKDGKSFSYNSSINIAVAVA 350
Query: 350 XXGGLITPVLQDADKLDLYLLSQKWKELVEKARSKQLQPHEYNSGTFTLSNLGMFGVDRF 409
GGLITPVLQDADKLDLYLLSQKWKELV KARSKQLQPHEYNSGTFTLSNLGMFGVDRF
Sbjct: 351 INGGLITPVLQDADKLDLYLLSQKWKELVGKARSKQLQPHEYNSGTFTLSNLGMFGVDRF 410
Query: 410 DAILPPGQGAIMAVGASKPTVVADADGFFGVKSKMLVNVTADHRIIYGADLAAFLQTFSK 469
DAILPPGQGAIMAVGASKPTVVAD DGFF VK+ MLVNVTADHRI+YGADLAAFLQTF+K
Sbjct: 411 DAILPPGQGAIMAVGASKPTVVADKDGFFSVKNTMLVNVTADHRIVYGADLAAFLQTFAK 470
Query: 470 IVENPESLTL 479
I+ENP+SLTL
Sbjct: 471 IIENPDSLTL 480
|
|
| TAIR|locus:2009273 EMB3003 "AT1G34430" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| GENEDB_PFALCIPARUM|PF10_0407 PF10_0407 "dihydrolipoamide acetyltransferase, putative" [Plasmodium falciparum (taxid:5833)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8IJJ4 PF10_0407 "Dihydrolipoamide acyltransferase, putative" [Plasmodium falciparum 3D7 (taxid:36329)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|NSE_0953 NSE_0953 "pyruvate dehydrogenase complex, E2 component, dihydrolipoamide acetyltransferase" [Neorickettsia sennetsu str. Miyayama (taxid:222891)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SPO_2242 SPO_2242 "pyruvate dehydrogenase complex, E2 component, dihydrolipoamide acetyltransferase" [Ruegeria pomeroyi DSS-3 (taxid:246200)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2385311 Dlat "dihydrolipoamide S-acetyltransferase (E2 component of pyruvate dehydrogenase complex)" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|H0YDD4 DLAT "Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| RGD|619859 Dlat "dihydrolipoamide S-acetyltransferase" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|ECH_0098 ECH_0098 "pyruvate dehydrogenase complex, E2 component, dihydrolipoamide acetyltransferase" [Ehrlichia chaffeensis str. Arkansas (taxid:205920)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| LTA2 | LTA2; dihydrolipoyllysine-residue acetyltransferase; Nuclear encoded dihydrolipoamide S-acetyltransferase (LTA2) that encodes teh Pyruvate Decarboxylase E2 subunit. Mutant has embryo defect. (480 aa) | ||||||||||
(Arabidopsis thaliana) | |||||||||||
| EMB3003 | • | • | • | • | • | 0.931 | |||||
| LPD1 | • | • | • | • | • | • | 0.907 | ||||
| At1g01090 | • | • | • | • | • | 0.882 | |||||
| CAC1 | • | • | 0.863 | ||||||||
| mtLPD1 | • | • | • | • | • | • | • | 0.832 | |||
| KAS_I | • | 0.827 | |||||||||
| MOD1 | • | • | 0.796 | ||||||||
| AT3G25545 | • | 0.792 | |||||||||
| mtLPD2 | • | • | • | • | • | • | 0.790 | ||||
| MAB1 | • | • | • | • | 0.772 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 479 | |||
| PRK11856 | 411 | PRK11856, PRK11856, branched-chain alpha-keto acid | 1e-149 | |
| COG0508 | 404 | COG0508, AceF, Pyruvate/2-oxoglutarate dehydrogena | 1e-105 | |
| TIGR01349 | 436 | TIGR01349, PDHac_trf_mito, pyruvate dehydrogenase | 5e-90 | |
| PLN02744 | 539 | PLN02744, PLN02744, dihydrolipoyllysine-residue ac | 6e-81 | |
| PRK11855 | 547 | PRK11855, PRK11855, dihydrolipoamide acetyltransfe | 1e-69 | |
| pfam00198 | 212 | pfam00198, 2-oxoacid_dh, 2-oxoacid dehydrogenases | 3e-69 | |
| TIGR01347 | 403 | TIGR01347, sucB, 2-oxoglutarate dehydrogenase comp | 2e-58 | |
| PRK05704 | 407 | PRK05704, PRK05704, dihydrolipoamide succinyltrans | 3e-55 | |
| TIGR02927 | 579 | TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogena | 4e-53 | |
| PRK11854 | 633 | PRK11854, aceF, pyruvate dehydrogenase dihydrolipo | 1e-52 | |
| PLN02528 | 416 | PLN02528, PLN02528, 2-oxoisovalerate dehydrogenase | 4e-46 | |
| TIGR01348 | 546 | TIGR01348, PDHac_trf_long, pyruvate dehydrogenase | 5e-42 | |
| PRK14843 | 347 | PRK14843, PRK14843, dihydrolipoamide acetyltransfe | 7e-42 | |
| PTZ00144 | 418 | PTZ00144, PTZ00144, dihydrolipoamide succinyltrans | 1e-37 | |
| PRK11857 | 306 | PRK11857, PRK11857, dihydrolipoamide acetyltransfe | 1e-29 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 1e-27 | |
| cd06849 | 74 | cd06849, lipoyl_domain, Lipoyl domain of the dihyd | 2e-26 | |
| PLN02226 | 463 | PLN02226, PLN02226, 2-oxoglutarate dehydrogenase E | 4e-26 | |
| PRK11892 | 464 | PRK11892, PRK11892, pyruvate dehydrogenase subunit | 5e-24 | |
| PRK14875 | 371 | PRK14875, PRK14875, acetoin dehydrogenase E2 subun | 4e-20 | |
| PRK11855 | 547 | PRK11855, PRK11855, dihydrolipoamide acetyltransfe | 6e-17 | |
| PRK11854 | 633 | PRK11854, aceF, pyruvate dehydrogenase dihydrolipo | 8e-14 | |
| TIGR02927 | 579 | TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogena | 2e-12 | |
| PRK11854 | 633 | PRK11854, aceF, pyruvate dehydrogenase dihydrolipo | 3e-12 | |
| pfam00364 | 73 | pfam00364, Biotin_lipoyl, Biotin-requiring enzyme | 4e-12 | |
| TIGR01348 | 546 | TIGR01348, PDHac_trf_long, pyruvate dehydrogenase | 1e-11 | |
| cd06663 | 73 | cd06663, Biotinyl_lipoyl_domains, Biotinyl_lipoyl_ | 2e-10 | |
| pfam02817 | 39 | pfam02817, E3_binding, e3 binding domain | 2e-10 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 8e-07 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 1e-05 | |
| cd06850 | 67 | cd06850, biotinyl_domain, The biotinyl-domain or b | 1e-05 | |
| PRK12323 | 700 | PRK12323, PRK12323, DNA polymerase III subunits ga | 2e-05 | |
| PRK07003 | 830 | PRK07003, PRK07003, DNA polymerase III subunits ga | 3e-05 | |
| PRK07003 | 830 | PRK07003, PRK07003, DNA polymerase III subunits ga | 5e-05 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 1e-04 | |
| PRK07003 | 830 | PRK07003, PRK07003, DNA polymerase III subunits ga | 2e-04 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 2e-04 | |
| PRK12323 | 700 | PRK12323, PRK12323, DNA polymerase III subunits ga | 0.001 | |
| COG0511 | 140 | COG0511, AccB, Biotin carboxyl carrier protein [Li | 0.001 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 0.002 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 0.002 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 0.002 | |
| PTZ00436 | 357 | PTZ00436, PTZ00436, 60S ribosomal protein L19-like | 0.003 |
| >gnl|CDD|237001 PRK11856, PRK11856, branched-chain alpha-keto acid dehydrogenase subunit E2; Reviewed | Back alignment and domain information |
|---|
Score = 431 bits (1110), Expect = e-149
Identities = 167/425 (39%), Positives = 241/425 (56%), Gaps = 19/425 (4%)
Query: 58 IREIFMPALSSTMTEGKIVSWIKSEGDVLSKGESVVVVESDKADMDVETFYDGILAAIVV 117
+ E MP L MTEG+IV W+ GD + +G+ + VE+DKA +++ + G +A ++V
Sbjct: 2 MFEFKMPDLGEGMTEGEIVEWLVKVGDTVKEGQPLAEVETDKATVEIPSPVAGTVAKLLV 61
Query: 118 PEGESAPVGAAIGILAETEAEVAQAKAKAASAGAAAPASHPVTSTPVPAVSPPEPKKVAE 177
EG+ PVG+ I ++ E A AA+A AA A P + A + P A
Sbjct: 62 EEGDVVPVGSVIAVIEEEGEAEA-----AAAAEAAPEAPAPEPAPAAAAAAAAAPAAAAA 116
Query: 178 SAPSGPRKTVATPYAKKLLKQHKVDINSVVGTGPFGRITPEDVEKAAGIAPSKSVAPSAA 237
A A+P +KL ++ VD+++V G+GP GRIT EDVE AA +AA
Sbjct: 117 PAAPAAAAAKASPAVRKLARELGVDLSTVKGSGPGGRITKEDVEAAAA---------AAA 167
Query: 238 PAALPKPAPAAAPAAPLLPGSTVVPFTTMQAAVSKNMIES-LSVPTFRVGYPIITDALDA 296
PAA A AAAP A G VP + M+ A++K M+ES +P F + + AL A
Sbjct: 168 PAAAAAAAAAAAPPAAAAEGEERVPLSGMRKAIAKRMVESKREIPHFTLTDEVDVTALLA 227
Query: 297 LYEKVKP--KGVTMTALLAKAAAMALVQHPVVNASCKDGKSFTYNANINIAVAVAINGGL 354
L +++K +T+T L KA A+AL + P +NAS D + +NI +AVA +GGL
Sbjct: 228 LRKQLKAIGVKLTVTDFLIKAVALALKKFPELNASW-DDDAIVLKKYVNIGIAVATDGGL 286
Query: 355 ITPVLQDADKLDLYLLSQKWKELVEKARSKQLQPHEYNSGTFTLSNLGMFGVDRFDAILP 414
I PV++DADK L+ L+++ K+L EKAR +L+P E GTFT+SNLGMFG D F I+
Sbjct: 287 IVPVIRDADKKSLFELAREIKDLAEKAREGKLKPEELQGGTFTISNLGMFGGDYFTPIIN 346
Query: 415 PGQGAIMAVGASKPTVVADADGFFGVKSKMLVNVTADHRIIYGADLAAFLQTFSKIVENP 474
P + AI+ VGA V DG V+ M ++++ DHR+I GAD A FL+ +++ENP
Sbjct: 347 PPEVAILGVGAIVERPVVV-DGEIVVRKVMPLSLSFDHRVIDGADAARFLKALKELLENP 405
Query: 475 ESLTL 479
L L
Sbjct: 406 ALLLL 410
|
Length = 411 |
| >gnl|CDD|223582 COG0508, AceF, Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component, and related enzymes [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|233367 TIGR01349, PDHac_trf_mito, pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form | Back alignment and domain information |
|---|
| >gnl|CDD|215397 PLN02744, PLN02744, dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex | Back alignment and domain information |
|---|
| >gnl|CDD|237000 PRK11855, PRK11855, dihydrolipoamide acetyltransferase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|215782 pfam00198, 2-oxoacid_dh, 2-oxoacid dehydrogenases acyltransferase (catalytic domain) | Back alignment and domain information |
|---|
| >gnl|CDD|233365 TIGR01347, sucB, 2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase (E2 component) | Back alignment and domain information |
|---|
| >gnl|CDD|235571 PRK05704, PRK05704, dihydrolipoamide succinyltransferase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|200219 TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|236999 PRK11854, aceF, pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|215289 PLN02528, PLN02528, 2-oxoisovalerate dehydrogenase E2 component | Back alignment and domain information |
|---|
| >gnl|CDD|233366 TIGR01348, PDHac_trf_long, pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form | Back alignment and domain information |
|---|
| >gnl|CDD|184847 PRK14843, PRK14843, dihydrolipoamide acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240289 PTZ00144, PTZ00144, dihydrolipoamide succinyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237002 PRK11857, PRK11857, dihydrolipoamide acetyltransferase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|133458 cd06849, lipoyl_domain, Lipoyl domain of the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases | Back alignment and domain information |
|---|
| >gnl|CDD|177871 PLN02226, PLN02226, 2-oxoglutarate dehydrogenase E2 component | Back alignment and domain information |
|---|
| >gnl|CDD|237011 PRK11892, PRK11892, pyruvate dehydrogenase subunit beta; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184875 PRK14875, PRK14875, acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237000 PRK11855, PRK11855, dihydrolipoamide acetyltransferase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|236999 PRK11854, aceF, pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|200219 TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|236999 PRK11854, aceF, pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|201182 pfam00364, Biotin_lipoyl, Biotin-requiring enzyme | Back alignment and domain information |
|---|
| >gnl|CDD|233366 TIGR01348, PDHac_trf_long, pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form | Back alignment and domain information |
|---|
| >gnl|CDD|133456 cd06663, Biotinyl_lipoyl_domains, Biotinyl_lipoyl_domains are present in biotin-dependent carboxylases/decarboxylases, the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases, and the H-protein of the glycine cleavage system (GCS) | Back alignment and domain information |
|---|
| >gnl|CDD|202412 pfam02817, E3_binding, e3 binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|133459 cd06850, biotinyl_domain, The biotinyl-domain or biotin carboxyl carrier protein (BCCP) domain is present in all biotin-dependent enzymes, such as acetyl-CoA carboxylase, pyruvate carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA carboxylase, geranyl-CoA carboxylase, oxaloacetate decarboxylase, methylmalonyl-CoA decarboxylase, transcarboxylase and urea amidolyase | Back alignment and domain information |
|---|
| >gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223585 COG0511, AccB, Biotin carboxyl carrier protein [Lipid metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|185616 PTZ00436, PTZ00436, 60S ribosomal protein L19-like protein; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 479 | |||
| PRK05704 | 407 | dihydrolipoamide succinyltransferase; Validated | 100.0 | |
| TIGR01347 | 403 | sucB 2-oxoglutarate dehydrogenase complex dihydrol | 100.0 | |
| PLN02744 | 539 | dihydrolipoyllysine-residue acetyltransferase comp | 100.0 | |
| KOG0557 | 470 | consensus Dihydrolipoamide acetyltransferase [Ener | 100.0 | |
| TIGR02927 | 590 | SucB_Actino 2-oxoglutarate dehydrogenase, E2 compo | 100.0 | |
| TIGR01349 | 435 | PDHac_trf_mito pyruvate dehydrogenase complex dihy | 100.0 | |
| PLN02528 | 416 | 2-oxoisovalerate dehydrogenase E2 component | 100.0 | |
| TIGR01348 | 546 | PDHac_trf_long pyruvate dehydrogenase complex dihy | 100.0 | |
| PRK11854 | 633 | aceF pyruvate dehydrogenase dihydrolipoyltransacet | 100.0 | |
| PRK11856 | 411 | branched-chain alpha-keto acid dehydrogenase subun | 100.0 | |
| PRK11855 | 547 | dihydrolipoamide acetyltransferase; Reviewed | 100.0 | |
| COG0508 | 404 | AceF Pyruvate/2-oxoglutarate dehydrogenase complex | 100.0 | |
| PLN02226 | 463 | 2-oxoglutarate dehydrogenase E2 component | 100.0 | |
| PTZ00144 | 418 | dihydrolipoamide succinyltransferase; Provisional | 100.0 | |
| KOG0558 | 474 | consensus Dihydrolipoamide transacylase (alpha-ket | 100.0 | |
| PRK11857 | 306 | dihydrolipoamide acetyltransferase; Reviewed | 100.0 | |
| PRK14843 | 347 | dihydrolipoamide acetyltransferase; Provisional | 100.0 | |
| KOG0559 | 457 | consensus Dihydrolipoamide succinyltransferase (2- | 100.0 | |
| PF00198 | 231 | 2-oxoacid_dh: 2-oxoacid dehydrogenases acyltransfe | 100.0 | |
| PRK12270 | 1228 | kgd alpha-ketoglutarate decarboxylase; Reviewed | 100.0 | |
| PF00302 | 206 | CAT: Chloramphenicol acetyltransferase; InterPro: | 99.97 | |
| PRK13757 | 219 | chloramphenicol acetyltransferase; Provisional | 99.97 | |
| COG4845 | 219 | Chloramphenicol O-acetyltransferase [Defense mecha | 99.94 | |
| PF00364 | 74 | Biotin_lipoyl: Biotin-requiring enzyme; InterPro: | 99.77 | |
| PRK14875 | 371 | acetoin dehydrogenase E2 subunit dihydrolipoyllysi | 99.76 | |
| PRK06748 | 83 | hypothetical protein; Validated | 99.67 | |
| PRK05889 | 71 | putative acetyl-CoA carboxylase biotin carboxyl ca | 99.58 | |
| COG0511 | 140 | AccB Biotin carboxyl carrier protein [Lipid metabo | 99.55 | |
| PRK11892 | 464 | pyruvate dehydrogenase subunit beta; Provisional | 99.54 | |
| cd06663 | 73 | Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains ar | 99.53 | |
| PLN02983 | 274 | biotin carboxyl carrier protein of acetyl-CoA carb | 99.49 | |
| PRK08225 | 70 | acetyl-CoA carboxylase biotin carboxyl carrier pro | 99.48 | |
| PRK11854 | 633 | aceF pyruvate dehydrogenase dihydrolipoyltransacet | 99.47 | |
| TIGR02927 | 590 | SucB_Actino 2-oxoglutarate dehydrogenase, E2 compo | 99.42 | |
| PRK06549 | 130 | acetyl-CoA carboxylase biotin carboxyl carrier pro | 99.41 | |
| PF02817 | 39 | E3_binding: e3 binding domain; InterPro: IPR004167 | 99.39 | |
| PRK05641 | 153 | putative acetyl-CoA carboxylase biotin carboxyl ca | 99.36 | |
| PRK07051 | 80 | hypothetical protein; Validated | 99.36 | |
| PRK11855 | 547 | dihydrolipoamide acetyltransferase; Reviewed | 99.34 | |
| TIGR00531 | 156 | BCCP acetyl-CoA carboxylase, biotin carboxyl carri | 99.31 | |
| TIGR01348 | 546 | PDHac_trf_long pyruvate dehydrogenase complex dihy | 99.3 | |
| cd06850 | 67 | biotinyl_domain The biotinyl-domain or biotin carb | 99.3 | |
| PRK14042 | 596 | pyruvate carboxylase subunit B; Provisional | 99.28 | |
| PRK06302 | 155 | acetyl-CoA carboxylase biotin carboxyl carrier pro | 99.25 | |
| cd06849 | 74 | lipoyl_domain Lipoyl domain of the dihydrolipoyl a | 99.2 | |
| TIGR01108 | 582 | oadA oxaloacetate decarboxylase alpha subunit. Thi | 99.08 | |
| TIGR02712 | 1201 | urea_carbox urea carboxylase. Members of this fami | 99.07 | |
| PRK14040 | 593 | oxaloacetate decarboxylase; Provisional | 99.06 | |
| TIGR01235 | 1143 | pyruv_carbox pyruvate carboxylase. This enzyme pla | 99.06 | |
| COG4770 | 645 | Acetyl/propionyl-CoA carboxylase, alpha subunit [L | 98.98 | |
| PRK09282 | 592 | pyruvate carboxylase subunit B; Validated | 98.93 | |
| PRK12999 | 1146 | pyruvate carboxylase; Reviewed | 98.89 | |
| COG1038 | 1149 | PycA Pyruvate carboxylase [Energy production and c | 98.89 | |
| KOG0369 | 1176 | consensus Pyruvate carboxylase [Energy production | 98.69 | |
| KOG0238 | 670 | consensus 3-Methylcrotonyl-CoA carboxylase, biotin | 98.31 | |
| cd06848 | 96 | GCS_H Glycine cleavage H-protein. Glycine cleavage | 98.3 | |
| TIGR03077 | 110 | not_gcvH glycine cleavage protein H-like protein, | 98.05 | |
| KOG0368 | 2196 | consensus Acetyl-CoA carboxylase [Lipid transport | 98.0 | |
| PRK09783 | 409 | copper/silver efflux system membrane fusion protei | 97.96 | |
| PRK00624 | 114 | glycine cleavage system protein H; Provisional | 97.93 | |
| PRK13380 | 144 | glycine cleavage system protein H; Provisional | 97.92 | |
| TIGR00998 | 334 | 8a0101 efflux pump membrane protein (multidrug res | 97.9 | |
| PRK10559 | 310 | p-hydroxybenzoic acid efflux subunit AaeA; Provisi | 97.85 | |
| PRK01202 | 127 | glycine cleavage system protein H; Provisional | 97.83 | |
| TIGR01730 | 322 | RND_mfp RND family efflux transporter, MFP subunit | 97.81 | |
| PRK10476 | 346 | multidrug resistance protein MdtN; Provisional | 97.74 | |
| PRK15136 | 390 | multidrug efflux system protein EmrA; Provisional | 97.64 | |
| PRK09578 | 385 | periplasmic multidrug efflux lipoprotein precursor | 97.59 | |
| PRK15030 | 397 | multidrug efflux system transporter AcrA; Provisio | 97.59 | |
| PRK12784 | 84 | hypothetical protein; Provisional | 97.57 | |
| PRK03598 | 331 | putative efflux pump membrane fusion protein; Prov | 97.56 | |
| PRK09859 | 385 | multidrug efflux system protein MdtE; Provisional | 97.51 | |
| PRK14843 | 347 | dihydrolipoamide acetyltransferase; Provisional | 97.51 | |
| PF13533 | 50 | Biotin_lipoyl_2: Biotin-lipoyl like | 97.46 | |
| TIGR00527 | 127 | gcvH glycine cleavage system H protein. The genome | 97.46 | |
| PRK11556 | 415 | multidrug efflux system subunit MdtA; Provisional | 97.33 | |
| PRK11578 | 370 | macrolide transporter subunit MacA; Provisional | 97.28 | |
| PF13533 | 50 | Biotin_lipoyl_2: Biotin-lipoyl like | 97.22 | |
| PF12700 | 328 | HlyD_2: HlyD family secretion protein; PDB: 3LNN_B | 97.18 | |
| PF01597 | 122 | GCV_H: Glycine cleavage H-protein; InterPro: IPR00 | 97.1 | |
| TIGR02971 | 327 | heterocyst_DevB ABC exporter membrane fusion prote | 97.02 | |
| TIGR03309 | 256 | matur_yqeB selenium-dependent molybdenum hydroxyla | 96.95 | |
| COG0509 | 131 | GcvH Glycine cleavage system H protein (lipoate-bi | 96.93 | |
| PF13375 | 101 | RnfC_N: RnfC Barrel sandwich hybrid domain | 96.58 | |
| PRK05889 | 71 | putative acetyl-CoA carboxylase biotin carboxyl ca | 96.54 | |
| TIGR00999 | 265 | 8a0102 Membrane Fusion Protein cluster 2 (function | 96.41 | |
| TIGR01843 | 423 | type_I_hlyD type I secretion membrane fusion prote | 96.41 | |
| COG1566 | 352 | EmrA Multidrug resistance efflux pump [Defense mec | 96.4 | |
| PRK06748 | 83 | hypothetical protein; Validated | 95.9 | |
| cd06253 | 298 | M14_ASTE_ASPA_like_3 A functionally uncharacterize | 95.9 | |
| cd06250 | 359 | M14_PaAOTO_like An uncharacterized subgroup of the | 95.65 | |
| cd06252 | 316 | M14_ASTE_ASPA_like_2 A functionally uncharacterize | 95.56 | |
| cd06251 | 287 | M14_ASTE_ASPA_like_1 A functionally uncharacterize | 95.55 | |
| PF07247 | 480 | AATase: Alcohol acetyltransferase; InterPro: IPR01 | 95.51 | |
| cd06850 | 67 | biotinyl_domain The biotinyl-domain or biotin carb | 95.4 | |
| PRK08225 | 70 | acetyl-CoA carboxylase biotin carboxyl carrier pro | 95.4 | |
| TIGR02994 | 325 | ectoine_eutE ectoine utilization protein EutE. Mem | 95.16 | |
| COG0511 | 140 | AccB Biotin carboxyl carrier protein [Lipid metabo | 95.03 | |
| PF13437 | 105 | HlyD_3: HlyD family secretion protein | 94.99 | |
| COG3608 | 331 | Predicted deacylase [General function prediction o | 94.8 | |
| PF09891 | 150 | DUF2118: Uncharacterized protein conserved in arch | 94.72 | |
| PF05896 | 257 | NQRA: Na(+)-translocating NADH-quinone reductase s | 94.54 | |
| PRK06549 | 130 | acetyl-CoA carboxylase biotin carboxyl carrier pro | 94.22 | |
| cd06254 | 288 | M14_ASTE_ASPA_like_4 A functionally uncharacterize | 94.22 | |
| PF00364 | 74 | Biotin_lipoyl: Biotin-requiring enzyme; InterPro: | 94.17 | |
| PRK07051 | 80 | hypothetical protein; Validated | 93.64 | |
| PF00529 | 305 | HlyD: HlyD family secretion protein the correspond | 93.57 | |
| PRK10476 | 346 | multidrug resistance protein MdtN; Provisional | 93.54 | |
| PRK05641 | 153 | putative acetyl-CoA carboxylase biotin carboxyl ca | 93.35 | |
| TIGR00998 | 334 | 8a0101 efflux pump membrane protein (multidrug res | 93.3 | |
| PRK11556 | 415 | multidrug efflux system subunit MdtA; Provisional | 93.12 | |
| TIGR01235 | 1143 | pyruv_carbox pyruvate carboxylase. This enzyme pla | 92.98 | |
| PRK09859 | 385 | multidrug efflux system protein MdtE; Provisional | 92.92 | |
| TIGR02971 | 327 | heterocyst_DevB ABC exporter membrane fusion prote | 92.84 | |
| PF00529 | 305 | HlyD: HlyD family secretion protein the correspond | 92.32 | |
| TIGR01730 | 322 | RND_mfp RND family efflux transporter, MFP subunit | 91.99 | |
| PF12700 | 328 | HlyD_2: HlyD family secretion protein; PDB: 3LNN_B | 91.8 | |
| PRK11578 | 370 | macrolide transporter subunit MacA; Provisional | 91.79 | |
| TIGR01936 | 447 | nqrA NADH:ubiquinone oxidoreductase, Na(+)-translo | 91.53 | |
| PRK09578 | 385 | periplasmic multidrug efflux lipoprotein precursor | 91.53 | |
| TIGR01000 | 457 | bacteriocin_acc bacteriocin secretion accessory pr | 91.5 | |
| PRK15136 | 390 | multidrug efflux system protein EmrA; Provisional | 91.46 | |
| PRK10559 | 310 | p-hydroxybenzoic acid efflux subunit AaeA; Provisi | 91.37 | |
| TIGR01945 | 435 | rnfC electron transport complex, RnfABCDGE type, C | 91.09 | |
| COG1726 | 447 | NqrA Na+-transporting NADH:ubiquinone oxidoreducta | 90.9 | |
| PF00668 | 301 | Condensation: Condensation domain; InterPro: IPR00 | 90.78 | |
| TIGR03794 | 421 | NHPM_micro_HlyD NHPM bacteriocin system secretion | 90.7 | |
| PRK03598 | 331 | putative efflux pump membrane fusion protein; Prov | 90.65 | |
| PRK05035 | 695 | electron transport complex protein RnfC; Provision | 90.54 | |
| TIGR01843 | 423 | type_I_hlyD type I secretion membrane fusion prote | 90.53 | |
| PRK05352 | 448 | Na(+)-translocating NADH-quinone reductase subunit | 90.34 | |
| cd06255 | 293 | M14_ASTE_ASPA_like_5 A functionally uncharacterize | 90.18 | |
| PF07831 | 75 | PYNP_C: Pyrimidine nucleoside phosphorylase C-term | 90.13 | |
| KOG3373 | 172 | consensus Glycine cleavage system H protein (lipoa | 89.59 | |
| PRK15030 | 397 | multidrug efflux system transporter AcrA; Provisio | 89.58 | |
| cd00210 | 124 | PTS_IIA_glc PTS_IIA, PTS system, glucose/sucrose s | 89.31 | |
| PRK14042 | 596 | pyruvate carboxylase subunit B; Provisional | 88.91 | |
| PF04952 | 292 | AstE_AspA: Succinylglutamate desuccinylase / Aspar | 88.62 | |
| PRK09783 | 409 | copper/silver efflux system membrane fusion protei | 88.34 | |
| TIGR02946 | 446 | acyl_WS_DGAT acyltransferase, WS/DGAT/MGAT. This b | 88.25 | |
| TIGR00531 | 156 | BCCP acetyl-CoA carboxylase, biotin carboxyl carri | 87.93 | |
| COG4072 | 161 | Uncharacterized protein conserved in archaea [Func | 87.52 | |
| PRK06302 | 155 | acetyl-CoA carboxylase biotin carboxyl carrier pro | 87.49 | |
| PRK09439 | 169 | PTS system glucose-specific transporter subunit; P | 87.3 | |
| TIGR03794 | 421 | NHPM_micro_HlyD NHPM bacteriocin system secretion | 87.3 | |
| TIGR01000 | 457 | bacteriocin_acc bacteriocin secretion accessory pr | 87.27 | |
| PLN02983 | 274 | biotin carboxyl carrier protein of acetyl-CoA carb | 87.24 | |
| PF00358 | 132 | PTS_EIIA_1: phosphoenolpyruvate-dependent sugar ph | 86.99 | |
| COG4656 | 529 | RnfC Predicted NADH:ubiquinone oxidoreductase, sub | 86.41 | |
| TIGR00830 | 121 | PTBA PTS system, glucose subfamily, IIA component. | 86.04 | |
| COG0845 | 372 | AcrA Membrane-fusion protein [Cell envelope biogen | 85.96 | |
| PLN02226 | 463 | 2-oxoglutarate dehydrogenase E2 component | 85.81 | |
| PF02749 | 88 | QRPTase_N: Quinolinate phosphoribosyl transferase, | 85.53 | |
| TIGR00164 | 189 | PS_decarb_rel phosphatidylserine decarboxylase pre | 85.19 | |
| PRK14040 | 593 | oxaloacetate decarboxylase; Provisional | 84.9 | |
| PF13437 | 105 | HlyD_3: HlyD family secretion protein | 84.39 | |
| PRK05305 | 206 | phosphatidylserine decarboxylase; Provisional | 84.15 | |
| PRK09294 | 416 | acyltransferase PapA5; Provisional | 84.0 | |
| TIGR01108 | 582 | oadA oxaloacetate decarboxylase alpha subunit. Thi | 83.88 | |
| PRK09282 | 592 | pyruvate carboxylase subunit B; Validated | 83.29 | |
| COG2190 | 156 | NagE Phosphotransferase system IIA components [Car | 82.64 | |
| PRK14875 | 371 | acetoin dehydrogenase E2 subunit dihydrolipoyllysi | 82.5 | |
| COG1566 | 352 | EmrA Multidrug resistance efflux pump [Defense mec | 81.78 | |
| PRK12784 | 84 | hypothetical protein; Provisional | 80.86 | |
| cd00210 | 124 | PTS_IIA_glc PTS_IIA, PTS system, glucose/sucrose s | 80.06 | |
| cd06663 | 73 | Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains ar | 80.02 |
| >PRK05704 dihydrolipoamide succinyltransferase; Validated | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.8e-86 Score=689.51 Aligned_cols=395 Identities=32% Similarity=0.477 Sum_probs=331.2
Q ss_pred EEEecCCCCCCCceEEEEEEEcCCCCeecCCCeEEEEEecceeeEEEcCCCeEEEEEecCCCCeecCCCeEEEEecChhh
Q 011684 59 REIFMPALSSTMTEGKIVSWIKSEGDVLSKGESVVVVESDKADMDVETFYDGILAAIVVPEGESAPVGAAIGILAETEAE 138 (479)
Q Consensus 59 ~~i~~P~l~~~~~eg~i~~w~v~~Gd~V~~g~~l~~vet~K~~~~v~ap~~G~v~~i~~~~g~~v~~G~~l~~i~~~~~~ 138 (479)
++|+||+||++|+||+|++|+|++||.|++||+||+||+||++++|+||++|+|.++++++|+.|.+|++|++|++.+++
T Consensus 3 ~~i~~P~lg~~~~eg~i~~w~v~~Gd~V~~Gd~l~~vEtdK~~~ei~a~~~G~v~~i~v~~G~~V~~G~~l~~i~~~~~~ 82 (407)
T PRK05704 3 VEIKVPTLPESVTEATIATWHKKPGDAVKRDEVLVEIETDKVVLEVPAPAAGVLSEILAEEGDTVTVGQVLGRIDEGAAA 82 (407)
T ss_pred eeEecCCCCCCCceEEEEEEEeCCcCEeCCCCEEEEEEecCceeEEecCCCEEEEEEEeCCCCEeCCCCEEEEEecCCcc
Confidence 58999999999999999999999999999999999999999999999999999999999999999999999999765432
Q ss_pred HHHHHhhhhccCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCccccChhHHHHHhhcCCCccccccCCCCCccchh
Q 011684 139 VAQAKAKAASAGAAAPASHPVTSTPVPAVSPPEPKKVAESAPSGPRKTVATPYAKKLLKQHKVDINSVVGTGPFGRITPE 218 (479)
Q Consensus 139 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~asP~aR~lA~e~gidl~~v~gtG~~GrI~~~ 218 (479)
.. . ... +...++ .. ..+.+.+. .+. .....+++||+||+||+||||||++|+|||++|||+++
T Consensus 83 ~~---~-~~~-----~~~~~~-~~--~~~~~~~~---~~~--~~~~~~~asP~aR~lA~e~gidl~~v~gtG~~GrI~~~ 145 (407)
T PRK05704 83 GA---A-AAA-----AAAAAA-AA--AAPAQAQA---AAA--AEQSNDALSPAARKLAAENGLDASAVKGTGKGGRVTKE 145 (407)
T ss_pred cc---c-CCC-----CCCCCC-CC--CCCCCCCC---Ccc--CCCccccCCchhhhHHhhcCCChhhCCCCCCCCcccHH
Confidence 11 0 000 000000 00 00000000 000 01123679999999999999999999999999999999
Q ss_pred hHHHhhccCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCceeccchhhHHHHHHhhhc-cCccEEEEEEEEeccHHHHH
Q 011684 219 DVEKAAGIAPSKSVAPSAAPAALPKPAPAAAPAAPLLPGSTVVPFTTMQAAVSKNMIES-LSVPTFRVGYPIITDALDAL 297 (479)
Q Consensus 219 DV~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~s~~r~~ia~~m~~S-~~vP~~~~~~~iDvt~l~~~ 297 (479)
||++|+....... + +++.+... ..+........+.+|++++||+|+++|.+| +++|||+++.++|+|+|+++
T Consensus 146 DV~~~~~~~~~~~----~-~~~~~~~~--~~~~~~~~~~~~~vpls~~rk~ia~~m~~S~~~iPh~~~~~evd~~~l~~~ 218 (407)
T PRK05704 146 DVLAALAAAAAAP----A-APAAAAPA--AAPAPLGARPEERVPMTRLRKTIAERLLEAQNTTAMLTTFNEVDMTPVMDL 218 (407)
T ss_pred HHHHHhhcccccC----C-CCCCCCCc--CCCccccCCcceEeeChHHHHHHHHHHHHHhhcCCeEEEEEEEeHHHHHHH
Confidence 9999974321110 0 00000000 000000011235689999999999999999 89999999999999999999
Q ss_pred HHHhCC-------CCCCHHHHHHHHHHHHHhhCccccccccCCCeeEEcCcccEEEEEEeCCCeEEeEEecCCCCCHHHH
Q 011684 298 YEKVKP-------KGVTMTALLAKAAAMALVQHPVVNASCKDGKSFTYNANINIAVAVAINGGLITPVLQDADKLDLYLL 370 (479)
Q Consensus 298 ~~~~k~-------~~~s~~~~likAva~Al~~~P~~n~~~~~~~~i~~~~~i~i~~aV~~~~gl~~pvi~~a~~~sl~ei 370 (479)
|+++++ .++||++||+||+++||.+||+||++|+ ++++++|+++|||+||++++||++|||++++++++.||
T Consensus 219 r~~~~~~~~~~~~~kls~~~~likA~a~AL~~~P~~Na~~~-~~~i~~~~~~nIgiAv~~~~GLivPVI~~a~~~sl~eI 297 (407)
T PRK05704 219 RKQYKDAFEKKHGVKLGFMSFFVKAVVEALKRYPEVNASID-GDDIVYHNYYDIGIAVGTPRGLVVPVLRDADQLSFAEI 297 (407)
T ss_pred HHHHHhhhHhhcCCCcCHHHHHHHHHHHHHHhCcHhhcEEc-CCeEEEcCCCCeEEEEECCCceEeCcCCCcccCCHHHH
Confidence 999874 1699999999999999999999999996 45899999999999999999999999999999999999
Q ss_pred HHHHHHHHHHHHcCCCCCCCCCCCeEEEeecCCCCccceeecCCCCCceEEEeCcceEEEEEcCCCeEEEEEEEEEEEEe
Q 011684 371 SQKWKELVEKARSKQLQPHEYNSGTFTLSNLGMFGVDRFDAILPPGQGAIMAVGASKPTVVADADGFFGVKSKMLVNVTA 450 (479)
Q Consensus 371 ~~~~~~l~~~ar~~~l~~~d~~~~tftISnlg~~G~~~ftpii~~~~~ail~vG~~~~~~v~~~~G~i~~r~~m~lslt~ 450 (479)
+++++++.+++|+|+|+++|+.||||+|||+|+||+.+|+||+|+||+|||++|++.++++++ ||+++++++|+|+|+|
T Consensus 298 a~~~~~l~~~ar~g~L~~~d~~ggTfTiSNlG~~G~~~~tpiIn~pq~aILgvG~i~~~pv~~-~g~i~~r~~~~lsls~ 376 (407)
T PRK05704 298 EKKIAELAKKARDGKLSIEELTGGTFTITNGGVFGSLMSTPIINPPQSAILGMHKIKERPVAV-NGQIVIRPMMYLALSY 376 (407)
T ss_pred HHHHHHHHHHHHcCCCChHHcCCceEEEecCCcccccceeccccCCcEEEEEcccceEEeEEE-CCEEEEEEEEEEEEEe
Confidence 999999999999999999999999999999999999999999999999999999999999986 7999999999999999
Q ss_pred cccccchHHHHHHHHHHHHHhcCCccccC
Q 011684 451 DHRIIYGADLAAFLQTFSKIVENPESLTL 479 (479)
Q Consensus 451 DHRvvDG~~aa~Fl~~l~~~le~p~~ll~ 479 (479)
|||+|||+++|+||++|+++||+|+.||+
T Consensus 377 DHRviDGa~aa~Fl~~l~~~le~p~~ll~ 405 (407)
T PRK05704 377 DHRIIDGKEAVGFLVTIKELLEDPERLLL 405 (407)
T ss_pred chhhhCcHHHHHHHHHHHHHhhCHHHHhh
Confidence 99999999999999999999999998764
|
|
| >TIGR01347 sucB 2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase (E2 component) | Back alignment and domain information |
|---|
| >PLN02744 dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex | Back alignment and domain information |
|---|
| >KOG0557 consensus Dihydrolipoamide acetyltransferase [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR02927 SucB_Actino 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase | Back alignment and domain information |
|---|
| >TIGR01349 PDHac_trf_mito pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form | Back alignment and domain information |
|---|
| >PLN02528 2-oxoisovalerate dehydrogenase E2 component | Back alignment and domain information |
|---|
| >TIGR01348 PDHac_trf_long pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form | Back alignment and domain information |
|---|
| >PRK11854 aceF pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated | Back alignment and domain information |
|---|
| >PRK11856 branched-chain alpha-keto acid dehydrogenase subunit E2; Reviewed | Back alignment and domain information |
|---|
| >PRK11855 dihydrolipoamide acetyltransferase; Reviewed | Back alignment and domain information |
|---|
| >COG0508 AceF Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component, and related enzymes [Energy production and conversion] | Back alignment and domain information |
|---|
| >PLN02226 2-oxoglutarate dehydrogenase E2 component | Back alignment and domain information |
|---|
| >PTZ00144 dihydrolipoamide succinyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG0558 consensus Dihydrolipoamide transacylase (alpha-keto acid dehydrogenase E2 subunit) [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK11857 dihydrolipoamide acetyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK14843 dihydrolipoamide acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG0559 consensus Dihydrolipoamide succinyltransferase (2-oxoglutarate dehydrogenase, E2 subunit) [Energy production and conversion] | Back alignment and domain information |
|---|
| >PF00198 2-oxoacid_dh: 2-oxoacid dehydrogenases acyltransferase (catalytic domain); InterPro: IPR001078 This domain is found in the lipoamide acyltransferase component of the branched-chain alpha-keto acid dehydrogenase complex 2 | Back alignment and domain information |
|---|
| >PRK12270 kgd alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >PF00302 CAT: Chloramphenicol acetyltransferase; InterPro: IPR001707 Chloramphenicol acetyltransferase (CAT) (2 | Back alignment and domain information |
|---|
| >PRK13757 chloramphenicol acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG4845 Chloramphenicol O-acetyltransferase [Defense mechanisms] | Back alignment and domain information |
|---|
| >PF00364 Biotin_lipoyl: Biotin-requiring enzyme; InterPro: IPR000089 The biotin / lipoyl attachment domain has a conserved lysine residue that binds biotin or lipoic acid | Back alignment and domain information |
|---|
| >PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06748 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK05889 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Provisional | Back alignment and domain information |
|---|
| >COG0511 AccB Biotin carboxyl carrier protein [Lipid metabolism] | Back alignment and domain information |
|---|
| >PRK11892 pyruvate dehydrogenase subunit beta; Provisional | Back alignment and domain information |
|---|
| >cd06663 Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains are present in biotin-dependent carboxylases/decarboxylases, the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases, and the H-protein of the glycine cleavage system (GCS) | Back alignment and domain information |
|---|
| >PLN02983 biotin carboxyl carrier protein of acetyl-CoA carboxylase | Back alignment and domain information |
|---|
| >PRK08225 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >PRK11854 aceF pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated | Back alignment and domain information |
|---|
| >TIGR02927 SucB_Actino 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase | Back alignment and domain information |
|---|
| >PRK06549 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >PF02817 E3_binding: e3 binding domain; InterPro: IPR004167 A small domain of the E2 subunit of 2-oxo-acid dehydrogenases that is responsible for the binding of the E3 subunit | Back alignment and domain information |
|---|
| >PRK05641 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >PRK07051 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK11855 dihydrolipoamide acetyltransferase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00531 BCCP acetyl-CoA carboxylase, biotin carboxyl carrier protein | Back alignment and domain information |
|---|
| >TIGR01348 PDHac_trf_long pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form | Back alignment and domain information |
|---|
| >cd06850 biotinyl_domain The biotinyl-domain or biotin carboxyl carrier protein (BCCP) domain is present in all biotin-dependent enzymes, such as acetyl-CoA carboxylase, pyruvate carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA carboxylase, geranyl-CoA carboxylase, oxaloacetate decarboxylase, methylmalonyl-CoA decarboxylase, transcarboxylase and urea amidolyase | Back alignment and domain information |
|---|
| >PRK14042 pyruvate carboxylase subunit B; Provisional | Back alignment and domain information |
|---|
| >PRK06302 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >cd06849 lipoyl_domain Lipoyl domain of the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases | Back alignment and domain information |
|---|
| >TIGR01108 oadA oxaloacetate decarboxylase alpha subunit | Back alignment and domain information |
|---|
| >TIGR02712 urea_carbox urea carboxylase | Back alignment and domain information |
|---|
| >PRK14040 oxaloacetate decarboxylase; Provisional | Back alignment and domain information |
|---|
| >TIGR01235 pyruv_carbox pyruvate carboxylase | Back alignment and domain information |
|---|
| >COG4770 Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid metabolism] | Back alignment and domain information |
|---|
| >PRK09282 pyruvate carboxylase subunit B; Validated | Back alignment and domain information |
|---|
| >PRK12999 pyruvate carboxylase; Reviewed | Back alignment and domain information |
|---|
| >COG1038 PycA Pyruvate carboxylase [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG0369 consensus Pyruvate carboxylase [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG0238 consensus 3-Methylcrotonyl-CoA carboxylase, biotin-containing subunit/Propionyl-CoA carboxylase, alpha chain/Acetyl-CoA carboxylase, biotin carboxylase subunit [Lipid transport and metabolism; Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd06848 GCS_H Glycine cleavage H-protein | Back alignment and domain information |
|---|
| >TIGR03077 not_gcvH glycine cleavage protein H-like protein, Chlamydial | Back alignment and domain information |
|---|
| >KOG0368 consensus Acetyl-CoA carboxylase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK09783 copper/silver efflux system membrane fusion protein CusB; Provisional | Back alignment and domain information |
|---|
| >PRK00624 glycine cleavage system protein H; Provisional | Back alignment and domain information |
|---|
| >PRK13380 glycine cleavage system protein H; Provisional | Back alignment and domain information |
|---|
| >TIGR00998 8a0101 efflux pump membrane protein (multidrug resistance protein A) | Back alignment and domain information |
|---|
| >PRK10559 p-hydroxybenzoic acid efflux subunit AaeA; Provisional | Back alignment and domain information |
|---|
| >PRK01202 glycine cleavage system protein H; Provisional | Back alignment and domain information |
|---|
| >TIGR01730 RND_mfp RND family efflux transporter, MFP subunit | Back alignment and domain information |
|---|
| >PRK10476 multidrug resistance protein MdtN; Provisional | Back alignment and domain information |
|---|
| >PRK15136 multidrug efflux system protein EmrA; Provisional | Back alignment and domain information |
|---|
| >PRK09578 periplasmic multidrug efflux lipoprotein precursor; Reviewed | Back alignment and domain information |
|---|
| >PRK15030 multidrug efflux system transporter AcrA; Provisional | Back alignment and domain information |
|---|
| >PRK12784 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK03598 putative efflux pump membrane fusion protein; Provisional | Back alignment and domain information |
|---|
| >PRK09859 multidrug efflux system protein MdtE; Provisional | Back alignment and domain information |
|---|
| >PRK14843 dihydrolipoamide acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF13533 Biotin_lipoyl_2: Biotin-lipoyl like | Back alignment and domain information |
|---|
| >TIGR00527 gcvH glycine cleavage system H protein | Back alignment and domain information |
|---|
| >PRK11556 multidrug efflux system subunit MdtA; Provisional | Back alignment and domain information |
|---|
| >PRK11578 macrolide transporter subunit MacA; Provisional | Back alignment and domain information |
|---|
| >PF13533 Biotin_lipoyl_2: Biotin-lipoyl like | Back alignment and domain information |
|---|
| >PF12700 HlyD_2: HlyD family secretion protein; PDB: 3LNN_B 4DK0_A 4DK1_C 3FPP_B 2K32_A 2K33_A 3OW7_B 3OOC_A 3T53_B 4DNT_C | Back alignment and domain information |
|---|
| >PF01597 GCV_H: Glycine cleavage H-protein; InterPro: IPR002930 This is a family of glycine cleavage H-proteins, part of the glycine cleavage multienzyme complex (GCV) found in bacteria and the mitochondria of eukaryotes | Back alignment and domain information |
|---|
| >TIGR02971 heterocyst_DevB ABC exporter membrane fusion protein, DevB family | Back alignment and domain information |
|---|
| >TIGR03309 matur_yqeB selenium-dependent molybdenum hydroxylase system protein, YqeB family | Back alignment and domain information |
|---|
| >COG0509 GcvH Glycine cleavage system H protein (lipoate-binding) [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF13375 RnfC_N: RnfC Barrel sandwich hybrid domain | Back alignment and domain information |
|---|
| >PRK05889 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR00999 8a0102 Membrane Fusion Protein cluster 2 (function with RND porters) | Back alignment and domain information |
|---|
| >TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >COG1566 EmrA Multidrug resistance efflux pump [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK06748 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >cd06253 M14_ASTE_ASPA_like_3 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >cd06250 M14_PaAOTO_like An uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >cd06252 M14_ASTE_ASPA_like_2 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >cd06251 M14_ASTE_ASPA_like_1 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >PF07247 AATase: Alcohol acetyltransferase; InterPro: IPR010828 This family contains a number of alcohol acetyltransferase (2 | Back alignment and domain information |
|---|
| >cd06850 biotinyl_domain The biotinyl-domain or biotin carboxyl carrier protein (BCCP) domain is present in all biotin-dependent enzymes, such as acetyl-CoA carboxylase, pyruvate carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA carboxylase, geranyl-CoA carboxylase, oxaloacetate decarboxylase, methylmalonyl-CoA decarboxylase, transcarboxylase and urea amidolyase | Back alignment and domain information |
|---|
| >PRK08225 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >TIGR02994 ectoine_eutE ectoine utilization protein EutE | Back alignment and domain information |
|---|
| >COG0511 AccB Biotin carboxyl carrier protein [Lipid metabolism] | Back alignment and domain information |
|---|
| >PF13437 HlyD_3: HlyD family secretion protein | Back alignment and domain information |
|---|
| >COG3608 Predicted deacylase [General function prediction only] | Back alignment and domain information |
|---|
| >PF09891 DUF2118: Uncharacterized protein conserved in archaea (DUF2118); InterPro: IPR019217 This entry represents a family of hypothetical proteins of unknown function | Back alignment and domain information |
|---|
| >PF05896 NQRA: Na(+)-translocating NADH-quinone reductase subunit A (NQRA); InterPro: IPR008703 This family consists of several bacterial Na+-translocating NADH-quinone reductase subunit A (NQRA) proteins | Back alignment and domain information |
|---|
| >PRK06549 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >cd06254 M14_ASTE_ASPA_like_4 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >PF00364 Biotin_lipoyl: Biotin-requiring enzyme; InterPro: IPR000089 The biotin / lipoyl attachment domain has a conserved lysine residue that binds biotin or lipoic acid | Back alignment and domain information |
|---|
| >PRK07051 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF00529 HlyD: HlyD family secretion protein the corresponding Prosite entry | Back alignment and domain information |
|---|
| >PRK10476 multidrug resistance protein MdtN; Provisional | Back alignment and domain information |
|---|
| >PRK05641 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >TIGR00998 8a0101 efflux pump membrane protein (multidrug resistance protein A) | Back alignment and domain information |
|---|
| >PRK11556 multidrug efflux system subunit MdtA; Provisional | Back alignment and domain information |
|---|
| >TIGR01235 pyruv_carbox pyruvate carboxylase | Back alignment and domain information |
|---|
| >PRK09859 multidrug efflux system protein MdtE; Provisional | Back alignment and domain information |
|---|
| >TIGR02971 heterocyst_DevB ABC exporter membrane fusion protein, DevB family | Back alignment and domain information |
|---|
| >PF00529 HlyD: HlyD family secretion protein the corresponding Prosite entry | Back alignment and domain information |
|---|
| >TIGR01730 RND_mfp RND family efflux transporter, MFP subunit | Back alignment and domain information |
|---|
| >PF12700 HlyD_2: HlyD family secretion protein; PDB: 3LNN_B 4DK0_A 4DK1_C 3FPP_B 2K32_A 2K33_A 3OW7_B 3OOC_A 3T53_B 4DNT_C | Back alignment and domain information |
|---|
| >PRK11578 macrolide transporter subunit MacA; Provisional | Back alignment and domain information |
|---|
| >TIGR01936 nqrA NADH:ubiquinone oxidoreductase, Na(+)-translocating, A subunit | Back alignment and domain information |
|---|
| >PRK09578 periplasmic multidrug efflux lipoprotein precursor; Reviewed | Back alignment and domain information |
|---|
| >TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein | Back alignment and domain information |
|---|
| >PRK15136 multidrug efflux system protein EmrA; Provisional | Back alignment and domain information |
|---|
| >PRK10559 p-hydroxybenzoic acid efflux subunit AaeA; Provisional | Back alignment and domain information |
|---|
| >TIGR01945 rnfC electron transport complex, RnfABCDGE type, C subunit | Back alignment and domain information |
|---|
| >COG1726 NqrA Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrA [Energy production and conversion] | Back alignment and domain information |
|---|
| >PF00668 Condensation: Condensation domain; InterPro: IPR001242 This domain is found in many multi-domain enzymes which synthesize peptide antibiotics | Back alignment and domain information |
|---|
| >TIGR03794 NHPM_micro_HlyD NHPM bacteriocin system secretion protein | Back alignment and domain information |
|---|
| >PRK03598 putative efflux pump membrane fusion protein; Provisional | Back alignment and domain information |
|---|
| >PRK05035 electron transport complex protein RnfC; Provisional | Back alignment and domain information |
|---|
| >TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >PRK05352 Na(+)-translocating NADH-quinone reductase subunit A; Provisional | Back alignment and domain information |
|---|
| >cd06255 M14_ASTE_ASPA_like_5 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >PF07831 PYNP_C: Pyrimidine nucleoside phosphorylase C-terminal domain; InterPro: IPR013102 This domain is found at the C-terminal end of the large alpha/beta domain making up various pyrimidine nucleoside phosphorylases [, ] | Back alignment and domain information |
|---|
| >KOG3373 consensus Glycine cleavage system H protein (lipoate-binding) [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK15030 multidrug efflux system transporter AcrA; Provisional | Back alignment and domain information |
|---|
| >cd00210 PTS_IIA_glc PTS_IIA, PTS system, glucose/sucrose specific IIA subunit | Back alignment and domain information |
|---|
| >PRK14042 pyruvate carboxylase subunit B; Provisional | Back alignment and domain information |
|---|
| >PF04952 AstE_AspA: Succinylglutamate desuccinylase / Aspartoacylase family; InterPro: IPR007036 This family describes both succinylglutamate desuccinylase that catalyses the fifth and last step in arginine catabolism by the arginine succinyltransferase pathway and also includes aspartoacylase 3 | Back alignment and domain information |
|---|
| >PRK09783 copper/silver efflux system membrane fusion protein CusB; Provisional | Back alignment and domain information |
|---|
| >TIGR02946 acyl_WS_DGAT acyltransferase, WS/DGAT/MGAT | Back alignment and domain information |
|---|
| >TIGR00531 BCCP acetyl-CoA carboxylase, biotin carboxyl carrier protein | Back alignment and domain information |
|---|
| >COG4072 Uncharacterized protein conserved in archaea [Function unknown] | Back alignment and domain information |
|---|
| >PRK06302 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >PRK09439 PTS system glucose-specific transporter subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03794 NHPM_micro_HlyD NHPM bacteriocin system secretion protein | Back alignment and domain information |
|---|
| >TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein | Back alignment and domain information |
|---|
| >PLN02983 biotin carboxyl carrier protein of acetyl-CoA carboxylase | Back alignment and domain information |
|---|
| >PF00358 PTS_EIIA_1: phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 1; InterPro: IPR001127 The phosphoenolpyruvate-dependent sugar phosphotransferase system (PTS) [, ] is a major carbohydrate transport system in bacteria | Back alignment and domain information |
|---|
| >COG4656 RnfC Predicted NADH:ubiquinone oxidoreductase, subunit RnfC [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR00830 PTBA PTS system, glucose subfamily, IIA component | Back alignment and domain information |
|---|
| >COG0845 AcrA Membrane-fusion protein [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PLN02226 2-oxoglutarate dehydrogenase E2 component | Back alignment and domain information |
|---|
| >PF02749 QRPTase_N: Quinolinate phosphoribosyl transferase, N-terminal domain; InterPro: IPR022412 Quinolinate phosphoribosyl transferase (QPRTase) or nicotinate-nucleotide pyrophosphorylase 2 | Back alignment and domain information |
|---|
| >TIGR00164 PS_decarb_rel phosphatidylserine decarboxylase precursor-related protein | Back alignment and domain information |
|---|
| >PRK14040 oxaloacetate decarboxylase; Provisional | Back alignment and domain information |
|---|
| >PF13437 HlyD_3: HlyD family secretion protein | Back alignment and domain information |
|---|
| >PRK05305 phosphatidylserine decarboxylase; Provisional | Back alignment and domain information |
|---|
| >PRK09294 acyltransferase PapA5; Provisional | Back alignment and domain information |
|---|
| >TIGR01108 oadA oxaloacetate decarboxylase alpha subunit | Back alignment and domain information |
|---|
| >PRK09282 pyruvate carboxylase subunit B; Validated | Back alignment and domain information |
|---|
| >COG2190 NagE Phosphotransferase system IIA components [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG1566 EmrA Multidrug resistance efflux pump [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK12784 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd00210 PTS_IIA_glc PTS_IIA, PTS system, glucose/sucrose specific IIA subunit | Back alignment and domain information |
|---|
| >cd06663 Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains are present in biotin-dependent carboxylases/decarboxylases, the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases, and the H-protein of the glycine cleavage system (GCS) | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 479 | ||||
| 3b8k_A | 239 | Structure Of The Truncated Human Dihydrolipoyl Acet | 3e-23 | ||
| 3duf_I | 428 | Snapshots Of Catalysis In The E1 Subunit Of The Pyr | 2e-18 | ||
| 1c4t_A | 233 | Catalytic Domain From Trimeric Dihydrolipoamide Suc | 7e-16 | ||
| 3l60_A | 250 | Crystal Structure Of Branched-Chain Alpha-Keto Acid | 4e-14 | ||
| 2ihw_A | 262 | Crystal Structure Of A Cubic Core Of The Dihydrolip | 2e-12 | ||
| 1b5s_A | 242 | Dihydrolipoyl Transacetylase (E.C.2.3.1.12) Catalyt | 3e-12 | ||
| 1zy8_L | 229 | The Crystal Structure Of Dihydrolipoamide Dehydroge | 2e-11 | ||
| 2dnc_A | 98 | Solution Structure Of Rsgi Ruh-054, A Lipoyl Domain | 7e-11 | ||
| 1y8n_B | 128 | Crystal Structure Of The Pdk3-L2 Complex Length = 1 | 1e-08 | ||
| 1fyc_A | 106 | Inner Lipoyl Domain From Human Pyruvate Dehydrogena | 2e-08 | ||
| 3mae_A | 256 | Crystal Structure Of Probable Dihydrolipamide Acety | 4e-08 | ||
| 3crk_C | 87 | Crystal Structure Of The Pdhk2-L2 Complex. Length = | 8e-08 | ||
| 2dne_A | 108 | Solution Structure Of Rsgi Ruh-058, A Lipoyl Domain | 1e-07 | ||
| 3rqc_A | 224 | Crystal Structure Of The Catalytic Core Of The 2-Ox | 2e-07 | ||
| 2xt6_A | 1113 | Crystal Structure Of Mycobacterium Smegmatis Alpha- | 2e-05 | ||
| 1eaa_A | 243 | Atomic Structure Of The Cubic Core Of The Pyruvate | 6e-05 | ||
| 1dpc_A | 243 | Crystallographic And Enzymatic Investigations On Th | 9e-05 | ||
| 2l5t_A | 77 | Solution Nmr Structure Of E2 Lipoyl Domain From The | 1e-04 | ||
| 1dpd_A | 243 | Crystallographic And Enzymatic Investigations On Th | 1e-04 | ||
| 1ghj_A | 79 | Solution Structure Of The Lipoyl Domain Of The 2- O | 3e-04 | ||
| 1dpb_A | 243 | Crystallographic And Enzymatic Investigations On Th | 9e-04 |
| >pdb|3B8K|A Chain A, Structure Of The Truncated Human Dihydrolipoyl Acetyltransferase (E2) Length = 239 | Back alignment and structure |
|
| >pdb|3DUF|I Chain I, Snapshots Of Catalysis In The E1 Subunit Of The Pyruvate Dehydrogenase Multi-Enzyme Complex Length = 428 | Back alignment and structure |
| >pdb|1C4T|A Chain A, Catalytic Domain From Trimeric Dihydrolipoamide Succinyltransferase Length = 233 | Back alignment and structure |
| >pdb|3L60|A Chain A, Crystal Structure Of Branched-Chain Alpha-Keto Acid Dehydrogenase Subunit E2 From Mycobacterium Tuberculosis Length = 250 | Back alignment and structure |
| >pdb|2IHW|A Chain A, Crystal Structure Of A Cubic Core Of The Dihydrolipoamide Acyltransferase (E2b) Component In The Branched-Chain Alpha-Ketoacid Dehydrogenase Complex (Bckdc), Apo Form Length = 262 | Back alignment and structure |
| >pdb|1B5S|A Chain A, Dihydrolipoyl Transacetylase (E.C.2.3.1.12) Catalytic Domain (Residues 184-425) From Bacillus Stearothermophilus Length = 242 | Back alignment and structure |
| >pdb|2DNC|A Chain A, Solution Structure Of Rsgi Ruh-054, A Lipoyl Domain From Human 2-Oxoacid Dehydrogenase Length = 98 | Back alignment and structure |
| >pdb|1Y8N|B Chain B, Crystal Structure Of The Pdk3-L2 Complex Length = 128 | Back alignment and structure |
| >pdb|1FYC|A Chain A, Inner Lipoyl Domain From Human Pyruvate Dehydrogenase (Pdh) Complex, Nmr, 1 Structure Length = 106 | Back alignment and structure |
| >pdb|3MAE|A Chain A, Crystal Structure Of Probable Dihydrolipamide Acetyltransferase From Listeria Monocytogenes 4b F2365 Length = 256 | Back alignment and structure |
| >pdb|3CRK|C Chain C, Crystal Structure Of The Pdhk2-L2 Complex. Length = 87 | Back alignment and structure |
| >pdb|2DNE|A Chain A, Solution Structure Of Rsgi Ruh-058, A Lipoyl Domain Of Human 2-Oxoacid Dehydrogenase Length = 108 | Back alignment and structure |
| >pdb|3RQC|A Chain A, Crystal Structure Of The Catalytic Core Of The 2-Oxoacid Dehydrogenase Multienzyme Complex From Thermoplasma Acidophilum Length = 224 | Back alignment and structure |
| >pdb|2XT6|A Chain A, Crystal Structure Of Mycobacterium Smegmatis Alpha-Ketoglutarate Decarboxylase Homodimer (Orthorhombic Form) Length = 1113 | Back alignment and structure |
| >pdb|1EAA|A Chain A, Atomic Structure Of The Cubic Core Of The Pyruvate Dehydrogenase Multienzyme Complex Length = 243 | Back alignment and structure |
| >pdb|1DPC|A Chain A, Crystallographic And Enzymatic Investigations On The Role Of Ser558, His610 And Asn614 In The Catalytic Mechanism Of Azotobacter Vinelandii Dihydrolipoamide Acetyltransferase (E2p) Length = 243 | Back alignment and structure |
| >pdb|2L5T|A Chain A, Solution Nmr Structure Of E2 Lipoyl Domain From Thermoplasma Acidophilum Length = 77 | Back alignment and structure |
| >pdb|1DPD|A Chain A, Crystallographic And Enzymatic Investigations On The Role Of Ser558, His610 And Asn614 In The Catalytic Mechanism Of Azotobacter Vinelandii Dihydrolipoamide Acetyltransferase (E2p) Length = 243 | Back alignment and structure |
| >pdb|1GHJ|A Chain A, Solution Structure Of The Lipoyl Domain Of The 2- Oxoglutarate Dehydrogenase Complex From Azotobacter Vineland Ii, Nmr, Minimized Average Structure Length = 79 | Back alignment and structure |
| >pdb|1DPB|A Chain A, Crystallographic And Enzymatic Investigations On The Role Of Ser558, His610 And Asn614 In The Catalytic Mechanism Of Azotobacter Vinelandii Dihydrolipoamide Acetyltransferase (E2p) Length = 243 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 479 | |||
| 3dva_I | 428 | Dihydrolipoyllysine-residue acetyltransferase comp | 2e-89 | |
| 3b8k_A | 239 | PDCE2;, dihydrolipoyllysine-residue acetyltransfer | 5e-71 | |
| 1zy8_K | 229 | Pyruvate dehydrogenase protein X component, mitoch | 9e-59 | |
| 3l60_A | 250 | Branched-chain alpha-keto acid dehydrogenase; stru | 4e-54 | |
| 2ii3_A | 262 | Lipoamide acyltransferase component of branched-C | 3e-52 | |
| 3mae_A | 256 | 2-oxoisovalerate dehydrogenase E2 component, dihyd | 2e-39 | |
| 1dpb_A | 243 | Dihydrolipoyl-transacetylase; dihydrolipoamide ace | 1e-38 | |
| 3rqc_A | 224 | Probable lipoamide acyltransferase; alpha beta fol | 8e-36 | |
| 1q23_A | 219 | Chloramphenicol acetyltransferase; CAT I, trimer, | 5e-31 | |
| 1y8o_B | 128 | Dihydrolipoyllysine-residue acetyltransferase COM | 6e-31 | |
| 3cla_A | 213 | Type III chloramphenicol acetyltransferase; transf | 5e-30 | |
| 2dne_A | 108 | Dihydrolipoyllysine-residue acetyltransferase comp | 2e-29 | |
| 2dnc_A | 98 | Pyruvate dehydrogenase protein X component; lipoic | 5e-28 | |
| 1scz_A | 233 | E2, dihydrolipoamide succinyltransferase; COA-depe | 3e-27 | |
| 3crk_C | 87 | Dihydrolipoyllysine-residue acetyltransferase COM | 3e-24 | |
| 2i9d_A | 217 | Chloramphenicol acetyltransferase; structural geno | 8e-21 | |
| 2xt6_A | 1113 | 2-oxoglutarate decarboxylase; lyase, KDH, KGD; HET | 5e-20 | |
| 1k8m_A | 93 | E2 component of branched-chain ahpha-ketoacid dehy | 1e-15 | |
| 2l5t_A | 77 | Lipoamide acyltransferase; E2 lipoyl domain; NMR { | 4e-15 | |
| 1ghj_A | 79 | E2, E2, the dihydrolipoamide succinyltransferase c | 7e-14 | |
| 1pmr_A | 80 | Dihydrolipoyl succinyltransferase; 2-oxoglutarate | 1e-13 | |
| 1w4i_A | 62 | Pyruvate dehydrogenase E2; transferase, peripheral | 6e-12 | |
| 2coo_A | 70 | Lipoamide acyltransferase component of branched- c | 1e-10 | |
| 2eq8_C | 40 | Pyruvate dehydrogenase complex, dihydrolipoamide a | 3e-10 | |
| 3rnm_E | 58 | Lipoamide acyltransferase component of branched-C | 4e-10 | |
| 2eq7_C | 40 | 2-oxoglutarate dehydrogenase E2 component; protein | 6e-10 | |
| 1bal_A | 51 | Dihydrolipoamide succinyltransferase; glycolysis; | 5e-09 | |
| 2eq9_C | 41 | Pyruvate dehydrogenase complex, dihydrolipoamide a | 1e-08 | |
| 1w85_I | 49 | Dihydrolipoyllysine-residue acetyltransferase comp | 3e-08 | |
| 2kcc_A | 84 | Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, | 7e-08 | |
| 2k7v_A | 85 | Dihydrolipoyllysine-residue acetyltransferase comp | 2e-07 | |
| 2dn8_A | 100 | Acetyl-COA carboxylase 2; biotin required enzyme, | 4e-07 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 6e-06 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 8e-04 | |
| 2f60_K | 64 | Pyruvate dehydrogenase protein X component; protei | 6e-06 | |
| 1iyu_A | 79 | E2P, dihydrolipoamide acetyltransferase component | 1e-05 | |
| 1qjo_A | 80 | Dihydrolipoamide acetyltransferase; lipoyl domain, | 2e-05 | |
| 1gjx_A | 81 | Pyruvate dehydrogenase; oxidoreductase, lipoyl dom | 2e-05 | |
| 2ejm_A | 99 | Methylcrotonoyl-COA carboxylase subunit alpha; bio | 7e-05 | |
| 1z6h_A | 72 | Biotin/lipoyl attachment protein; solution structu | 7e-05 | |
| 3va7_A | 1236 | KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A | 8e-05 |
| >3dva_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; oxidoreductase, multienzyme complex; HET: TPW; 2.35A {Bacillus stearothermophilus} PDB: 3dv0_I* 3duf_I* 1b5s_A 1lab_A 1lac_A 1w3d_A Length = 428 | Back alignment and structure |
|---|
Score = 278 bits (713), Expect = 2e-89
Identities = 109/434 (25%), Positives = 187/434 (43%), Gaps = 25/434 (5%)
Query: 60 EIFMPALSSTMTEGKIVSWIKSEGDVLSKGESVVVVESDKADMDVETFYDGILAAIVVPE 119
E +P + + EG+IV W GD +++ + + V++DKA +++ + G + I+VPE
Sbjct: 4 EFKLPDIGEGIHEGEIVKWFVKPGDEVNEDDVLCEVQNDKAVVEIPSPVKGKVLEILVPE 63
Query: 120 GESAPVGAAIGILAETEAEVAQAKAKAASAGAAAPASHPVTSTPVPAVSPPEPKKVAESA 179
G A VG + L + A S + AE+
Sbjct: 64 GTVATVGQTLITL-DAPGYENMTFKGQEQEEAKKEEKTETVSKEEKVDAVAPNAPAAEAE 122
Query: 180 PSGPRKTVATPYAKKLLKQHKVDINSVVGTGPFGRITPEDVEKAAGIAPSKSVAPSAAPA 239
R+ +A P +K ++ VDI V GTG GR+ ED++ + A + A
Sbjct: 123 AGPNRRVIAMPSVRKYAREKGVDIRLVQGTGKNGRVLKEDIDAFLAGGAKPAPAAAEEKA 182
Query: 240 ALPKPAPAAAPAAPLLPGSTVVPFTTMQAAVSKNMIESLSVPTFRVGYPIIT-------D 292
A PA T + ++ A++K M+ S P +T
Sbjct: 183 APAAAKPATTEGE---FPETREKMSGIRRAIAKAMVHSKHT------APHVTLMDEADVT 233
Query: 293 ALDALYEKVKP----KGV--TMTALLAKAAAMALVQHPVVNASC-KDGKSFTYNANINIA 345
L A +K K KG+ T + KA AL ++PV+N S + + NI
Sbjct: 234 KLVAHRKKFKAIAAEKGIKLTFLPYVVKALVSALREYPVLNTSIDDETEEIIQKHYYNIG 293
Query: 346 VAVAINGGLITPVLQDADKLDLYLLSQKWKELVEKARSKQLQPHEYNSGTFTLSNLGMFG 405
+A + GL+ PV++ AD+ ++ L+Q+ EL EKAR +L P E + T++N+G G
Sbjct: 294 IAADTDRGLLVPVIKHADRKPIFALAQEINELAEKARDGKLTPGEMKGASCTITNIGSAG 353
Query: 406 VDRFDAILPPGQGAIMAVGASKPTVVADADGFFGVKSKMLVNVTADHRIIYGADLAAFLQ 465
F ++ + AI+ +G + DG + ++++ DHR+I GA L
Sbjct: 354 GQWFTPVINHPEVAILGIGRIAEKPIVR-DGEIVAAPMLALSLSFDHRMIDGATAQKALN 412
Query: 466 TFSKIVENPESLTL 479
+++ +PE L +
Sbjct: 413 HIKRLLSDPELLLM 426
|
| >3b8k_A PDCE2;, dihydrolipoyllysine-residue acetyltransferase; central beta-sheet surrounded by five alpha-helices; 8.80A {Homo sapiens} Length = 239 | Back alignment and structure |
|---|
| >3l60_A Branched-chain alpha-keto acid dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.00A {Mycobacterium tuberculosis} Length = 250 | Back alignment and structure |
|---|
| >2ii3_A Lipoamide acyltransferase component of branched-C alpha-keto acid dehydrogenase complex...; cubic core, HOMO trimer, oxidized COA-bound form; HET: CAO; 2.17A {Bos taurus} PDB: 2ihw_A* 2ii4_A* 2ii5_A* Length = 262 | Back alignment and structure |
|---|
| >3mae_A 2-oxoisovalerate dehydrogenase E2 component, dihydrolipamide acetyltransferase; 2-oxoacid dehydrogenases acyltransferase; 2.50A {Listeria monocytogenes} Length = 256 | Back alignment and structure |
|---|
| >1dpb_A Dihydrolipoyl-transacetylase; dihydrolipoamide acetyltransferase; 2.50A {Azotobacter vinelandii} SCOP: c.43.1.1 PDB: 1dpd_A 1eaa_A 1eab_A* 1eac_A* 1ead_A* 1eae_A* 1eaf_A 1dpc_A Length = 243 | Back alignment and structure |
|---|
| >3rqc_A Probable lipoamide acyltransferase; alpha beta fold; 4.01A {Thermoplasma acidophilum dsm 1728} Length = 224 | Back alignment and structure |
|---|
| >1q23_A Chloramphenicol acetyltransferase; CAT I, trimer, fusidic acid; HET: FUA; 2.18A {Escherichia coli} SCOP: c.43.1.1 PDB: 1noc_B 1pd5_A* 3u9b_A 3u9f_A* Length = 219 | Back alignment and structure |
|---|
| >1y8o_B Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex; pyruvate dehydrogenase kinase 3, lipoyl-bearing domain; HET: RED ADP; 2.48A {Homo sapiens} SCOP: b.84.1.1 PDB: 1y8n_B* 1y8p_B* 2pnr_C* 2q8i_B* 1fyc_A Length = 128 | Back alignment and structure |
|---|
| >3cla_A Type III chloramphenicol acetyltransferase; transferase (acyltransferase); HET: CLM; 1.75A {Escherichia coli} SCOP: c.43.1.1 PDB: 1cla_A* 2cla_A 4cla_A* 1cia_A 1qca_A* Length = 213 | Back alignment and structure |
|---|
| >2dne_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; lipoyl domain, lipoic acid, 2-oxoacid dehydrogenase; NMR {Homo sapiens} Length = 108 | Back alignment and structure |
|---|
| >2dnc_A Pyruvate dehydrogenase protein X component; lipoic acid, lipoyl domain, 2-oxoacid dehydrogenase, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 98 | Back alignment and structure |
|---|
| >1scz_A E2, dihydrolipoamide succinyltransferase; COA-dependent acyltransferase, CAT-like, alpha and beta (2 L mixed beta-sheeet of 6 strands; 2.20A {Escherichia coli} SCOP: c.43.1.1 PDB: 1e2o_A 1c4t_A Length = 233 | Back alignment and structure |
|---|
| >3crk_C Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex,...; pyruvate dehydrogenase kinase isozyme 2, glucos metabolism; HET: LA2; 2.30A {Homo sapiens} PDB: 3crl_C* Length = 87 | Back alignment and structure |
|---|
| >2i9d_A Chloramphenicol acetyltransferase; structural genomics, PSI- protein structure initiative, midwest center for structural genomics; 2.30A {Bacteroides thetaiotaomicron} Length = 217 | Back alignment and structure |
|---|
| >2xt6_A 2-oxoglutarate decarboxylase; lyase, KDH, KGD; HET: TPP; 2.74A {Mycobacterium smegmatis} Length = 1113 | Back alignment and structure |
|---|
| >1k8m_A E2 component of branched-chain ahpha-ketoacid dehydrogenase; lipoyl acid bearing, human BCKD, experimental DATA, average structure, transferase; NMR {Homo sapiens} SCOP: b.84.1.1 PDB: 1k8o_A Length = 93 | Back alignment and structure |
|---|
| >2l5t_A Lipoamide acyltransferase; E2 lipoyl domain; NMR {Thermoplasma acidophilum} Length = 77 | Back alignment and structure |
|---|
| >1ghj_A E2, E2, the dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase...; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1ghk_A Length = 79 | Back alignment and structure |
|---|
| >1pmr_A Dihydrolipoyl succinyltransferase; 2-oxoglutarate dehydrogenase, lipoyl domain, complex, glycolysis; NMR {Escherichia coli} SCOP: b.84.1.1 Length = 80 | Back alignment and structure |
|---|
| >1w4i_A Pyruvate dehydrogenase E2; transferase, peripheral-subunit binding domain, ultrafast folding, homologues,; NMR {Pyrobaculum aerophilum} PDB: 1w4j_A 1w4k_A Length = 62 | Back alignment and structure |
|---|
| >2coo_A Lipoamide acyltransferase component of branched- chain alpha-keto acid dehydrogenase...; E3_binding domain; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >2eq8_C Pyruvate dehydrogenase complex, dihydrolipoamide acetyltransferase E2 component; protein-protein complex, oxidoreductase; HET: FAD; 1.94A {Thermus thermophilus} Length = 40 | Back alignment and structure |
|---|
| >3rnm_E Lipoamide acyltransferase component of branched-C alpha-keto acid dehydrogenase complex,...; protein-protein interaction, redox protein; HET: FAD NHE; 2.40A {Homo sapiens} PDB: 1zwv_A Length = 58 | Back alignment and structure |
|---|
| >2eq7_C 2-oxoglutarate dehydrogenase E2 component; protein-protein complex, oxidoreductase; HET: FAD NAD; 1.80A {Thermus thermophilus} Length = 40 | Back alignment and structure |
|---|
| >1bal_A Dihydrolipoamide succinyltransferase; glycolysis; NMR {Escherichia coli} SCOP: a.9.1.1 PDB: 1bbl_A 1w4h_A 2wav_A 2wxc_A 2btg_A 2bth_A 2cyu_A Length = 51 | Back alignment and structure |
|---|
| >2eq9_C Pyruvate dehydrogenase complex, dihydrolipoamide acetyltransferase E2 component; protein-protein complex, oxidoreductase; HET: FAD; 2.09A {Thermus thermophilus} Length = 41 | Back alignment and structure |
|---|
| >1w85_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate; dehydrogenase, multienzyme complex, oxidoreductase; HET: TDP; 2.0A {Geobacillus stearothermophilus} SCOP: a.9.1.1 PDB: 1w88_I* 1w4g_A 1w4e_A 1w4f_A 2pdd_A 2pde_A 1ebd_C* Length = 49 | Back alignment and structure |
|---|
| >2kcc_A Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, BIRA, biotinylation, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase; NMR {Homo sapiens} Length = 84 | Back alignment and structure |
|---|
| >2k7v_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; misfolded dimer, acyltransferase, glycolysis; NMR {Escherichia coli} Length = 85 | Back alignment and structure |
|---|
| >2dn8_A Acetyl-COA carboxylase 2; biotin required enzyme, transcarboxylase, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2f60_K Pyruvate dehydrogenase protein X component; protein-binding protein, E3BD, protein binding; 1.55A {Homo sapiens} PDB: 2f5z_K Length = 64 | Back alignment and structure |
|---|
| >1iyu_A E2P, dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1iyv_A Length = 79 | Back alignment and structure |
|---|
| >1qjo_A Dihydrolipoamide acetyltransferase; lipoyl domain, pyruvate dehydrogenase; NMR {Escherichia coli} SCOP: b.84.1.1 Length = 80 | Back alignment and structure |
|---|
| >1gjx_A Pyruvate dehydrogenase; oxidoreductase, lipoyl domain, dihydrolipoyl dehydrogenase, multienzyme complex, post-translational modification; NMR {Neisseria meningitidis} SCOP: b.84.1.1 Length = 81 | Back alignment and structure |
|---|
| >2ejm_A Methylcrotonoyl-COA carboxylase subunit alpha; biotin-requiring enzyme, biotin, actyl COA carboxylase, fatty acid synthesis, structural genomics; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >1z6h_A Biotin/lipoyl attachment protein; solution structure, biosynthetic protein; HET: BTI; NMR {Bacillus subtilis} PDB: 1z7t_A 2b8f_A 2b8g_A* Length = 72 | Back alignment and structure |
|---|
| >3va7_A KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A {Kluyveromyces lactis} Length = 1236 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 479 | |||
| 3dva_I | 428 | Dihydrolipoyllysine-residue acetyltransferase comp | 100.0 | |
| 3l60_A | 250 | Branched-chain alpha-keto acid dehydrogenase; stru | 100.0 | |
| 2ii3_A | 262 | Lipoamide acyltransferase component of branched-C | 100.0 | |
| 1dpb_A | 243 | Dihydrolipoyl-transacetylase; dihydrolipoamide ace | 100.0 | |
| 1scz_A | 233 | E2, dihydrolipoamide succinyltransferase; COA-depe | 100.0 | |
| 3mae_A | 256 | 2-oxoisovalerate dehydrogenase E2 component, dihyd | 100.0 | |
| 3b8k_A | 239 | PDCE2;, dihydrolipoyllysine-residue acetyltransfer | 100.0 | |
| 3rqc_A | 224 | Probable lipoamide acyltransferase; alpha beta fol | 100.0 | |
| 1q23_A | 219 | Chloramphenicol acetyltransferase; CAT I, trimer, | 100.0 | |
| 3cla_A | 213 | Type III chloramphenicol acetyltransferase; transf | 100.0 | |
| 2xt6_A | 1113 | 2-oxoglutarate decarboxylase; lyase, KDH, KGD; HET | 100.0 | |
| 2i9d_A | 217 | Chloramphenicol acetyltransferase; structural geno | 100.0 | |
| 1zy8_K | 229 | Pyruvate dehydrogenase protein X component, mitoch | 99.97 | |
| 2dne_A | 108 | Dihydrolipoyllysine-residue acetyltransferase comp | 99.8 | |
| 1y8o_B | 128 | Dihydrolipoyllysine-residue acetyltransferase COM | 99.79 | |
| 3crk_C | 87 | Dihydrolipoyllysine-residue acetyltransferase COM | 99.78 | |
| 2dnc_A | 98 | Pyruvate dehydrogenase protein X component; lipoic | 99.77 | |
| 1k8m_A | 93 | E2 component of branched-chain ahpha-ketoacid dehy | 99.76 | |
| 1ghj_A | 79 | E2, E2, the dihydrolipoamide succinyltransferase c | 99.72 | |
| 2l5t_A | 77 | Lipoamide acyltransferase; E2 lipoyl domain; NMR { | 99.67 | |
| 1qjo_A | 80 | Dihydrolipoamide acetyltransferase; lipoyl domain, | 99.67 | |
| 1pmr_A | 80 | Dihydrolipoyl succinyltransferase; 2-oxoglutarate | 99.66 | |
| 1iyu_A | 79 | E2P, dihydrolipoamide acetyltransferase component | 99.64 | |
| 1gjx_A | 81 | Pyruvate dehydrogenase; oxidoreductase, lipoyl dom | 99.61 | |
| 2k7v_A | 85 | Dihydrolipoyllysine-residue acetyltransferase comp | 99.44 | |
| 1z6h_A | 72 | Biotin/lipoyl attachment protein; solution structu | 99.43 | |
| 2kcc_A | 84 | Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, | 99.41 | |
| 2jku_A | 94 | Propionyl-COA carboxylase alpha chain, mitochondri | 99.39 | |
| 2dn8_A | 100 | Acetyl-COA carboxylase 2; biotin required enzyme, | 99.36 | |
| 2d5d_A | 74 | Methylmalonyl-COA decarboxylase gamma chain; bioti | 99.31 | |
| 1bdo_A | 80 | Acetyl-COA carboxylase; BCCPSC, carboxyl transfera | 99.3 | |
| 1dcz_A | 77 | Transcarboxylase 1.3S subunit; antiparallel beta s | 99.29 | |
| 2ejm_A | 99 | Methylcrotonoyl-COA carboxylase subunit alpha; bio | 99.25 | |
| 2eq9_C | 41 | Pyruvate dehydrogenase complex, dihydrolipoamide a | 99.24 | |
| 3rnm_E | 58 | Lipoamide acyltransferase component of branched-C | 99.23 | |
| 3n6r_A | 681 | Propionyl-COA carboxylase, alpha subunit; protein | 99.22 | |
| 2eq7_C | 40 | 2-oxoglutarate dehydrogenase E2 component; protein | 99.2 | |
| 2eq8_C | 40 | Pyruvate dehydrogenase complex, dihydrolipoamide a | 99.2 | |
| 3va7_A | 1236 | KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A | 99.16 | |
| 3hbl_A | 1150 | Pyruvate carboxylase; TIM barrel, ligase; HET: BTI | 99.16 | |
| 1w85_I | 49 | Dihydrolipoyllysine-residue acetyltransferase comp | 99.13 | |
| 3u9t_A | 675 | MCC alpha, methylcrotonyl-COA carboxylase, alpha-s | 99.12 | |
| 1bal_A | 51 | Dihydrolipoamide succinyltransferase; glycolysis; | 99.12 | |
| 2f60_K | 64 | Pyruvate dehydrogenase protein X component; protei | 99.03 | |
| 2coo_A | 70 | Lipoamide acyltransferase component of branched- c | 99.01 | |
| 1w4i_A | 62 | Pyruvate dehydrogenase E2; transferase, peripheral | 99.0 | |
| 1zko_A | 136 | Glycine cleavage system H protein; TM0212, structu | 98.9 | |
| 2k32_A | 116 | A; NMR {Campylobacter jejuni} PDB: 2k33_A* | 98.88 | |
| 3bg3_A | 718 | Pyruvate carboxylase, mitochondrial; TIM barrel, A | 98.86 | |
| 2qf7_A | 1165 | Pyruvate carboxylase protein; multi-domain, multi- | 98.81 | |
| 1onl_A | 128 | Glycine cleavage system H protein; hybrid barrel-s | 98.48 | |
| 3a7l_A | 128 | H-protein, glycine cleavage system H protein; lipo | 98.45 | |
| 1hpc_A | 131 | H protein of the glycine cleavage system; transit | 98.44 | |
| 3ne5_B | 413 | Cation efflux system protein CUSB; transmembrane h | 98.01 | |
| 2f1m_A | 277 | Acriflavine resistance protein A; helical hairpin, | 97.99 | |
| 3lnn_A | 359 | Membrane fusion protein (MFP) heavy metal cation Z | 97.98 | |
| 3fpp_A | 341 | Macrolide-specific efflux protein MACA; hexameric | 97.92 | |
| 3klr_A | 125 | Glycine cleavage system H protein; antiparallel be | 97.9 | |
| 3mxu_A | 143 | Glycine cleavage system H protein; seattle structu | 97.74 | |
| 3tzu_A | 137 | GCVH, glycine cleavage system H protein 1; ssgcid, | 97.7 | |
| 1vf7_A | 369 | Multidrug resistance protein MEXA; alpha hairpin, | 97.7 | |
| 3hgb_A | 155 | Glycine cleavage system H protein; ssgcid, niaid, | 97.43 | |
| 4dk0_A | 369 | Putative MACA; alpha-hairpin, lipoyl, beta-barrel, | 97.18 | |
| 3na6_A | 331 | Succinylglutamate desuccinylase/aspartoacylase; st | 96.73 | |
| 2dn8_A | 100 | Acetyl-COA carboxylase 2; biotin required enzyme, | 96.72 | |
| 3cdx_A | 354 | Succinylglutamatedesuccinylase/aspartoacylase; str | 96.57 | |
| 3fmc_A | 368 | Putative succinylglutamate desuccinylase / aspart; | 96.52 | |
| 1z6h_A | 72 | Biotin/lipoyl attachment protein; solution structu | 96.13 | |
| 1dcz_A | 77 | Transcarboxylase 1.3S subunit; antiparallel beta s | 96.04 | |
| 2d5d_A | 74 | Methylmalonyl-COA decarboxylase gamma chain; bioti | 96.01 | |
| 1f3z_A | 161 | EIIA-GLC, glucose-specific phosphocarrier; phospho | 95.74 | |
| 2k32_A | 116 | A; NMR {Campylobacter jejuni} PDB: 2k33_A* | 95.67 | |
| 2gpr_A | 154 | Glucose-permease IIA component; phosphotransferase | 95.39 | |
| 2kcc_A | 84 | Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, | 95.29 | |
| 1ax3_A | 162 | Iiaglc, glucose permease IIA domain; phosphotransf | 95.11 | |
| 2qj8_A | 332 | MLR6093 protein; structural genomics, joint center | 94.99 | |
| 2f1m_A | 277 | Acriflavine resistance protein A; helical hairpin, | 94.65 | |
| 2ejm_A | 99 | Methylcrotonoyl-COA carboxylase subunit alpha; bio | 94.32 | |
| 2jku_A | 94 | Propionyl-COA carboxylase alpha chain, mitochondri | 94.26 | |
| 1bdo_A | 80 | Acetyl-COA carboxylase; BCCPSC, carboxyl transfera | 94.21 | |
| 2xha_A | 193 | NUSG, transcription antitermination protein NUSG; | 93.64 | |
| 3lnn_A | 359 | Membrane fusion protein (MFP) heavy metal cation Z | 93.54 | |
| 3d4r_A | 169 | Domain of unknown function from the PFAM-B_34464; | 93.5 | |
| 3fpp_A | 341 | Macrolide-specific efflux protein MACA; hexameric | 93.32 | |
| 2l5t_A | 77 | Lipoamide acyltransferase; E2 lipoyl domain; NMR { | 93.0 | |
| 1qjo_A | 80 | Dihydrolipoamide acetyltransferase; lipoyl domain, | 92.84 | |
| 1k8m_A | 93 | E2 component of branched-chain ahpha-ketoacid dehy | 92.43 | |
| 2dnc_A | 98 | Pyruvate dehydrogenase protein X component; lipoic | 92.17 | |
| 2auk_A | 190 | DNA-directed RNA polymerase beta' chain; sandwich- | 91.98 | |
| 1ghj_A | 79 | E2, E2, the dihydrolipoamide succinyltransferase c | 91.86 | |
| 3crk_C | 87 | Dihydrolipoyllysine-residue acetyltransferase COM | 91.84 | |
| 1gjx_A | 81 | Pyruvate dehydrogenase; oxidoreductase, lipoyl dom | 91.75 | |
| 2dne_A | 108 | Dihydrolipoyllysine-residue acetyltransferase comp | 91.75 | |
| 1vf7_A | 369 | Multidrug resistance protein MEXA; alpha hairpin, | 91.64 | |
| 3ne5_B | 413 | Cation efflux system protein CUSB; transmembrane h | 91.46 | |
| 2k7v_A | 85 | Dihydrolipoyllysine-residue acetyltransferase comp | 91.45 | |
| 2xhc_A | 352 | Transcription antitermination protein NUSG; 2.45A | 90.62 | |
| 1y8o_B | 128 | Dihydrolipoyllysine-residue acetyltransferase COM | 90.42 | |
| 4hvm_A | 493 | Tlmii; PSI-biology, midwest center for structural | 90.38 | |
| 2xha_A | 193 | NUSG, transcription antitermination protein NUSG; | 89.57 | |
| 4dk0_A | 369 | Putative MACA; alpha-hairpin, lipoyl, beta-barrel, | 88.21 | |
| 3our_B | 183 | EIIA, phosphotransferase system IIA component; exh | 87.13 | |
| 1iyu_A | 79 | E2P, dihydrolipoamide acetyltransferase component | 86.91 | |
| 1pmr_A | 80 | Dihydrolipoyl succinyltransferase; 2-oxoglutarate | 86.27 | |
| 3fot_A | 519 | 15-O-acetyltransferase; fusarium head blight, tric | 86.1 | |
| 1l5a_A | 436 | Amide synthase, VIBH; nonribosomal peptide synthet | 85.98 | |
| 3n6r_A | 681 | Propionyl-COA carboxylase, alpha subunit; protein | 85.95 | |
| 3va7_A | 1236 | KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A | 81.33 | |
| 3hbl_A | 1150 | Pyruvate carboxylase; TIM barrel, ligase; HET: BTI | 81.31 | |
| 1l5a_A | 436 | Amide synthase, VIBH; nonribosomal peptide synthet | 80.74 | |
| 3bg3_A | 718 | Pyruvate carboxylase, mitochondrial; TIM barrel, A | 80.48 |
| >3dva_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; oxidoreductase, multienzyme complex; HET: TPW; 2.35A {Bacillus stearothermophilus} PDB: 3dv0_I* 3duf_I* 1b5s_A 1lab_A 1lac_A 1w3d_A | Back alignment and structure |
|---|
Probab=100.00 E-value=4e-91 Score=729.41 Aligned_cols=415 Identities=26% Similarity=0.376 Sum_probs=40.1
Q ss_pred eEEEecCCCCCCCceEEEEEEEcCCCCeecCCCeEEEEEecceeeEEEcCCCeEEEEEecCCCCeecCCCeEEEEecChh
Q 011684 58 IREIFMPALSSTMTEGKIVSWIKSEGDVLSKGESVVVVESDKADMDVETFYDGILAAIVVPEGESAPVGAAIGILAETEA 137 (479)
Q Consensus 58 ~~~i~~P~l~~~~~eg~i~~w~v~~Gd~V~~g~~l~~vet~K~~~~v~ap~~G~v~~i~~~~g~~v~~G~~l~~i~~~~~ 137 (479)
.++|+||+||++|+||+|++|+|++||.|++||+||+||+||++++|+||++|+|.++++++|+.|.+|++|+.|+++++
T Consensus 2 ~~~i~mP~lg~~~~eg~i~~w~v~~Gd~V~~gd~l~~vEt~K~~~~i~ap~~G~v~~i~v~~G~~V~~G~~l~~i~~~~~ 81 (428)
T 3dva_I 2 AFEFKLPDIGEGIHEGEIVKWFVKPGDEVNEDDVLCEVQNDKAVVEIPSPVKGKVLEILVPEGTVATVGQTLITLDAPGY 81 (428)
T ss_dssp --------------------------------------------------------------------------------
T ss_pred CeeEEcCCCCCCCccEEEEEEEcCCCCEECCCCEEEEEEeCCeeEEEecCCCeEEEEEEeCCCCEeCCCCEEEEEecCCc
Confidence 36899999999999999999999999999999999999999999999999999999999999999999999999987654
Q ss_pred hHHHHHhhhhccCCCCCCCCCCCCCCCCCCCCCCCCC--CCCCCCCCCCccccChhHHHHHhhcCCCccccccCCCCCcc
Q 011684 138 EVAQAKAKAASAGAAAPASHPVTSTPVPAVSPPEPKK--VAESAPSGPRKTVATPYAKKLLKQHKVDINSVVGTGPFGRI 215 (479)
Q Consensus 138 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~asP~aR~lA~e~gidl~~v~gtG~~GrI 215 (479)
+...............+.+. ..+...+.+.+.+. ........+.++++||+|||||+|+||||++|+|||++|||
T Consensus 82 ~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~~~~~~~~~asP~~R~lA~e~gvdl~~v~gtG~~GrI 158 (428)
T 3dva_I 82 ENMTFKGQEQEEAKKEEKTE---TVSKEEKVDAVAPNAPAAEAEAGPNRRVIAMPSVRKYAREKGVDIRLVQGTGKNGRV 158 (428)
T ss_dssp -------------------------------------------------CCCCCHHHHHHHHHTTCCGGGSCCCSTTSCC
T ss_pred cccccccccccccccCCCcc---cCCccccccCCCccccccccccccccccccCHHHHHHHHHcCCCHHHCCCCCCCCce
Confidence 43211100000000000000 00000000000000 00001112346799999999999999999999999999999
Q ss_pred chhhHHHhhccCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCceeccchhhHHHHHHhhhc-cCccEEEEEEEEeccHH
Q 011684 216 TPEDVEKAAGIAPSKSVAPSAAPAALPKPAPAAAPAAPLLPGSTVVPFTTMQAAVSKNMIES-LSVPTFRVGYPIITDAL 294 (479)
Q Consensus 216 ~~~DV~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~s~~r~~ia~~m~~S-~~vP~~~~~~~iDvt~l 294 (479)
+++||++|+......... .+ +.+. ...+............+++|+++|||+||++|.+| +++|||+++.+||+|+|
T Consensus 159 ~k~DV~~~~~~~~~~~~~-~~-~~~~-~~~~~~~~~~~~~~~~~~~p~s~~Rk~ia~~m~~S~~~~P~~~~~~evDvt~l 235 (428)
T 3dva_I 159 LKEDIDAFLAGGAKPAPA-AA-EEKA-APAAAKPATTEGEFPETREKMSGIRRAIAKAMVHSKHTAPHVTLMDEADVTKL 235 (428)
T ss_dssp CTTTTTTTSCC---------------------------------------------------------------------
T ss_pred eHHHHHHHhhcccccccc-cc-cccc-ccCCCCccccccCCccccccCcHHHHHHHHHHHHhcccCCeEEEEEEEeHHHH
Confidence 999999997643211000 00 0000 00000000000111356899999999999999999 79999999999999999
Q ss_pred HHHHHHhCC------CCCCHHHHHHHHHHHHHhhCccccccccCC-CeeEEcCcccEEEEEEeCCCeEEeEEecCCCCCH
Q 011684 295 DALYEKVKP------KGVTMTALLAKAAAMALVQHPVVNASCKDG-KSFTYNANINIAVAVAINGGLITPVLQDADKLDL 367 (479)
Q Consensus 295 ~~~~~~~k~------~~~s~~~~likAva~Al~~~P~~n~~~~~~-~~i~~~~~i~i~~aV~~~~gl~~pvi~~a~~~sl 367 (479)
+++|+++|+ .++||++||+||+++||++||+||++|+++ ++|++|+++|+|+||++++||++|+|+++++++|
T Consensus 236 ~~~rk~~~~~~~~~g~kls~~~~~ikAva~Al~~~P~~Na~~~~~~~~i~~~~~v~igiAV~t~~GL~vPvi~~a~~~sl 315 (428)
T 3dva_I 236 VAHRKKFKAIAAEKGIKLTFLPYVVKALVSALREYPVLNTSIDDETEEIIQKHYYNIGIAADTDRGLLVPVIKHADRKPI 315 (428)
T ss_dssp --------------------------------------------------------------------------------
T ss_pred HHHHHHhhhhHhhcCCCcCHHHHHHHHHHHHHHhCHHhhheEecCCCeEEEcCccCeEEEEEcCCceEEeeeccCCCCCH
Confidence 999999874 269999999999999999999999999652 6899999999999999999999999999999999
Q ss_pred HHHHHHHHHHHHHHHcCCCCCCCCCCCeEEEeecCCCCccceeecCCCCCceEEEeCcceEEEEEcCCCeEEEEEEEEEE
Q 011684 368 YLLSQKWKELVEKARSKQLQPHEYNSGTFTLSNLGMFGVDRFDAILPPGQGAIMAVGASKPTVVADADGFFGVKSKMLVN 447 (479)
Q Consensus 368 ~ei~~~~~~l~~~ar~~~l~~~d~~~~tftISnlg~~G~~~ftpii~~~~~ail~vG~~~~~~v~~~~G~i~~r~~m~ls 447 (479)
.+|+++++++.+++|+|+|.++|+++|||+|||+||||+++|+||+|+||++||++|+++++|+++ ||++++|++|+|+
T Consensus 316 ~eia~~~~~l~~~ar~gkL~~~e~~ggtftISnlG~~G~~~ftpIin~pq~aIl~vG~i~~~pv~~-~g~i~~r~~m~ls 394 (428)
T 3dva_I 316 FALAQEINELAEKARDGKLTPGEMKGASCTITNIGSAGGQWFTPVINHPEVAILGIGRIAEKPIVR-DGEIVAAPMLALS 394 (428)
T ss_dssp --------------------------------------------------------------------------------
T ss_pred HHHHHHHHHHHHHHHcCCCCccccCCCEEEEEcCCCCCccceEeecCCCCceEEEccccEEEEEEE-CCEEEEeeeEEEE
Confidence 999999999999999999999999999999999999999999999999999999999999999995 8999999999999
Q ss_pred EEecccccchHHHHHHHHHHHHHhcCCccccC
Q 011684 448 VTADHRIIYGADLAAFLQTFSKIVENPESLTL 479 (479)
Q Consensus 448 lt~DHRvvDG~~aa~Fl~~l~~~le~p~~ll~ 479 (479)
|+||||+|||+|+++||++|+++||+|+.||+
T Consensus 395 ls~DHRviDG~~aa~Fl~~lk~~Le~P~~lll 426 (428)
T 3dva_I 395 LSFDHRMIDGATAQKALNHIKRLLSDPELLLM 426 (428)
T ss_dssp --------------------------------
T ss_pred EEecccccchHHHHHHHHHHHHHHhCHHHHhh
Confidence 99999999999999999999999999998875
|
| >3l60_A Branched-chain alpha-keto acid dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: c.43.1.0 | Back alignment and structure |
|---|
| >2ii3_A Lipoamide acyltransferase component of branched-C alpha-keto acid dehydrogenase complex...; cubic core, HOMO trimer, oxidized COA-bound form; HET: CAO; 2.17A {Bos taurus} PDB: 2ihw_A* 2ii4_A* 2ii5_A* | Back alignment and structure |
|---|
| >1dpb_A Dihydrolipoyl-transacetylase; dihydrolipoamide acetyltransferase; 2.50A {Azotobacter vinelandii} SCOP: c.43.1.1 PDB: 1dpd_A 1eaa_A 1eab_A* 1eac_A* 1ead_A* 1eae_A* 1eaf_A 1dpc_A | Back alignment and structure |
|---|
| >1scz_A E2, dihydrolipoamide succinyltransferase; COA-dependent acyltransferase, CAT-like, alpha and beta (2 L mixed beta-sheeet of 6 strands; 2.20A {Escherichia coli} SCOP: c.43.1.1 PDB: 1e2o_A 1c4t_A | Back alignment and structure |
|---|
| >3mae_A 2-oxoisovalerate dehydrogenase E2 component, dihydrolipamide acetyltransferase; 2-oxoacid dehydrogenases acyltransferase; 2.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3b8k_A PDCE2;, dihydrolipoyllysine-residue acetyltransferase; central beta-sheet surrounded by five alpha-helices; 8.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3rqc_A Probable lipoamide acyltransferase; alpha beta fold; 4.01A {Thermoplasma acidophilum dsm 1728} | Back alignment and structure |
|---|
| >1q23_A Chloramphenicol acetyltransferase; CAT I, trimer, fusidic acid; HET: FUA; 2.18A {Escherichia coli} SCOP: c.43.1.1 PDB: 1noc_B 1pd5_A* 3u9b_A 3u9f_A* | Back alignment and structure |
|---|
| >3cla_A Type III chloramphenicol acetyltransferase; transferase (acyltransferase); HET: CLM; 1.75A {Escherichia coli} SCOP: c.43.1.1 PDB: 1cla_A* 2cla_A 4cla_A* 1cia_A 1qca_A* | Back alignment and structure |
|---|
| >2xt6_A 2-oxoglutarate decarboxylase; lyase, KDH, KGD; HET: TPP; 2.74A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >2i9d_A Chloramphenicol acetyltransferase; structural genomics, PSI- protein structure initiative, midwest center for structural genomics; 2.30A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2dne_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; lipoyl domain, lipoic acid, 2-oxoacid dehydrogenase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1y8o_B Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex; pyruvate dehydrogenase kinase 3, lipoyl-bearing domain; HET: RED ADP; 2.48A {Homo sapiens} SCOP: b.84.1.1 PDB: 1y8n_B* 1y8p_B* 2pnr_C* 2q8i_B* 1fyc_A | Back alignment and structure |
|---|
| >3crk_C Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex,...; pyruvate dehydrogenase kinase isozyme 2, glucos metabolism; HET: LA2; 2.30A {Homo sapiens} PDB: 3crl_C* | Back alignment and structure |
|---|
| >2dnc_A Pyruvate dehydrogenase protein X component; lipoic acid, lipoyl domain, 2-oxoacid dehydrogenase, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1k8m_A E2 component of branched-chain ahpha-ketoacid dehydrogenase; lipoyl acid bearing, human BCKD, experimental DATA, average structure, transferase; NMR {Homo sapiens} SCOP: b.84.1.1 PDB: 1k8o_A | Back alignment and structure |
|---|
| >1ghj_A E2, E2, the dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase...; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1ghk_A | Back alignment and structure |
|---|
| >2l5t_A Lipoamide acyltransferase; E2 lipoyl domain; NMR {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >1qjo_A Dihydrolipoamide acetyltransferase; lipoyl domain, pyruvate dehydrogenase; NMR {Escherichia coli} SCOP: b.84.1.1 | Back alignment and structure |
|---|
| >1pmr_A Dihydrolipoyl succinyltransferase; 2-oxoglutarate dehydrogenase, lipoyl domain, complex, glycolysis; NMR {Escherichia coli} SCOP: b.84.1.1 | Back alignment and structure |
|---|
| >1iyu_A E2P, dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1iyv_A | Back alignment and structure |
|---|
| >1gjx_A Pyruvate dehydrogenase; oxidoreductase, lipoyl domain, dihydrolipoyl dehydrogenase, multienzyme complex, post-translational modification; NMR {Neisseria meningitidis} SCOP: b.84.1.1 | Back alignment and structure |
|---|
| >2k7v_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; misfolded dimer, acyltransferase, glycolysis; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >1z6h_A Biotin/lipoyl attachment protein; solution structure, biosynthetic protein; HET: BTI; NMR {Bacillus subtilis} PDB: 1z7t_A 2b8f_A 2b8g_A* | Back alignment and structure |
|---|
| >2kcc_A Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, BIRA, biotinylation, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jku_A Propionyl-COA carboxylase alpha chain, mitochondrial; ligase, biotin, ATP-binding, disease mutation, nucleotide-binding, mitochondrion; HET: PG4; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2dn8_A Acetyl-COA carboxylase 2; biotin required enzyme, transcarboxylase, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d5d_A Methylmalonyl-COA decarboxylase gamma chain; biotin, BCCP, structural genomics, NPPSFA; 1.55A {Pyrococcus horikoshii} PDB: 2ejf_C* 2ejg_C* 2evb_A | Back alignment and structure |
|---|
| >1bdo_A Acetyl-COA carboxylase; BCCPSC, carboxyl transferase, fatty acid biosynthesis, hamme structure, selenomethionine, ligase, transferase; HET: BTN; 1.80A {Escherichia coli} SCOP: b.84.1.1 PDB: 2bdo_A* 1a6x_A 3bdo_A | Back alignment and structure |
|---|
| >1dcz_A Transcarboxylase 1.3S subunit; antiparallel beta sheet, hammerhead, biocytin, transferase; NMR {Propionibacterium freudenreichiisubsp} SCOP: b.84.1.1 PDB: 1dd2_A 1o78_A | Back alignment and structure |
|---|
| >2ejm_A Methylcrotonoyl-COA carboxylase subunit alpha; biotin-requiring enzyme, biotin, actyl COA carboxylase, fatty acid synthesis, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eq9_C Pyruvate dehydrogenase complex, dihydrolipoamide acetyltransferase E2 component; protein-protein complex, oxidoreductase; HET: FAD; 2.09A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3rnm_E Lipoamide acyltransferase component of branched-C alpha-keto acid dehydrogenase complex,...; protein-protein interaction, redox protein; HET: FAD NHE; 2.40A {Homo sapiens} SCOP: a.9.1.0 PDB: 1zwv_A | Back alignment and structure |
|---|
| >3n6r_A Propionyl-COA carboxylase, alpha subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Ruegeria pomeroyi} | Back alignment and structure |
|---|
| >2eq7_C 2-oxoglutarate dehydrogenase E2 component; protein-protein complex, oxidoreductase; HET: FAD NAD; 1.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2eq8_C Pyruvate dehydrogenase complex, dihydrolipoamide acetyltransferase E2 component; protein-protein complex, oxidoreductase; HET: FAD; 1.94A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3va7_A KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A {Kluyveromyces lactis} | Back alignment and structure |
|---|
| >3hbl_A Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 2.71A {Staphylococcus aureus subsp} PDB: 3bg5_A* 3ho8_A* 4hnu_A* 4hnt_A* 4hnv_A* 3hb9_A* | Back alignment and structure |
|---|
| >1w85_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate; dehydrogenase, multienzyme complex, oxidoreductase; HET: TDP; 2.0A {Geobacillus stearothermophilus} SCOP: a.9.1.1 PDB: 1w88_I* 1w4g_A 1w4e_A 1w4f_A 2pdd_A 2pde_A 1ebd_C* | Back alignment and structure |
|---|
| >1bal_A Dihydrolipoamide succinyltransferase; glycolysis; NMR {Escherichia coli} SCOP: a.9.1.1 PDB: 1bbl_A 1w4h_A 2wav_A 2wxc_A 2btg_A 2bth_A 2cyu_A | Back alignment and structure |
|---|
| >2f60_K Pyruvate dehydrogenase protein X component; protein-binding protein, E3BD, protein binding; 1.55A {Homo sapiens} PDB: 2f5z_K | Back alignment and structure |
|---|
| >2coo_A Lipoamide acyltransferase component of branched- chain alpha-keto acid dehydrogenase...; E3_binding domain; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1w4i_A Pyruvate dehydrogenase E2; transferase, peripheral-subunit binding domain, ultrafast folding, homologues,; NMR {Pyrobaculum aerophilum} PDB: 1w4j_A 1w4k_A | Back alignment and structure |
|---|
| >1zko_A Glycine cleavage system H protein; TM0212, structural genomi center for structural genomics, JCSG, protein structure INI PSI; HET: MSE; 1.65A {Thermotoga maritima} PDB: 2ka7_A | Back alignment and structure |
|---|
| >2k32_A A; NMR {Campylobacter jejuni} PDB: 2k33_A* | Back alignment and structure |
|---|
| >3bg3_A Pyruvate carboxylase, mitochondrial; TIM barrel, ATP-binding, biotin, disease mutation, gluconeogenesis, ligase, lipid synthesis, manganese; HET: KCX BTI; 2.80A {Homo sapiens} PDB: 3bg9_A | Back alignment and structure |
|---|
| >2qf7_A Pyruvate carboxylase protein; multi-domain, multi-functional, biotin-dependent, ligase; HET: KCX COA AGS; 2.00A {Rhizobium etli} PDB: 3tw6_A* 3tw7_A* | Back alignment and structure |
|---|
| >1onl_A Glycine cleavage system H protein; hybrid barrel-sandwich structure, structural genomics, riken structural genomics/proteomics initiative; 2.50A {Thermus thermophilus} SCOP: b.84.1.1 | Back alignment and structure |
|---|
| >3a7l_A H-protein, glycine cleavage system H protein; lipoic acid, lipoyl, transport protein; 1.30A {Escherichia coli} PDB: 3a7a_B 3ab9_A* 3a8i_E* 3a8j_E* 3a8k_E* | Back alignment and structure |
|---|
| >1hpc_A H protein of the glycine cleavage system; transit peptide; HET: LPA; 2.00A {Pisum sativum} SCOP: b.84.1.1 PDB: 1dxm_A* 1htp_A* | Back alignment and structure |
|---|
| >3ne5_B Cation efflux system protein CUSB; transmembrane helix, metal transport; 2.90A {Escherichia coli} PDB: 3ooc_A 3opo_A 3ow7_A 4dnt_B 4dop_B 3h9i_A 3h94_A 3h9t_B 3t53_B 3t51_B 3t56_B | Back alignment and structure |
|---|
| >2f1m_A Acriflavine resistance protein A; helical hairpin, lipoyl domain, beta barrel, transport prote; 2.71A {Escherichia coli} | Back alignment and structure |
|---|
| >3lnn_A Membrane fusion protein (MFP) heavy metal cation ZNEB (CZCB-LIKE); structural genomics, PSI-2, protein structure initiative; 2.80A {Cupriavidus metallidurans} | Back alignment and structure |
|---|
| >3fpp_A Macrolide-specific efflux protein MACA; hexameric assembly, membrane fusion protein, drug efflux pump, periplasmic protein; 2.99A {Escherichia coli} | Back alignment and structure |
|---|
| >3klr_A Glycine cleavage system H protein; antiparallel beta sheet, beta sandwich, oxidoreductase; HET: GOL; 0.88A {Bos taurus} SCOP: b.84.1.0 PDB: 2edg_A | Back alignment and structure |
|---|
| >3mxu_A Glycine cleavage system H protein; seattle structural genomics center for infectious disease, S CAT-scratch disease, bacteremia; HET: CIT; 1.80A {Bartonella henselae} | Back alignment and structure |
|---|
| >3tzu_A GCVH, glycine cleavage system H protein 1; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 2.30A {Mycobacterium marinum} | Back alignment and structure |
|---|
| >1vf7_A Multidrug resistance protein MEXA; alpha hairpin, beta barrel, membrane protein; 2.40A {Pseudomonas aeruginosa} SCOP: f.46.1.1 PDB: 2v4d_A 1t5e_A | Back alignment and structure |
|---|
| >3hgb_A Glycine cleavage system H protein; ssgcid, niaid, decode, UW, SBRI, lipoyl; 1.75A {Mycobacterium tuberculosis} PDB: 3ift_A | Back alignment and structure |
|---|
| >4dk0_A Putative MACA; alpha-hairpin, lipoyl, beta-barrel, periplasmic protein, MEM protein; 3.50A {Aggregatibacter actinomycetemcomitans} PDB: 4dk1_A | Back alignment and structure |
|---|
| >3na6_A Succinylglutamate desuccinylase/aspartoacylase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 2.00A {Ruegeria SP} | Back alignment and structure |
|---|
| >2dn8_A Acetyl-COA carboxylase 2; biotin required enzyme, transcarboxylase, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3cdx_A Succinylglutamatedesuccinylase/aspartoacylase; structural genomics, PSI-2, protein structure initiative; 2.10A {Rhodobacter sphaeroides 2} | Back alignment and structure |
|---|
| >3fmc_A Putative succinylglutamate desuccinylase / aspart; S genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 1.80A {Shewanella amazonensis} PDB: 3lwu_A* | Back alignment and structure |
|---|
| >1z6h_A Biotin/lipoyl attachment protein; solution structure, biosynthetic protein; HET: BTI; NMR {Bacillus subtilis} PDB: 1z7t_A 2b8f_A 2b8g_A* | Back alignment and structure |
|---|
| >1dcz_A Transcarboxylase 1.3S subunit; antiparallel beta sheet, hammerhead, biocytin, transferase; NMR {Propionibacterium freudenreichiisubsp} SCOP: b.84.1.1 PDB: 1dd2_A 1o78_A | Back alignment and structure |
|---|
| >2d5d_A Methylmalonyl-COA decarboxylase gamma chain; biotin, BCCP, structural genomics, NPPSFA; 1.55A {Pyrococcus horikoshii} PDB: 2ejf_C* 2ejg_C* 2evb_A | Back alignment and structure |
|---|
| >1f3z_A EIIA-GLC, glucose-specific phosphocarrier; phosphotransferase, signal transduction, sugar transport; 1.98A {Escherichia coli} SCOP: b.84.3.1 PDB: 1f3g_A 1ggr_A 1gla_F 1glb_F* 1glc_F* 1gld_F* 1gle_F* 1o2f_A 2f3g_A | Back alignment and structure |
|---|
| >2k32_A A; NMR {Campylobacter jejuni} PDB: 2k33_A* | Back alignment and structure |
|---|
| >2gpr_A Glucose-permease IIA component; phosphotransferase, enzyme IIA; 2.50A {Mycoplasma capricolum} SCOP: b.84.3.1 | Back alignment and structure |
|---|
| >2kcc_A Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, BIRA, biotinylation, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ax3_A Iiaglc, glucose permease IIA domain; phosphotransferase system, sugar transport, transferase, phosphorylation, transmembrane; NMR {Bacillus subtilis} SCOP: b.84.3.1 PDB: 1gpr_A | Back alignment and structure |
|---|
| >2qj8_A MLR6093 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 2.00A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >2f1m_A Acriflavine resistance protein A; helical hairpin, lipoyl domain, beta barrel, transport prote; 2.71A {Escherichia coli} | Back alignment and structure |
|---|
| >2ejm_A Methylcrotonoyl-COA carboxylase subunit alpha; biotin-requiring enzyme, biotin, actyl COA carboxylase, fatty acid synthesis, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jku_A Propionyl-COA carboxylase alpha chain, mitochondrial; ligase, biotin, ATP-binding, disease mutation, nucleotide-binding, mitochondrion; HET: PG4; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1bdo_A Acetyl-COA carboxylase; BCCPSC, carboxyl transferase, fatty acid biosynthesis, hamme structure, selenomethionine, ligase, transferase; HET: BTN; 1.80A {Escherichia coli} SCOP: b.84.1.1 PDB: 2bdo_A* 1a6x_A 3bdo_A | Back alignment and structure |
|---|
| >2xha_A NUSG, transcription antitermination protein NUSG; 1.91A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3lnn_A Membrane fusion protein (MFP) heavy metal cation ZNEB (CZCB-LIKE); structural genomics, PSI-2, protein structure initiative; 2.80A {Cupriavidus metallidurans} | Back alignment and structure |
|---|
| >3d4r_A Domain of unknown function from the PFAM-B_34464; structural genomics, joint center for structural genomics; HET: MSE; 2.20A {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >3fpp_A Macrolide-specific efflux protein MACA; hexameric assembly, membrane fusion protein, drug efflux pump, periplasmic protein; 2.99A {Escherichia coli} | Back alignment and structure |
|---|
| >2l5t_A Lipoamide acyltransferase; E2 lipoyl domain; NMR {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >1qjo_A Dihydrolipoamide acetyltransferase; lipoyl domain, pyruvate dehydrogenase; NMR {Escherichia coli} SCOP: b.84.1.1 | Back alignment and structure |
|---|
| >1k8m_A E2 component of branched-chain ahpha-ketoacid dehydrogenase; lipoyl acid bearing, human BCKD, experimental DATA, average structure, transferase; NMR {Homo sapiens} SCOP: b.84.1.1 PDB: 1k8o_A | Back alignment and structure |
|---|
| >2dnc_A Pyruvate dehydrogenase protein X component; lipoic acid, lipoyl domain, 2-oxoacid dehydrogenase, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2auk_A DNA-directed RNA polymerase beta' chain; sandwich-barrel hybrid motif, transferase; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >1ghj_A E2, E2, the dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase...; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1ghk_A | Back alignment and structure |
|---|
| >3crk_C Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex,...; pyruvate dehydrogenase kinase isozyme 2, glucos metabolism; HET: LA2; 2.30A {Homo sapiens} PDB: 3crl_C* | Back alignment and structure |
|---|
| >1gjx_A Pyruvate dehydrogenase; oxidoreductase, lipoyl domain, dihydrolipoyl dehydrogenase, multienzyme complex, post-translational modification; NMR {Neisseria meningitidis} SCOP: b.84.1.1 | Back alignment and structure |
|---|
| >2dne_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; lipoyl domain, lipoic acid, 2-oxoacid dehydrogenase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1vf7_A Multidrug resistance protein MEXA; alpha hairpin, beta barrel, membrane protein; 2.40A {Pseudomonas aeruginosa} SCOP: f.46.1.1 PDB: 2v4d_A 1t5e_A | Back alignment and structure |
|---|
| >3ne5_B Cation efflux system protein CUSB; transmembrane helix, metal transport; 2.90A {Escherichia coli} PDB: 3ooc_A 3opo_A 3ow7_A 4dnt_B 4dop_B 3h9i_A 3h94_A 3h9t_B 3t53_B 3t51_B 3t56_B | Back alignment and structure |
|---|
| >2k7v_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; misfolded dimer, acyltransferase, glycolysis; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >2xhc_A Transcription antitermination protein NUSG; 2.45A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1y8o_B Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex; pyruvate dehydrogenase kinase 3, lipoyl-bearing domain; HET: RED ADP; 2.48A {Homo sapiens} SCOP: b.84.1.1 PDB: 1y8n_B* 1y8p_B* 2pnr_C* 2q8i_B* 1fyc_A | Back alignment and structure |
|---|
| >4hvm_A Tlmii; PSI-biology, midwest center for structural genomics, MCSG, N product biosynthesis, natPro; 2.70A {Streptoalloteichus hindustanus} | Back alignment and structure |
|---|
| >2xha_A NUSG, transcription antitermination protein NUSG; 1.91A {Thermotoga maritima} | Back alignment and structure |
|---|
| >4dk0_A Putative MACA; alpha-hairpin, lipoyl, beta-barrel, periplasmic protein, MEM protein; 3.50A {Aggregatibacter actinomycetemcomitans} PDB: 4dk1_A | Back alignment and structure |
|---|
| >3our_B EIIA, phosphotransferase system IIA component; exhibit no hydrolase activity1, lyase-transferase complex; 2.20A {Vibrio vulnificus} SCOP: b.84.3.1 | Back alignment and structure |
|---|
| >1iyu_A E2P, dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1iyv_A | Back alignment and structure |
|---|
| >1pmr_A Dihydrolipoyl succinyltransferase; 2-oxoglutarate dehydrogenase, lipoyl domain, complex, glycolysis; NMR {Escherichia coli} SCOP: b.84.1.1 | Back alignment and structure |
|---|
| >3fot_A 15-O-acetyltransferase; fusarium head blight, trichothecene mycotoxin, deoxynivaleno toxin, fusarium graminearum, coenzyme A; 1.75A {Fusarium sporotrichioides} PDB: 3fp0_A* | Back alignment and structure |
|---|
| >1l5a_A Amide synthase, VIBH; nonribosomal peptide synthetase, NRPS condensation domain, vibriobactin, biosynthetic protein; 2.55A {Vibrio cholerae} SCOP: c.43.1.2 c.43.1.2 | Back alignment and structure |
|---|
| >3n6r_A Propionyl-COA carboxylase, alpha subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Ruegeria pomeroyi} | Back alignment and structure |
|---|
| >3va7_A KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A {Kluyveromyces lactis} | Back alignment and structure |
|---|
| >3hbl_A Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 2.71A {Staphylococcus aureus subsp} PDB: 3bg5_A* 3ho8_A* 4hnu_A* 4hnt_A* 4hnv_A* 3hb9_A* | Back alignment and structure |
|---|
| >1l5a_A Amide synthase, VIBH; nonribosomal peptide synthetase, NRPS condensation domain, vibriobactin, biosynthetic protein; 2.55A {Vibrio cholerae} SCOP: c.43.1.2 c.43.1.2 | Back alignment and structure |
|---|
| >3bg3_A Pyruvate carboxylase, mitochondrial; TIM barrel, ATP-binding, biotin, disease mutation, gluconeogenesis, ligase, lipid synthesis, manganese; HET: KCX BTI; 2.80A {Homo sapiens} PDB: 3bg9_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 479 | ||||
| d1scza_ | 233 | c.43.1.1 (A:) Dihydrolipoamide succinyltransferase | 9e-51 | |
| d1q23a_ | 214 | c.43.1.1 (A:) Chloramphenicol acetyltransferase, C | 9e-42 | |
| d3claa_ | 213 | c.43.1.1 (A:) Chloramphenicol acetyltransferase, C | 3e-41 | |
| d1b5sa_ | 242 | c.43.1.1 (A:) Dihydrolipoamide acetyltransferase { | 6e-39 | |
| d1dpba_ | 243 | c.43.1.1 (A:) Dihydrolipoamide acetyltransferase { | 3e-34 | |
| d1pmra_ | 80 | b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate | 3e-22 | |
| d1y8ob1 | 102 | b.84.1.1 (B:128-229) Lipoyl domain of dihydrolipoa | 7e-22 | |
| d1k8ma_ | 87 | b.84.1.1 (A:) Lipoyl domain of the mitochondrial b | 4e-21 | |
| d1ghja_ | 79 | b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate | 2e-20 | |
| d1laba_ | 80 | b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide ac | 3e-19 | |
| d1gjxa_ | 81 | b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide ac | 6e-14 | |
| d1qjoa_ | 80 | b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide ac | 1e-13 | |
| d1iyua_ | 79 | b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide ac | 9e-13 | |
| d1w85i_ | 42 | a.9.1.1 (I:) E3/E1 binding domain of dihydrolipoyl | 1e-10 | |
| d2cyua1 | 39 | a.9.1.1 (A:2-40) E3-binding domain of dihydrolipoa | 9e-10 | |
| d1dcza_ | 77 | b.84.1.1 (A:) Biotin carboxyl carrier domain of tr | 5e-09 |
| >d1scza_ c.43.1.1 (A:) Dihydrolipoamide succinyltransferase {Escherichia coli [TaxId: 562]} Length = 233 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: CoA-dependent acyltransferases superfamily: CoA-dependent acyltransferases family: CAT-like domain: Dihydrolipoamide succinyltransferase species: Escherichia coli [TaxId: 562]
Score = 170 bits (432), Expect = 9e-51
Identities = 67/231 (29%), Positives = 111/231 (48%), Gaps = 10/231 (4%)
Query: 257 GSTVVPFTTMQAAVSKNMIESL-SVPTFRVGYPIITDALDAL-------YEKVKPKGVTM 308
VP T ++ V++ ++E+ S + + L +EK +
Sbjct: 3 SEKRVPMTRLRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYGEAFEKRHGIRLGF 62
Query: 309 TALLAKAAAMALVQHPVVNASCKDGKSFTYNANINIAVAVAINGGLITPVLQDADKLDLY 368
+ KA AL ++P VNAS DG Y+ ++++AV+ GL+TPVL+D D L +
Sbjct: 63 MSFYVKAVVEALKRYPEVNASI-DGDDVVYHNYFDVSMAVSTPRGLVTPVLRDVDTLGMA 121
Query: 369 LLSQKWKELVEKARSKQLQPHEYNSGTFTLSNLGMFGVDRFDAILPPGQGAIMAVGASKP 428
+ +K KEL K R +L + G FT++N G+FG I+ P Q AI+ + A K
Sbjct: 122 DIEKKIKELAVKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIK- 180
Query: 429 TVVADADGFFGVKSKMLVNVTADHRIIYGADLAAFLQTFSKIVENPESLTL 479
+G + M + ++ DHR+I G + FL T +++E+P L L
Sbjct: 181 DRPMAVNGQVEILPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPTRLLL 231
|
| >d1q23a_ c.43.1.1 (A:) Chloramphenicol acetyltransferase, CAT {Escherichia coli [TaxId: 562]} Length = 214 | Back information, alignment and structure |
|---|
| >d3claa_ c.43.1.1 (A:) Chloramphenicol acetyltransferase, CAT {Escherichia coli [TaxId: 562]} Length = 213 | Back information, alignment and structure |
|---|
| >d1b5sa_ c.43.1.1 (A:) Dihydrolipoamide acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Length = 242 | Back information, alignment and structure |
|---|
| >d1dpba_ c.43.1.1 (A:) Dihydrolipoamide acetyltransferase {Azotobacter vinelandii [TaxId: 354]} Length = 243 | Back information, alignment and structure |
|---|
| >d1pmra_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Escherichia coli [TaxId: 562]} Length = 80 | Back information, alignment and structure |
|---|
| >d1y8ob1 b.84.1.1 (B:128-229) Lipoyl domain of dihydrolipoamide acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d1k8ma_ b.84.1.1 (A:) Lipoyl domain of the mitochondrial branched-chain alpha-ketoacid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 87 | Back information, alignment and structure |
|---|
| >d1ghja_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Azotobacter vinelandii [TaxId: 354]} Length = 79 | Back information, alignment and structure |
|---|
| >d1laba_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Length = 80 | Back information, alignment and structure |
|---|
| >d1gjxa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Neisseria meningitidis [TaxId: 487]} Length = 81 | Back information, alignment and structure |
|---|
| >d1qjoa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Escherichia coli [TaxId: 562]} Length = 80 | Back information, alignment and structure |
|---|
| >d1iyua_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Azotobacter vinelandii [TaxId: 354]} Length = 79 | Back information, alignment and structure |
|---|
| >d1w85i_ a.9.1.1 (I:) E3/E1 binding domain of dihydrolipoyl acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Length = 42 | Back information, alignment and structure |
|---|
| >d2cyua1 a.9.1.1 (A:2-40) E3-binding domain of dihydrolipoamide succinyltransferase {Escherichia coli [TaxId: 562]} Length = 39 | Back information, alignment and structure |
|---|
| >d1dcza_ b.84.1.1 (A:) Biotin carboxyl carrier domain of transcarboxylase (TC 1.3S) {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} Length = 77 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 479 | |||
| d1scza_ | 233 | Dihydrolipoamide succinyltransferase {Escherichia | 100.0 | |
| d1dpba_ | 243 | Dihydrolipoamide acetyltransferase {Azotobacter vi | 100.0 | |
| d1b5sa_ | 242 | Dihydrolipoamide acetyltransferase {Bacillus stear | 100.0 | |
| d1q23a_ | 214 | Chloramphenicol acetyltransferase, CAT {Escherichi | 100.0 | |
| d3claa_ | 213 | Chloramphenicol acetyltransferase, CAT {Escherichi | 100.0 | |
| d1y8ob1 | 102 | Lipoyl domain of dihydrolipoamide acetyltransferas | 99.89 | |
| d1ghja_ | 79 | Lipoyl domain of the 2-oxoglutarate dehydrogenase | 99.87 | |
| d1k8ma_ | 87 | Lipoyl domain of the mitochondrial branched-chain | 99.87 | |
| d1laba_ | 80 | Lipoyl domain of dihydrolipoamide acetyltransferas | 99.85 | |
| d1pmra_ | 80 | Lipoyl domain of the 2-oxoglutarate dehydrogenase | 99.83 | |
| d1qjoa_ | 80 | Lipoyl domain of dihydrolipoamide acetyltransferas | 99.81 | |
| d1gjxa_ | 81 | Lipoyl domain of dihydrolipoamide acetyltransferas | 99.81 | |
| d1iyua_ | 79 | Lipoyl domain of dihydrolipoamide acetyltransferas | 99.79 | |
| d1dcza_ | 77 | Biotin carboxyl carrier domain of transcarboxylase | 99.65 | |
| d1w85i_ | 42 | E3/E1 binding domain of dihydrolipoyl acetyltransf | 99.54 | |
| d1bdoa_ | 80 | Biotinyl domain of acetyl-CoA carboxylase {Escheri | 99.52 | |
| d2cyua1 | 39 | E3-binding domain of dihydrolipoamide succinyltran | 99.47 | |
| d1onla_ | 127 | Protein H of glycine cleavage system {Thermus ther | 97.21 | |
| d1hpca_ | 131 | Protein H of glycine cleavage system {Pea (Pisum s | 97.14 | |
| d1vf7a_ | 237 | Multidrug resistance protein MexA domain {Pseudomo | 96.96 | |
| d1dcza_ | 77 | Biotin carboxyl carrier domain of transcarboxylase | 96.49 | |
| d1bdoa_ | 80 | Biotinyl domain of acetyl-CoA carboxylase {Escheri | 95.5 | |
| d1vf7a_ | 237 | Multidrug resistance protein MexA domain {Pseudomo | 94.91 | |
| d1qjoa_ | 80 | Lipoyl domain of dihydrolipoamide acetyltransferas | 94.67 | |
| d1k8ma_ | 87 | Lipoyl domain of the mitochondrial branched-chain | 94.63 | |
| d1iyua_ | 79 | Lipoyl domain of dihydrolipoamide acetyltransferas | 94.23 | |
| d1ghja_ | 79 | Lipoyl domain of the 2-oxoglutarate dehydrogenase | 93.29 | |
| d1y8ob1 | 102 | Lipoyl domain of dihydrolipoamide acetyltransferas | 92.93 | |
| d1gjxa_ | 81 | Lipoyl domain of dihydrolipoamide acetyltransferas | 92.07 | |
| d1laba_ | 80 | Lipoyl domain of dihydrolipoamide acetyltransferas | 91.49 | |
| d1pmra_ | 80 | Lipoyl domain of the 2-oxoglutarate dehydrogenase | 89.79 | |
| d1brwa3 | 103 | Pyrimidine nucleoside phosphorylase {Bacillus stea | 89.11 | |
| d1l5aa1 | 174 | VibH {Vibrio cholerae [TaxId: 666]} | 88.27 | |
| d2f3ga_ | 150 | Glucose-specific factor III (glsIII) {Escherichia | 88.02 | |
| d1gpra_ | 158 | Glucose permease IIa domain, IIa-glc {Bacillus sub | 87.42 | |
| d2gpra_ | 154 | Glucose permease IIa domain, IIa-glc {Mycoplasma c | 87.06 | |
| d1uoua3 | 105 | Thymidine phosphorylase {Human (Homo sapiens) [Tax | 86.4 | |
| d2gpra_ | 154 | Glucose permease IIa domain, IIa-glc {Mycoplasma c | 85.5 | |
| d1qpoa2 | 115 | Quinolinic acid phosphoribosyltransferase (Nicotin | 84.85 | |
| d2tpta3 | 105 | Thymidine phosphorylase {Escherichia coli [TaxId: | 83.92 | |
| d1uoua3 | 105 | Thymidine phosphorylase {Human (Homo sapiens) [Tax | 82.66 | |
| d1qapa2 | 122 | Quinolinic acid phosphoribosyltransferase (Nicotin | 81.79 | |
| d1gpra_ | 158 | Glucose permease IIa domain, IIa-glc {Bacillus sub | 81.33 | |
| d1brwa3 | 103 | Pyrimidine nucleoside phosphorylase {Bacillus stea | 80.7 |
| >d1scza_ c.43.1.1 (A:) Dihydrolipoamide succinyltransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: CoA-dependent acyltransferases superfamily: CoA-dependent acyltransferases family: CAT-like domain: Dihydrolipoamide succinyltransferase species: Escherichia coli [TaxId: 562]
Probab=100.00 E-value=2.2e-57 Score=435.21 Aligned_cols=220 Identities=30% Similarity=0.447 Sum_probs=211.1
Q ss_pred CceeccchhhHHHHHHhhhc-cCccEEEEEEEEeccHHHHHHHHhCC-------CCCCHHHHHHHHHHHHHhhCcccccc
Q 011684 258 STVVPFTTMQAAVSKNMIES-LSVPTFRVGYPIITDALDALYEKVKP-------KGVTMTALLAKAAAMALVQHPVVNAS 329 (479)
Q Consensus 258 ~~~~p~s~~r~~ia~~m~~S-~~vP~~~~~~~iDvt~l~~~~~~~k~-------~~~s~~~~likAva~Al~~~P~~n~~ 329 (479)
++++|++++||+|+++|.+| +++|||+++.+||+|+|+++|+++++ .++|+++|++||+++||.+||+||++
T Consensus 4 ee~vpls~~rk~ia~~m~~S~~~iP~~~~~~evd~t~l~~~r~~~~~~~~~~~~~klt~~~~likA~a~aL~~~P~~Na~ 83 (233)
T d1scza_ 4 EKRVPMTRLRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYGEAFEKRHGIRLGFMSFYVKAVVEALKRYPEVNAS 83 (233)
T ss_dssp CCCCCCCHHHHHHHHHHHHHHTTSCEEEEEEEEECHHHHHHHHHHHHHHHHHHSSCCCSHHHHHHHHHHHHHHCTTTTCE
T ss_pred CcccCCcHHHHHHHHHHHHHhccCCeEEEEEEEEHHHHHHHHHHHHHhhHhhcCCccCHHHHHHHHHHHHHHhCchhheE
Confidence 56789999999999999999 79999999999999999999987643 27999999999999999999999999
Q ss_pred ccCCCeeEEcCcccEEEEEEeCCCeEEeEEecCCCCCHHHHHHHHHHHHHHHHcCCCCCCCCCCCeEEEeecCCCCccce
Q 011684 330 CKDGKSFTYNANINIAVAVAINGGLITPVLQDADKLDLYLLSQKWKELVEKARSKQLQPHEYNSGTFTLSNLGMFGVDRF 409 (479)
Q Consensus 330 ~~~~~~i~~~~~i~i~~aV~~~~gl~~pvi~~a~~~sl~ei~~~~~~l~~~ar~~~l~~~d~~~~tftISnlg~~G~~~f 409 (479)
|+ ++++++++++|||+||++++||++|||++++++++.||+++++++.+++|+|+|+++|+.||||+|||+|++|+++|
T Consensus 84 ~~-~~~i~~~~~vnIgiAv~~~~GL~vPvI~~a~~~sl~eia~~~~~l~~~ar~~~L~~~d~~ggTfTISNlG~~g~~~~ 162 (233)
T d1scza_ 84 ID-GDDVVYHNYFDVSMAVSTPRGLVTPVLRDVDTLGMADIEKKIKELAVKGRDGKLTVEDLTGGNFTITNGGVFGSLMS 162 (233)
T ss_dssp EE-TTEEECCSSCCEEECEEETTEEECCEETTGGGCCHHHHHHHHHHHHHHTTTTCCCHHHHSCCSEEEEEGGGGTCCCC
T ss_pred Ec-CCeEEEeccceEEEEEEcCCCeEEeEeeccccCCHHHHHHHHHHHHHHhhcCCCCHHHhCCCcEEEEcCccccceee
Confidence 96 56999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred eecCCCCCceEEEeCcceEEEEEcCCCeEEEEEEEEEEEEecccccchHHHHHHHHHHHHHhcCCccccC
Q 011684 410 DAILPPGQGAIMAVGASKPTVVADADGFFGVKSKMLVNVTADHRIIYGADLAAFLQTFSKIVENPESLTL 479 (479)
Q Consensus 410 tpii~~~~~ail~vG~~~~~~v~~~~G~i~~r~~m~lslt~DHRvvDG~~aa~Fl~~l~~~le~p~~ll~ 479 (479)
+||+||||++||++|+++++|++. +|+++++++|+|||+||||++||+++|+||++|+++||||+.||+
T Consensus 163 tpii~ppq~aIl~vG~i~~~pv~~-~g~i~~r~~~~lsls~DHRviDGa~aa~Fl~~l~~~lE~P~~lll 231 (233)
T d1scza_ 163 TPIINPPQSAILGMHAIKDRPMAV-NGQVEILPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPTRLLL 231 (233)
T ss_dssp CCCCCTTCSEEEEEEEEEEEEEEE-TTEEEEEEEEEEEEEEETTTCCHHHHHHHHHHHHHHHHCTTHHHH
T ss_pred eeecCCCCceEEecccceeecccc-CCeEEEEEEeEEEEEhhcchhccHHHHHHHHHHHHHHhCHHHHhh
Confidence 999999999999999999999986 799999999999999999999999999999999999999998874
|
| >d1dpba_ c.43.1.1 (A:) Dihydrolipoamide acetyltransferase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1b5sa_ c.43.1.1 (A:) Dihydrolipoamide acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1q23a_ c.43.1.1 (A:) Chloramphenicol acetyltransferase, CAT {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3claa_ c.43.1.1 (A:) Chloramphenicol acetyltransferase, CAT {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1y8ob1 b.84.1.1 (B:128-229) Lipoyl domain of dihydrolipoamide acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ghja_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1k8ma_ b.84.1.1 (A:) Lipoyl domain of the mitochondrial branched-chain alpha-ketoacid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1laba_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1pmra_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qjoa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gjxa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d1iyua_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1dcza_ b.84.1.1 (A:) Biotin carboxyl carrier domain of transcarboxylase (TC 1.3S) {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} | Back information, alignment and structure |
|---|
| >d1w85i_ a.9.1.1 (I:) E3/E1 binding domain of dihydrolipoyl acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1bdoa_ b.84.1.1 (A:) Biotinyl domain of acetyl-CoA carboxylase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2cyua1 a.9.1.1 (A:2-40) E3-binding domain of dihydrolipoamide succinyltransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1onla_ b.84.1.1 (A:) Protein H of glycine cleavage system {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1hpca_ b.84.1.1 (A:) Protein H of glycine cleavage system {Pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1vf7a_ f.46.1.1 (A:) Multidrug resistance protein MexA domain {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1dcza_ b.84.1.1 (A:) Biotin carboxyl carrier domain of transcarboxylase (TC 1.3S) {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} | Back information, alignment and structure |
|---|
| >d1bdoa_ b.84.1.1 (A:) Biotinyl domain of acetyl-CoA carboxylase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vf7a_ f.46.1.1 (A:) Multidrug resistance protein MexA domain {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1qjoa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1k8ma_ b.84.1.1 (A:) Lipoyl domain of the mitochondrial branched-chain alpha-ketoacid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iyua_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1ghja_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1y8ob1 b.84.1.1 (B:128-229) Lipoyl domain of dihydrolipoamide acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gjxa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d1laba_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1pmra_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1brwa3 d.41.3.1 (A:331-433) Pyrimidine nucleoside phosphorylase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1l5aa1 c.43.1.2 (A:1-174) VibH {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d2f3ga_ b.84.3.1 (A:) Glucose-specific factor III (glsIII) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gpra_ b.84.3.1 (A:) Glucose permease IIa domain, IIa-glc {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2gpra_ b.84.3.1 (A:) Glucose permease IIa domain, IIa-glc {Mycoplasma capricolum [TaxId: 2095]} | Back information, alignment and structure |
|---|
| >d1uoua3 d.41.3.1 (A:374-480) Thymidine phosphorylase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gpra_ b.84.3.1 (A:) Glucose permease IIa domain, IIa-glc {Mycoplasma capricolum [TaxId: 2095]} | Back information, alignment and structure |
|---|
| >d1qpoa2 d.41.2.1 (A:2-116) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2tpta3 d.41.3.1 (A:336-440) Thymidine phosphorylase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1uoua3 d.41.3.1 (A:374-480) Thymidine phosphorylase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qapa2 d.41.2.1 (A:8-129) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), N-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1gpra_ b.84.3.1 (A:) Glucose permease IIa domain, IIa-glc {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1brwa3 d.41.3.1 (A:331-433) Pyrimidine nucleoside phosphorylase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|