Citrus Sinensis ID: 011751
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 478 | 2.2.26 [Sep-21-2011] | |||||||
| A2A4P0 | 1244 | ATP-dependent RNA helicas | yes | no | 0.897 | 0.344 | 0.5 | 1e-129 | |
| O42643 | 1168 | Pre-mRNA-splicing factor | yes | no | 0.895 | 0.366 | 0.506 | 1e-129 | |
| Q14562 | 1220 | ATP-dependent RNA helicas | yes | no | 0.897 | 0.351 | 0.5 | 1e-129 | |
| Q03319 | 719 | Probable ATP-dependent RN | no | no | 0.903 | 0.600 | 0.479 | 1e-126 | |
| Q09530 | 1200 | Probable pre-mRNA-splicin | yes | no | 0.897 | 0.357 | 0.508 | 1e-126 | |
| Q54F05 | 1160 | ATP-dependent RNA helicas | no | no | 0.897 | 0.369 | 0.489 | 1e-125 | |
| Q38953 | 1168 | Probable pre-mRNA-splicin | no | no | 0.897 | 0.367 | 0.487 | 1e-123 | |
| O45244 | 1008 | Probable pre-mRNA-splicin | no | no | 0.907 | 0.430 | 0.478 | 1e-122 | |
| Q54MH3 | 1106 | Putative pre-mRNA-splicin | no | no | 0.897 | 0.387 | 0.475 | 1e-122 | |
| Q80VY9 | 698 | Putative ATP-dependent RN | no | no | 0.914 | 0.626 | 0.465 | 1e-120 |
| >sp|A2A4P0|DHX8_MOUSE ATP-dependent RNA helicase DHX8 OS=Mus musculus GN=Dhx8 PE=2 SV=1 | Back alignment and function desciption |
|---|
Score = 462 bits (1189), Expect = e-129, Method: Compositional matrix adjust.
Identities = 241/482 (50%), Positives = 326/482 (67%), Gaps = 53/482 (10%)
Query: 6 ILQQRKSLPIASVEKRLVEEVRKNDILIIVGETGSGKTTQLPQFLFHAGFCRDGKLIGVT 65
IL+QR+SLPI ++++LV+ V N ILI++GETGSGKTTQ+ Q+L AG+ GK IG T
Sbjct: 582 ILEQRESLPIYKLKEQLVQAVHDNQILIVIGETGSGKTTQITQYLAEAGYTSRGK-IGCT 640
Query: 66 QPRRVAAVTVAKRVAEESGVELGQRVGYSIRFDDRTSTSTRIK---------EALLDPYL 116
QPRRVAA++VAKRV+EE G LGQ VGY+IRF+D TS T IK E L+DP L
Sbjct: 641 QPRRVAAMSVAKRVSEEFGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDPDL 700
Query: 117 SRYSAIIVDEAHERTVHTDVLLGLLKKVQNARSKSADGHSNGNNNNENSDMILDRGNDTN 176
++Y+ I++DEAHERT+HTDVL GLLKK R
Sbjct: 701 TQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRQD-------------------------- 734
Query: 177 GINTLKQCQGRKFAPLKLIIMSASLDARGFSEYFGCAKAVHVQGRQFPVEILYTLYPEPD 236
+KLI+ SA+LDA FS+YF A + GR +PVEILYT PE D
Sbjct: 735 ---------------MKLIVTSATLDAVKFSQYFYEAPIFTIPGRTYPVEILYTKEPETD 779
Query: 237 YLDATLITIFQVHLDEAPGDILVFLTGQEEIESVERLVQERLLQLPEASRKLVTVPIFSS 296
YLDA+LIT+ Q+HL E PGDILVFLTGQEEI++ ++ ER+ L +L+ +P++S+
Sbjct: 780 YLDASLITVMQIHLTEPPGDILVFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSA 839
Query: 297 LPSEQQMRVFAPAAAGFRKVILATNIAETSVTIPGIKYVIDPGFVKARLYDPVKGMESLL 356
LPSE Q R+F PA G RKV++ATNIAETS+TI GI YV+DPGFVK ++Y+ G++ L+
Sbjct: 840 LPSEMQTRIFDPAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLV 899
Query: 357 VVPISKAQALQRSGRAGREGPGKCFRLYPENEF-DKLEDSTKPEIKRCNLSNVILQLKAL 415
V PIS+AQA QR+GRAGR GPGKC+RLY E + D++ + PEI+R NL++ +L LKA+
Sbjct: 900 VTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAM 959
Query: 416 GVDDIIGFDFMEKPSRASIIKSLEQLFLLGALTDDCKLSDPVGHQMARLPLDPIYSKALI 475
G++D++ FDFM+ P ++I ++EQL+ LGAL D+ L+ +G +MA PL+P+ K LI
Sbjct: 960 GINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGLLTR-LGRRMAEFPLEPMLCKMLI 1018
Query: 476 VA 477
++
Sbjct: 1019 MS 1020
|
Facilitates nuclear export of spliced mRNA by releasing the RNA from the spliceosome. Mus musculus (taxid: 10090) EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 3 |
| >sp|O42643|PRP22_SCHPO Pre-mRNA-splicing factor ATP-dependent RNA helicase prp22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp22 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q14562|DHX8_HUMAN ATP-dependent RNA helicase DHX8 OS=Homo sapiens GN=DHX8 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q03319|PRH1_SCHPO Probable ATP-dependent RNA helicase prh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prh1 PE=3 SV=2 | Back alignment and function description |
|---|
| >sp|Q09530|MOG5_CAEEL Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-5 OS=Caenorhabditis elegans GN=mog-5 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q54F05|DHX8_DICDI ATP-dependent RNA helicase dhx8 OS=Dictyostelium discoideum GN=dhx8 PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q38953|DHX8_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase OS=Arabidopsis thaliana GN=At3g26560 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|O45244|DHX16_CAEEL Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-4 OS=Caenorhabditis elegans GN=mog-4 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q54MH3|DHX16_DICDI Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 OS=Dictyostelium discoideum GN=dhx16 PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q80VY9|DHX33_MOUSE Putative ATP-dependent RNA helicase DHX33 OS=Mus musculus GN=Dhx33 PE=1 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 478 | ||||||
| 356498004 | 705 | PREDICTED: ATP-dependent RNA helicase DH | 0.991 | 0.672 | 0.787 | 0.0 | |
| 356502628 | 705 | PREDICTED: ATP-dependent RNA helicase DH | 0.991 | 0.672 | 0.787 | 0.0 | |
| 359473112 | 713 | PREDICTED: putative ATP-dependent RNA he | 0.993 | 0.666 | 0.780 | 0.0 | |
| 255542006 | 690 | ATP-dependent RNA helicase, putative [Ri | 0.941 | 0.652 | 0.785 | 0.0 | |
| 224098988 | 658 | predicted protein [Populus trichocarpa] | 0.924 | 0.671 | 0.774 | 0.0 | |
| 296081370 | 1408 | unnamed protein product [Vitis vinifera] | 0.920 | 0.312 | 0.756 | 0.0 | |
| 42562325 | 717 | helicase associated domain-containing pr | 0.989 | 0.659 | 0.746 | 0.0 | |
| 326533114 | 697 | predicted protein [Hordeum vulgare subsp | 0.972 | 0.667 | 0.745 | 0.0 | |
| 226502510 | 692 | ATP-dependent RNA helicase DHX8 [Zea may | 0.964 | 0.666 | 0.735 | 0.0 | |
| 51090786 | 698 | putative RNA helicase [Oryza sativa Japo | 0.956 | 0.654 | 0.747 | 0.0 |
| >gi|356498004|ref|XP_003517845.1| PREDICTED: ATP-dependent RNA helicase DHX8-like [Glycine max] | Back alignment and taxonomy information |
|---|
Score = 773 bits (1997), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 381/484 (78%), Positives = 428/484 (88%), Gaps = 10/484 (2%)
Query: 3 RQKILQQRKSLPIASVEKRLVEEVRKNDILIIVGETGSGKTTQLPQFLFHAGFCRDGKLI 62
RQKI+QQRKSLPIA VEKRLVEEVRK+D+LIIVGETGSGKTTQ+PQFLF AGFC DG++I
Sbjct: 20 RQKIIQQRKSLPIAPVEKRLVEEVRKHDVLIIVGETGSGKTTQIPQFLFDAGFCCDGRVI 79
Query: 63 GVTQPRRVAAVTVAKRVAEESGVELGQRVGYSIRFDDRTSTSTRIK---------EALLD 113
G+TQPRRVAAVTVAKRVAEE GVELGQ+VGYS+RFDD TS TRIK EALLD
Sbjct: 80 GITQPRRVAAVTVAKRVAEECGVELGQKVGYSVRFDDATSGLTRIKYMTDGLLLREALLD 139
Query: 114 PYLSRYSAIIVDEAHERTVHTDVLLGLLKKVQNARSKSADGHSNGNNNNENSDMILDRGN 173
PYLS+YS IIVDEAHERTVHTDVL+GLLK VQ ARS S G N N+N + + ++ N
Sbjct: 140 PYLSKYSVIIVDEAHERTVHTDVLMGLLKSVQLARSSSVSGGQGLNFGNKNMNKLFEKEN 199
Query: 174 DTNGINTLKQCQGRKFAPLKLIIMSASLDARGFSEYFGCAKAVHVQGRQFPVEILYTLYP 233
D +GI LK+ + K+APLKLIIMSASLDAR FSEYFG AKAVH+QGRQFPV+I YT
Sbjct: 200 DQSGI-FLKKPRHEKYAPLKLIIMSASLDARAFSEYFGGAKAVHIQGRQFPVDIFYTRDA 258
Query: 234 EPDYLDATLITIFQVHLDEAPGDILVFLTGQEEIESVERLVQERLLQLPEASRKLVTVPI 293
E DYLDA+LITIFQ+HL+E PGDILVFLTGQEEIESVERL+ E+L QLP+ S+KL+ VPI
Sbjct: 259 ETDYLDASLITIFQIHLEEGPGDILVFLTGQEEIESVERLISEKLPQLPQESQKLLVVPI 318
Query: 294 FSSLPSEQQMRVFAPAAAGFRKVILATNIAETSVTIPGIKYVIDPGFVKARLYDPVKGME 353
F++LPSEQQMRVFAP+ +GFRKVILATNIAETSVTIPGIKYVIDPGFVKAR YDP KGME
Sbjct: 319 FAALPSEQQMRVFAPSPSGFRKVILATNIAETSVTIPGIKYVIDPGFVKARSYDPGKGME 378
Query: 354 SLLVVPISKAQALQRSGRAGREGPGKCFRLYPENEFDKLEDSTKPEIKRCNLSNVILQLK 413
SL+++P SK+QALQRSGRAGREGPGKCFRLYPE EF+KLEDST PEIKRCNLSNVILQLK
Sbjct: 379 SLIIIPTSKSQALQRSGRAGREGPGKCFRLYPEREFEKLEDSTMPEIKRCNLSNVILQLK 438
Query: 414 ALGVDDIIGFDFMEKPSRASIIKSLEQLFLLGALTDDCKLSDPVGHQMARLPLDPIYSKA 473
ALGVDDI+GFDF++KPSRA+IIKSLEQLFLLGALTD+C+LSDPVGHQMARLPLDP+YSKA
Sbjct: 439 ALGVDDILGFDFIDKPSRAAIIKSLEQLFLLGALTDECQLSDPVGHQMARLPLDPLYSKA 498
Query: 474 LIVA 477
LI+A
Sbjct: 499 LILA 502
|
Source: Glycine max Species: Glycine max Genus: Glycine Family: Fabaceae Order: Fabales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|356502628|ref|XP_003520120.1| PREDICTED: ATP-dependent RNA helicase DHX8 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|359473112|ref|XP_002282341.2| PREDICTED: putative ATP-dependent RNA helicase DHX33-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255542006|ref|XP_002512067.1| ATP-dependent RNA helicase, putative [Ricinus communis] gi|223549247|gb|EEF50736.1| ATP-dependent RNA helicase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224098988|ref|XP_002311345.1| predicted protein [Populus trichocarpa] gi|222851165|gb|EEE88712.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|296081370|emb|CBI16803.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|42562325|ref|NP_173961.3| helicase associated domain-containing protein [Arabidopsis thaliana] gi|332192562|gb|AEE30683.1| helicase associated domain-containing protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|326533114|dbj|BAJ93529.1| predicted protein [Hordeum vulgare subsp. vulgare] | Back alignment and taxonomy information |
|---|
| >gi|226502510|ref|NP_001147775.1| ATP-dependent RNA helicase DHX8 [Zea mays] gi|195613710|gb|ACG28685.1| ATP-dependent RNA helicase DHX8 [Zea mays] gi|413951431|gb|AFW84080.1| ATP-dependent RNA helicase DHX8 [Zea mays] | Back alignment and taxonomy information |
|---|
| >gi|51090786|dbj|BAD35264.1| putative RNA helicase [Oryza sativa Japonica Group] gi|51091123|dbj|BAD35820.1| putative RNA helicase [Oryza sativa Japonica Group] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 478 | ||||||
| TAIR|locus:2197965 | 717 | AT1G26370 [Arabidopsis thalian | 0.983 | 0.655 | 0.717 | 2.1e-178 | |
| DICTYBASE|DDB_G0270110 | 730 | dhx33 "DEAD/DEAH box helicase" | 0.615 | 0.402 | 0.550 | 1.6e-117 | |
| UNIPROTKB|F5H658 | 1181 | DHX8 "ATP-dependent RNA helica | 0.606 | 0.245 | 0.523 | 7.7e-113 | |
| POMBASE|SPAC10F6.02c | 1168 | prp22 "ATP-dependent RNA helic | 0.596 | 0.244 | 0.543 | 9.4e-113 | |
| RGD|1310723 | 1210 | Dhx8 "DEAH (Asp-Glu-Ala-His) b | 0.606 | 0.239 | 0.523 | 1.2e-112 | |
| UNIPROTKB|Q14562 | 1220 | DHX8 "ATP-dependent RNA helica | 0.606 | 0.237 | 0.523 | 1.4e-112 | |
| UNIPROTKB|D4A805 | 1242 | Dhx8 "Protein Dhx8" [Rattus no | 0.606 | 0.233 | 0.523 | 1.8e-112 | |
| MGI|MGI:1306823 | 1244 | Dhx8 "DEAH (Asp-Glu-Ala-His) b | 0.606 | 0.233 | 0.523 | 1.8e-112 | |
| ZFIN|ZDB-GENE-050809-39 | 1210 | dhx8 "DEAH (Asp-Glu-Ala-His) b | 0.606 | 0.239 | 0.520 | 1.9e-112 | |
| UNIPROTKB|F1S1H3 | 1212 | DHX8 "Uncharacterized protein" | 0.606 | 0.239 | 0.523 | 2e-112 |
| TAIR|locus:2197965 AT1G26370 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1732 (614.8 bits), Expect = 2.1e-178, P = 2.1e-178
Identities = 351/489 (71%), Positives = 400/489 (81%)
Query: 3 RQKILQQRKSLPIASVEKRLVEEVRKNDILIIVGETGSGKTTQLPQFLFHAGFCRDGKLI 62
RQKI + R+SLPIASVEKRLVEEV+KNDILIIVGETGSGKTTQLPQFL++AGFCR+GK+I
Sbjct: 31 RQKIAEHRRSLPIASVEKRLVEEVQKNDILIIVGETGSGKTTQLPQFLYNAGFCREGKMI 90
Query: 63 GVTQPXXXXXXXXXXXXXEESGVELGQRVGYSIRFDDRTSTSTRIK---------EALLD 113
G+TQP EE V+LGQ+VGYSIRFDD TS STR+K EALLD
Sbjct: 91 GITQPRRIAAVTVAKRVAEECEVQLGQKVGYSIRFDDTTSGSTRLKYMTDGLLLREALLD 150
Query: 114 PYLSRYSAIIVDEAHERTVHTDVLLGLLKKVQNARS-----KSADGHSXXXXXXXXSDMI 168
P+LSRYS IIVDEAH+R+VHTDVLL LLKK+Q RS K+ G+ D
Sbjct: 151 PHLSRYSVIIVDEAHDRSVHTDVLLALLKKIQRTRSQPVSEKTEFGNVASQVQTTTRDA- 209
Query: 169 LDRGNDTNGINTLKQCQGRKFAPLKLIIMSASLDARGFSEYFGCAKAVHVQGRQFPVEIL 228
G NG+ LK QGRK +PLKLIIMSASLDAR FSEYFG AKAVHVQGRQFPV+IL
Sbjct: 210 --NGPQQNGV--LKGYQGRKLSPLKLIIMSASLDARVFSEYFGGAKAVHVQGRQFPVDIL 265
Query: 229 YTLYPEPDYLDATLITIFQVHLDEAPGDILVFLTGQEEIESVERLVQERLLQLPEASRKL 288
YT++PE DY+DATL+TIFQ+H +E PGDILVFLTGQ+EIESVERLVQERL +PE RKL
Sbjct: 266 YTVHPESDYVDATLVTIFQIHFEEKPGDILVFLTGQDEIESVERLVQERLQNIPEDKRKL 325
Query: 289 VTVPIFSSLPSEQQMRVFAPAAAGFRKVILATNIAETSVTIPGIKYVIDPGFVKARLYDP 348
+ + IFS+LPSEQQM+VFAPA GFRKVILATNIAETS+TIPGI+YVIDPGFVKAR YDP
Sbjct: 326 LPLAIFSALPSEQQMKVFAPAPTGFRKVILATNIAETSITIPGIRYVIDPGFVKARSYDP 385
Query: 349 VKGMESLLVVPISKAQALQRSGRAGREGPGKCFRLYPENEFDKLEDSTKPEIKRCNLSNV 408
KGMESL VVP SKAQ LQRSGRAGREGPGK FRLYPE EF+KLEDSTKPEIKRCNLSN+
Sbjct: 386 SKGMESLDVVPASKAQTLQRSGRAGREGPGKSFRLYPEREFEKLEDSTKPEIKRCNLSNI 445
Query: 409 ILQLKALGVDDIIGFDFMEKPSRASIIKSLEQLFLLGALTDDCKLSDPVGHQMARLPLDP 468
ILQLKALG+DDI+GFDF++KPSR +IIK+L +L LGAL DD KL +PVG+QM+RLPL+P
Sbjct: 446 ILQLKALGIDDIVGFDFIDKPSRGAIIKALAELHSLGALADDGKLENPVGYQMSRLPLEP 505
Query: 469 IYSKALIVA 477
+YSKALI+A
Sbjct: 506 VYSKALILA 514
|
|
| DICTYBASE|DDB_G0270110 dhx33 "DEAD/DEAH box helicase" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F5H658 DHX8 "ATP-dependent RNA helicase DHX8" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| POMBASE|SPAC10F6.02c prp22 "ATP-dependent RNA helicase Prp22" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
| RGD|1310723 Dhx8 "DEAH (Asp-Glu-Ala-His) box polypeptide 8" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q14562 DHX8 "ATP-dependent RNA helicase DHX8" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|D4A805 Dhx8 "Protein Dhx8" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1306823 Dhx8 "DEAH (Asp-Glu-Ala-His) box polypeptide 8" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-050809-39 dhx8 "DEAH (Asp-Glu-Ala-His) box polypeptide 8" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1S1H3 DHX8 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 3rd Layer | 3.6.4 | LOW CONFIDENCE prediction! |
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
 |
 |
 |
 |
 |
 |
 |
 |
 |
 | gw1.VIII.2834.1 | hypothetical protein (658 aa) | ||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 478 | |||
| COG1643 | 845 | COG1643, HrpA, HrpA-like helicases [DNA replicatio | 0.0 | |
| TIGR01967 | 1283 | TIGR01967, DEAH_box_HrpA, ATP-dependent helicase H | 1e-106 | |
| PRK11131 | 1294 | PRK11131, PRK11131, ATP-dependent RNA helicase Hrp | 1e-100 | |
| TIGR01970 | 819 | TIGR01970, DEAH_box_HrpB, ATP-dependent helicase H | 7e-85 | |
| PRK11664 | 812 | PRK11664, PRK11664, ATP-dependent RNA helicase Hrp | 3e-81 | |
| cd00046 | 144 | cd00046, DEXDc, DEAD-like helicases superfamily | 3e-20 | |
| cd00079 | 131 | cd00079, HELICc, Helicase superfamily c-terminal d | 8e-15 | |
| smart00487 | 201 | smart00487, DEXDc, DEAD-like helicases superfamily | 1e-14 | |
| smart00490 | 82 | smart00490, HELICc, helicase superfamily c-termina | 3e-13 | |
| pfam00271 | 78 | pfam00271, Helicase_C, Helicase conserved C-termin | 6e-12 | |
| pfam04408 | 91 | pfam04408, HA2, Helicase associated domain (HA2) | 4e-09 | |
| smart00847 | 82 | smart00847, HA2, Helicase associated domain (HA2) | 3e-06 | |
| PHA02653 | 675 | PHA02653, PHA02653, RNA helicase NPH-II; Provision | 5e-06 | |
| COG1111 | 542 | COG1111, MPH1, ERCC4-like helicases [DNA replicati | 0.002 |
| >gnl|CDD|224557 COG1643, HrpA, HrpA-like helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
Score = 544 bits (1405), Expect = 0.0
Identities = 226/486 (46%), Positives = 292/486 (60%), Gaps = 58/486 (11%)
Query: 3 RQKILQQRKSLPIASVEKRLVEEVRKNDILIIVGETGSGKTTQLPQFLFHAGFCRDGKLI 62
IL+ R LP+ +V +++ + +N ++IIVGETGSGKTTQLPQFL G GK I
Sbjct: 39 VPDILEYRSGLPVTAVRDEILKAIEQNQVVIIVGETGSGKTTQLPQFLLEEGLGIAGK-I 97
Query: 63 GVTQPRRVAAVTVAKRVAEESGVELGQRVGYSIRFDDRTSTSTRIK---------EALLD 113
G TQPRR+AA +VA+RVAEE G +LG+ VGYSIRF+ + S TRIK E D
Sbjct: 98 GCTQPRRLAARSVAERVAEELGEKLGETVGYSIRFESKVSPRTRIKVMTDGILLREIQND 157
Query: 114 PYLSRYSAIIVDEAHERTVHTDVLLGLLKKVQNARSKSADGHSNGNNNNENSDMILDRGN 173
P LS YS +I+DEAHER+++TD+LLGLLK + R
Sbjct: 158 PLLSGYSVVIIDEAHERSLNTDILLGLLKDLLARRR------------------------ 193
Query: 174 DTNGINTLKQCQGRKFAPLKLIIMSASLDARGFSEYFGCAKAVHVQGRQFPVEILYTLYP 233
LKLIIMSA+LDA FS YFG A + ++GR +PVEI Y
Sbjct: 194 ----------------DDLKLIIMSATLDAERFSAYFGNAPVIEIEGRTYPVEIRYLPEA 237
Query: 234 EPDY-LDATLITIFQVHLDEAPGDILVFLTGQEEIESVERLVQERLLQLPEASRKLVTVP 292
E DY L ++ +HL E G ILVFL GQ EIE +++ L L +P
Sbjct: 238 EADYILLDAIVAAVDIHLREGSGSILVFLPGQREIERTAEWLEKAEL-----GDDLEILP 292
Query: 293 IFSSLPSEQQMRVFAPAAAGFRKVILATNIAETSVTIPGIKYVIDPGFVKARLYDPVKGM 352
++ +L +E+Q+RVF PA G RKV+LATNIAETS+TIPGI+YVID G K + YDP G+
Sbjct: 293 LYGALSAEEQVRVFEPAPGGKRKVVLATNIAETSLTIPGIRYVIDSGLAKEKRYDPRTGL 352
Query: 353 ESLLVVPISKAQALQRSGRAGREGPGKCFRLYPENEFDKLEDSTKPEIKRCNLSNVILQL 412
L PISKA A QR+GRAGR GPG C+RLY E +F + T PEI R +LS ++LQL
Sbjct: 353 TRLETEPISKASADQRAGRAGRTGPGICYRLYSEEDFLAFPEFTLPEILRTDLSGLVLQL 412
Query: 413 KALGVD-DIIGFDFMEKPSRASIIKSLEQLFLLGALTDDCKLSDPVGHQMARLPLDPIYS 471
K+LG+ DI F F++ P A+I +L L LGAL D KL+ P+G QM+ LPLDP +
Sbjct: 413 KSLGIGQDIAPFPFLDPPPEAAIQAALTLLQELGALDDSGKLT-PLGKQMSLLPLDPRLA 471
Query: 472 KALIVA 477
+ L+ A
Sbjct: 472 RMLLTA 477
|
Length = 845 |
| >gnl|CDD|233659 TIGR01967, DEAH_box_HrpA, ATP-dependent helicase HrpA | Back alignment and domain information |
|---|
| >gnl|CDD|182986 PRK11131, PRK11131, ATP-dependent RNA helicase HrpA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233660 TIGR01970, DEAH_box_HrpB, ATP-dependent helicase HrpB | Back alignment and domain information |
|---|
| >gnl|CDD|236950 PRK11664, PRK11664, ATP-dependent RNA helicase HrpB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238005 cd00046, DEXDc, DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|238034 cd00079, HELICc, Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process | Back alignment and domain information |
|---|
| >gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|197757 smart00490, HELICc, helicase superfamily c-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|201125 pfam00271, Helicase_C, Helicase conserved C-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|218070 pfam04408, HA2, Helicase associated domain (HA2) | Back alignment and domain information |
|---|
| >gnl|CDD|214852 smart00847, HA2, Helicase associated domain (HA2) Add an annotation | Back alignment and domain information |
|---|
| >gnl|CDD|177443 PHA02653, PHA02653, RNA helicase NPH-II; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224036 COG1111, MPH1, ERCC4-like helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 478 | |||
| KOG0922 | 674 | consensus DEAH-box RNA helicase [RNA processing an | 100.0 | |
| KOG0923 | 902 | consensus mRNA splicing factor ATP-dependent RNA h | 100.0 | |
| KOG0924 | 1042 | consensus mRNA splicing factor ATP-dependent RNA h | 100.0 | |
| COG1643 | 845 | HrpA HrpA-like helicases [DNA replication, recombi | 100.0 | |
| KOG0925 | 699 | consensus mRNA splicing factor ATP-dependent RNA h | 100.0 | |
| KOG0926 | 1172 | consensus DEAH-box RNA helicase [RNA processing an | 100.0 | |
| TIGR01970 | 819 | DEAH_box_HrpB ATP-dependent helicase HrpB. This mo | 100.0 | |
| PRK11664 | 812 | ATP-dependent RNA helicase HrpB; Provisional | 100.0 | |
| TIGR01967 | 1283 | DEAH_box_HrpA ATP-dependent helicase HrpA. This mo | 100.0 | |
| PRK11131 | 1294 | ATP-dependent RNA helicase HrpA; Provisional | 100.0 | |
| KOG0920 | 924 | consensus ATP-dependent RNA helicase A [RNA proces | 100.0 | |
| PHA02653 | 675 | RNA helicase NPH-II; Provisional | 100.0 | |
| PRK02362 | 737 | ski2-like helicase; Provisional | 100.0 | |
| PRK01172 | 674 | ski2-like helicase; Provisional | 100.0 | |
| KOG0331 | 519 | consensus ATP-dependent RNA helicase [RNA processi | 100.0 | |
| PRK00254 | 720 | ski2-like helicase; Provisional | 100.0 | |
| PRK11776 | 460 | ATP-dependent RNA helicase DbpA; Provisional | 100.0 | |
| PTZ00110 | 545 | helicase; Provisional | 100.0 | |
| KOG0330 | 476 | consensus ATP-dependent RNA helicase [RNA processi | 100.0 | |
| COG0513 | 513 | SrmB Superfamily II DNA and RNA helicases [DNA rep | 100.0 | |
| COG1202 | 830 | Superfamily II helicase, archaea-specific [General | 100.0 | |
| PRK04837 | 423 | ATP-dependent RNA helicase RhlB; Provisional | 100.0 | |
| PRK10590 | 456 | ATP-dependent RNA helicase RhlE; Provisional | 100.0 | |
| PLN00206 | 518 | DEAD-box ATP-dependent RNA helicase; Provisional | 100.0 | |
| KOG0921 | 1282 | consensus Dosage compensation complex, subunit MLE | 100.0 | |
| PRK11634 | 629 | ATP-dependent RNA helicase DeaD; Provisional | 100.0 | |
| COG1204 | 766 | Superfamily II helicase [General function predicti | 100.0 | |
| PRK04537 | 572 | ATP-dependent RNA helicase RhlB; Provisional | 100.0 | |
| PRK11192 | 434 | ATP-dependent RNA helicase SrmB; Provisional | 100.0 | |
| TIGR03817 | 742 | DECH_helic helicase/secretion neighborhood putativ | 100.0 | |
| KOG0333 | 673 | consensus U5 snRNP-like RNA helicase subunit [RNA | 100.0 | |
| PRK01297 | 475 | ATP-dependent RNA helicase RhlB; Provisional | 100.0 | |
| PTZ00424 | 401 | helicase 45; Provisional | 100.0 | |
| KOG0328 | 400 | consensus Predicted ATP-dependent RNA helicase FAL | 100.0 | |
| TIGR00614 | 470 | recQ_fam ATP-dependent DNA helicase, RecQ family. | 100.0 | |
| KOG0348 | 708 | consensus ATP-dependent RNA helicase [RNA processi | 100.0 | |
| KOG0342 | 543 | consensus ATP-dependent RNA helicase pitchoune [RN | 100.0 | |
| PRK11057 | 607 | ATP-dependent DNA helicase RecQ; Provisional | 100.0 | |
| PLN03137 | 1195 | ATP-dependent DNA helicase; Q4-like; Provisional | 100.0 | |
| PRK13767 | 876 | ATP-dependent helicase; Provisional | 100.0 | |
| KOG0345 | 567 | consensus ATP-dependent RNA helicase [RNA processi | 100.0 | |
| KOG0340 | 442 | consensus ATP-dependent RNA helicase [RNA processi | 100.0 | |
| TIGR01389 | 591 | recQ ATP-dependent DNA helicase RecQ. The ATP-depe | 100.0 | |
| KOG0335 | 482 | consensus ATP-dependent RNA helicase [RNA processi | 100.0 | |
| KOG0341 | 610 | consensus DEAD-box protein abstrakt [RNA processin | 100.0 | |
| KOG0338 | 691 | consensus ATP-dependent RNA helicase [RNA processi | 100.0 | |
| COG1201 | 814 | Lhr Lhr-like helicases [General function predictio | 100.0 | |
| KOG0336 | 629 | consensus ATP-dependent RNA helicase [RNA processi | 100.0 | |
| KOG0343 | 758 | consensus RNA Helicase [RNA processing and modific | 100.0 | |
| KOG0952 | 1230 | consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup | 100.0 | |
| KOG0332 | 477 | consensus ATP-dependent RNA helicase [RNA processi | 100.0 | |
| TIGR00580 | 926 | mfd transcription-repair coupling factor (mfd). Al | 100.0 | |
| KOG0326 | 459 | consensus ATP-dependent RNA helicase [RNA processi | 100.0 | |
| PRK09751 | 1490 | putative ATP-dependent helicase Lhr; Provisional | 100.0 | |
| PRK10917 | 681 | ATP-dependent DNA helicase RecG; Provisional | 100.0 | |
| COG0514 | 590 | RecQ Superfamily II DNA helicase [DNA replication, | 100.0 | |
| KOG0947 | 1248 | consensus Cytoplasmic exosomal RNA helicase SKI2, | 100.0 | |
| TIGR00643 | 630 | recG ATP-dependent DNA helicase RecG. | 100.0 | |
| PRK10689 | 1147 | transcription-repair coupling factor; Provisional | 100.0 | |
| KOG0948 | 1041 | consensus Nuclear exosomal RNA helicase MTR4, DEAD | 100.0 | |
| TIGR02621 | 844 | cas3_GSU0051 CRISPR-associated helicase Cas3, Anae | 100.0 | |
| KOG0339 | 731 | consensus ATP-dependent RNA helicase [RNA processi | 100.0 | |
| KOG0347 | 731 | consensus RNA helicase [RNA processing and modific | 100.0 | |
| COG1111 | 542 | MPH1 ERCC4-like helicases [DNA replication, recomb | 100.0 | |
| KOG0350 | 620 | consensus DEAD-box ATP-dependent RNA helicase [RNA | 100.0 | |
| TIGR01587 | 358 | cas3_core CRISPR-associated helicase Cas3. This mo | 100.0 | |
| KOG0344 | 593 | consensus ATP-dependent RNA helicase [RNA processi | 100.0 | |
| COG1205 | 851 | Distinct helicase family with a unique C-terminal | 99.98 | |
| KOG0951 | 1674 | consensus RNA helicase BRR2, DEAD-box superfamily | 99.98 | |
| KOG0346 | 569 | consensus RNA helicase [RNA processing and modific | 99.97 | |
| COG4581 | 1041 | Superfamily II RNA helicase [DNA replication, reco | 99.97 | |
| KOG4284 | 980 | consensus DEAD box protein [Transcription] | 99.97 | |
| KOG0334 | 997 | consensus RNA helicase [RNA processing and modific | 99.97 | |
| KOG0327 | 397 | consensus Translation initiation factor 4F, helica | 99.97 | |
| TIGR03158 | 357 | cas3_cyano CRISPR-associated helicase, Cyano-type. | 99.97 | |
| KOG0354 | 746 | consensus DEAD-box like helicase [General function | 99.97 | |
| PHA02558 | 501 | uvsW UvsW helicase; Provisional | 99.96 | |
| KOG0351 | 941 | consensus ATP-dependent DNA helicase [Replication, | 99.96 | |
| PRK13766 | 773 | Hef nuclease; Provisional | 99.95 | |
| KOG0352 | 641 | consensus ATP-dependent DNA helicase [Replication, | 99.95 | |
| PRK09401 | 1176 | reverse gyrase; Reviewed | 99.95 | |
| KOG0337 | 529 | consensus ATP-dependent RNA helicase [RNA processi | 99.95 | |
| KOG0950 | 1008 | consensus DNA polymerase theta/eta, DEAD-box super | 99.95 | |
| TIGR00603 | 732 | rad25 DNA repair helicase rad25. All proteins in t | 99.94 | |
| PRK12898 | 656 | secA preprotein translocase subunit SecA; Reviewed | 99.94 | |
| PRK09694 | 878 | helicase Cas3; Provisional | 99.94 | |
| PRK14701 | 1638 | reverse gyrase; Provisional | 99.94 | |
| COG1200 | 677 | RecG RecG-like helicase [DNA replication, recombin | 99.94 | |
| PRK05580 | 679 | primosome assembly protein PriA; Validated | 99.94 | |
| TIGR03714 | 762 | secA2 accessory Sec system translocase SecA2. Memb | 99.93 | |
| PRK09200 | 790 | preprotein translocase subunit SecA; Reviewed | 99.93 | |
| TIGR00595 | 505 | priA primosomal protein N'. All proteins in this f | 99.93 | |
| TIGR01054 | 1171 | rgy reverse gyrase. Generally, these gyrases are e | 99.93 | |
| COG4098 | 441 | comFA Superfamily II DNA/RNA helicase required for | 99.92 | |
| COG1061 | 442 | SSL2 DNA or RNA helicases of superfamily II [Trans | 99.92 | |
| COG1197 | 1139 | Mfd Transcription-repair coupling factor (superfam | 99.92 | |
| TIGR00963 | 745 | secA preprotein translocase, SecA subunit. The pro | 99.92 | |
| KOG0353 | 695 | consensus ATP-dependent DNA helicase [General func | 99.91 | |
| KOG0949 | 1330 | consensus Predicted helicase, DEAD-box superfamily | 99.91 | |
| PRK11448 | 1123 | hsdR type I restriction enzyme EcoKI subunit R; Pr | 99.89 | |
| PRK04914 | 956 | ATP-dependent helicase HepA; Validated | 99.88 | |
| PRK12906 | 796 | secA preprotein translocase subunit SecA; Reviewed | 99.86 | |
| COG1203 | 733 | CRISPR-associated helicase Cas3 [Defense mechanism | 99.85 | |
| TIGR00631 | 655 | uvrb excinuclease ABC, B subunit. This family is b | 99.82 | |
| KOG0329 | 387 | consensus ATP-dependent RNA helicase [RNA processi | 99.82 | |
| COG1198 | 730 | PriA Primosomal protein N' (replication factor Y) | 99.82 | |
| PRK13104 | 896 | secA preprotein translocase subunit SecA; Reviewed | 99.79 | |
| PRK12904 | 830 | preprotein translocase subunit SecA; Reviewed | 99.78 | |
| KOG0349 | 725 | consensus Putative DEAD-box RNA helicase DDX1 [RNA | 99.77 | |
| KOG0953 | 700 | consensus Mitochondrial RNA helicase SUV3, DEAD-bo | 99.74 | |
| COG4096 | 875 | HsdR Type I site-specific restriction-modification | 99.72 | |
| KOG4150 | 1034 | consensus Predicted ATP-dependent RNA helicase [RN | 99.72 | |
| COG0556 | 663 | UvrB Helicase subunit of the DNA excision repair c | 99.7 | |
| PRK13107 | 908 | preprotein translocase subunit SecA; Reviewed | 99.69 | |
| PRK05298 | 652 | excinuclease ABC subunit B; Provisional | 99.69 | |
| TIGR00348 | 667 | hsdR type I site-specific deoxyribonuclease, HsdR | 99.67 | |
| COG1110 | 1187 | Reverse gyrase [DNA replication, recombination, an | 99.66 | |
| PF00270 | 169 | DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 | 99.64 | |
| cd00079 | 131 | HELICc Helicase superfamily c-terminal domain; ass | 99.64 | |
| PF00271 | 78 | Helicase_C: Helicase conserved C-terminal domain; | 99.6 | |
| PLN03142 | 1033 | Probable chromatin-remodeling complex ATPase chain | 99.6 | |
| cd00268 | 203 | DEADc DEAD-box helicases. A diverse family of prot | 99.59 | |
| PRK12899 | 970 | secA preprotein translocase subunit SecA; Reviewed | 99.58 | |
| KOG0951 | 1674 | consensus RNA helicase BRR2, DEAD-box superfamily | 99.58 | |
| TIGR01407 | 850 | dinG_rel DnaQ family exonuclease/DinG family helic | 99.56 | |
| PRK12900 | 1025 | secA preprotein translocase subunit SecA; Reviewed | 99.55 | |
| TIGR02562 | 1110 | cas3_yersinia CRISPR-associated helicase Cas3. The | 99.46 | |
| smart00490 | 82 | HELICc helicase superfamily c-terminal domain. | 99.44 | |
| PRK12326 | 764 | preprotein translocase subunit SecA; Reviewed | 99.42 | |
| PRK07246 | 820 | bifunctional ATP-dependent DNA helicase/DNA polyme | 99.41 | |
| PRK13103 | 913 | secA preprotein translocase subunit SecA; Reviewed | 99.37 | |
| KOG1123 | 776 | consensus RNA polymerase II transcription initiati | 99.36 | |
| smart00487 | 201 | DEXDc DEAD-like helicases superfamily. | 99.35 | |
| KOG0921 | 1282 | consensus Dosage compensation complex, subunit MLE | 99.32 | |
| PF07652 | 148 | Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR | 99.29 | |
| PRK14873 | 665 | primosome assembly protein PriA; Provisional | 99.27 | |
| PRK12903 | 925 | secA preprotein translocase subunit SecA; Reviewed | 99.26 | |
| PRK08074 | 928 | bifunctional ATP-dependent DNA helicase/DNA polyme | 99.23 | |
| PF04851 | 184 | ResIII: Type III restriction enzyme, res subunit; | 99.21 | |
| cd00046 | 144 | DEXDc DEAD-like helicases superfamily. A diverse f | 99.2 | |
| CHL00122 | 870 | secA preprotein translocase subunit SecA; Validate | 99.09 | |
| PRK12902 | 939 | secA preprotein translocase subunit SecA; Reviewed | 99.02 | |
| PF02399 | 824 | Herpes_ori_bp: Origin of replication binding prote | 99.02 | |
| KOG0387 | 923 | consensus Transcription-coupled repair protein CSB | 98.98 | |
| COG4889 | 1518 | Predicted helicase [General function prediction on | 98.97 | |
| TIGR03117 | 636 | cas_csf4 CRISPR-associated DEAD/DEAH-box helicase | 98.97 | |
| KOG0385 | 971 | consensus Chromatin remodeling complex WSTF-ISWI, | 98.92 | |
| KOG0952 | 1230 | consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup | 98.81 | |
| KOG0390 | 776 | consensus DNA repair protein, SNF2 family [Replica | 98.78 | |
| KOG1000 | 689 | consensus Chromatin remodeling protein HARP/SMARCA | 98.62 | |
| smart00847 | 92 | HA2 Helicase associated domain (HA2) Add an annota | 98.61 | |
| PF04408 | 102 | HA2: Helicase associated domain (HA2); InterPro: I | 98.58 | |
| KOG0384 | 1373 | consensus Chromodomain-helicase DNA-binding protei | 98.46 | |
| PRK12901 | 1112 | secA preprotein translocase subunit SecA; Reviewed | 98.33 | |
| KOG0392 | 1549 | consensus SNF2 family DNA-dependent ATPase domain- | 98.32 | |
| PF00448 | 196 | SRP54: SRP54-type protein, GTPase domain; InterPro | 98.32 | |
| PF13401 | 131 | AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S | 98.15 | |
| PF13245 | 76 | AAA_19: Part of AAA domain | 98.12 | |
| COG0653 | 822 | SecA Preprotein translocase subunit SecA (ATPase, | 98.11 | |
| KOG0389 | 941 | consensus SNF2 family DNA-dependent ATPase [Chroma | 98.1 | |
| PF13604 | 196 | AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL | 98.04 | |
| COG0610 | 962 | Type I site-specific restriction-modification syst | 98.02 | |
| COG1120 | 258 | FepC ABC-type cobalamin/Fe3+-siderophores transpor | 98.0 | |
| TIGR02768 | 744 | TraA_Ti Ti-type conjugative transfer relaxase TraA | 98.0 | |
| PRK12723 | 388 | flagellar biosynthesis regulator FlhF; Provisional | 97.92 | |
| PRK11747 | 697 | dinG ATP-dependent DNA helicase DinG; Provisional | 97.83 | |
| PRK13889 | 988 | conjugal transfer relaxase TraA; Provisional | 97.83 | |
| TIGR01447 | 586 | recD exodeoxyribonuclease V, alpha subunit. This f | 97.81 | |
| PF13086 | 236 | AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV | 97.8 | |
| COG1136 | 226 | SalX ABC-type antimicrobial peptide transport syst | 97.79 | |
| COG1121 | 254 | ZnuC ABC-type Mn/Zn transport systems, ATPase comp | 97.79 | |
| cd00009 | 151 | AAA The AAA+ (ATPases Associated with a wide varie | 97.79 | |
| TIGR01448 | 720 | recD_rel helicase, putative, RecD/TraA family. Thi | 97.79 | |
| PRK11889 | 436 | flhF flagellar biosynthesis regulator FlhF; Provis | 97.79 | |
| PRK14974 | 336 | cell division protein FtsY; Provisional | 97.77 | |
| COG1419 | 407 | FlhF Flagellar GTP-binding protein [Cell motility | 97.74 | |
| PRK10875 | 615 | recD exonuclease V subunit alpha; Provisional | 97.72 | |
| PF00176 | 299 | SNF2_N: SNF2 family N-terminal domain; InterPro: I | 97.71 | |
| COG1119 | 257 | ModF ABC-type molybdenum transport system, ATPase | 97.7 | |
| COG1116 | 248 | TauB ABC-type nitrate/sulfonate/bicarbonate transp | 97.7 | |
| COG1126 | 240 | GlnQ ABC-type polar amino acid transport system, A | 97.69 | |
| COG4555 | 245 | NatA ABC-type Na+ transport system, ATPase compone | 97.69 | |
| PRK13826 | 1102 | Dtr system oriT relaxase; Provisional | 97.68 | |
| COG2884 | 223 | FtsE Predicted ATPase involved in cell division [C | 97.67 | |
| smart00489 | 289 | DEXDc3 DEAD-like helicases superfamily. | 97.63 | |
| smart00488 | 289 | DEXDc2 DEAD-like helicases superfamily. | 97.63 | |
| cd03216 | 163 | ABC_Carb_Monos_I This family represents the domain | 97.63 | |
| COG4604 | 252 | CeuD ABC-type enterochelin transport system, ATPas | 97.62 | |
| COG1199 | 654 | DinG Rad3-related DNA helicases [Transcription / D | 97.61 | |
| PRK14722 | 374 | flhF flagellar biosynthesis regulator FlhF; Provis | 97.6 | |
| TIGR00604 | 705 | rad3 DNA repair helicase (rad3). All proteins in t | 97.6 | |
| PRK06526 | 254 | transposase; Provisional | 97.59 | |
| COG1122 | 235 | CbiO ABC-type cobalt transport system, ATPase comp | 97.58 | |
| PRK05703 | 424 | flhF flagellar biosynthesis regulator FlhF; Valida | 97.58 | |
| TIGR02760 | 1960 | TraI_TIGR conjugative transfer relaxase protein Tr | 97.57 | |
| PF09848 | 352 | DUF2075: Uncharacterized conserved protein (DUF207 | 97.57 | |
| PRK12726 | 407 | flagellar biosynthesis regulator FlhF; Provisional | 97.56 | |
| COG3839 | 338 | MalK ABC-type sugar transport systems, ATPase comp | 97.55 | |
| COG1124 | 252 | DppF ABC-type dipeptide/oligopeptide/nickel transp | 97.54 | |
| smart00382 | 148 | AAA ATPases associated with a variety of cellular | 97.54 | |
| PF05970 | 364 | PIF1: PIF1-like helicase; InterPro: IPR010285 This | 97.53 | |
| COG3842 | 352 | PotA ABC-type spermidine/putrescine transport syst | 97.52 | |
| cd03222 | 177 | ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi | 97.48 | |
| cd03221 | 144 | ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is | 97.47 | |
| TIGR03015 | 269 | pepcterm_ATPase putative secretion ATPase, PEP-CTE | 97.47 | |
| cd03238 | 176 | ABC_UvrA The excision repair protein UvrA; Nucleot | 97.43 | |
| cd03223 | 166 | ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass | 97.41 | |
| PRK12727 | 559 | flagellar biosynthesis regulator FlhF; Provisional | 97.4 | |
| PRK10416 | 318 | signal recognition particle-docking protein FtsY; | 97.4 | |
| PRK14721 | 420 | flhF flagellar biosynthesis regulator FlhF; Provis | 97.4 | |
| COG1127 | 263 | Ttg2A ABC-type transport system involved in resist | 97.38 | |
| cd03230 | 173 | ABC_DR_subfamily_A This family of ATP-binding prot | 97.38 | |
| COG1129 | 500 | MglA ABC-type sugar transport system, ATPase compo | 97.37 | |
| PRK14250 | 241 | phosphate ABC transporter ATP-binding protein; Pro | 97.34 | |
| COG4525 | 259 | TauB ABC-type taurine transport system, ATPase com | 97.33 | |
| cd03246 | 173 | ABCC_Protease_Secretion This family represents the | 97.31 | |
| COG4152 | 300 | ABC-type uncharacterized transport system, ATPase | 97.3 | |
| COG1125 | 309 | OpuBA ABC-type proline/glycine betaine transport s | 97.3 | |
| PRK04296 | 190 | thymidine kinase; Provisional | 97.29 | |
| TIGR02782 | 299 | TrbB_P P-type conjugative transfer ATPase TrbB. Th | 97.28 | |
| PRK09536 | 402 | btuD corrinoid ABC transporter ATPase; Reviewed | 97.28 | |
| COG3845 | 501 | ABC-type uncharacterized transport systems, ATPase | 97.28 | |
| PRK07952 | 244 | DNA replication protein DnaC; Validated | 97.28 | |
| PRK06731 | 270 | flhF flagellar biosynthesis regulator FlhF; Valida | 97.27 | |
| PRK08181 | 269 | transposase; Validated | 97.26 | |
| PF13173 | 128 | AAA_14: AAA domain | 97.25 | |
| PRK09544 | 251 | znuC high-affinity zinc transporter ATPase; Review | 97.24 | |
| PF13307 | 167 | Helicase_C_2: Helicase C-terminal domain; PDB: 4A1 | 97.23 | |
| COG1131 | 293 | CcmA ABC-type multidrug transport system, ATPase c | 97.23 | |
| cd03247 | 178 | ABCC_cytochrome_bd The CYD subfamily implicated in | 97.23 | |
| TIGR02788 | 308 | VirB11 P-type DNA transfer ATPase VirB11. The VirB | 97.21 | |
| PRK10536 | 262 | hypothetical protein; Provisional | 97.2 | |
| KOG0058 | 716 | consensus Peptide exporter, ABC superfamily [Intra | 97.2 | |
| PF02562 | 205 | PhoH: PhoH-like protein; InterPro: IPR003714 PhoH | 97.19 | |
| PRK12724 | 432 | flagellar biosynthesis regulator FlhF; Provisional | 97.19 | |
| cd03214 | 180 | ABC_Iron-Siderophores_B12_Hemin ABC transporters, | 97.18 | |
| COG4608 | 268 | AppF ABC-type oligopeptide transport system, ATPas | 97.17 | |
| cd03213 | 194 | ABCG_EPDR ABCG transporters are involved in eye pi | 97.17 | |
| PRK14723 | 767 | flhF flagellar biosynthesis regulator FlhF; Provis | 97.17 | |
| TIGR01425 | 429 | SRP54_euk signal recognition particle protein SRP5 | 97.17 | |
| COG1135 | 339 | AbcC ABC-type metal ion transport system, ATPase c | 97.17 | |
| PF00004 | 132 | AAA: ATPase family associated with various cellula | 97.17 | |
| PRK13537 | 306 | nodulation ABC transporter NodI; Provisional | 97.16 | |
| COG3638 | 258 | ABC-type phosphate/phosphonate transport system, A | 97.16 | |
| PF05621 | 302 | TniB: Bacterial TniB protein; InterPro: IPR008868 | 97.14 | |
| cd01120 | 165 | RecA-like_NTPases RecA-like NTPases. This family i | 97.13 | |
| cd00267 | 157 | ABC_ATPase ABC (ATP-binding cassette) transporter | 97.11 | |
| PF00580 | 315 | UvrD-helicase: UvrD/REP helicase N-terminal domain | 97.1 | |
| PF02456 | 369 | Adeno_IVa2: Adenovirus IVa2 protein; InterPro: IPR | 97.1 | |
| TIGR03499 | 282 | FlhF flagellar biosynthetic protein FlhF. | 97.09 | |
| PRK09183 | 259 | transposase/IS protein; Provisional | 97.09 | |
| COG4618 | 580 | ArpD ABC-type protease/lipase transport system, AT | 97.09 | |
| PRK06995 | 484 | flhF flagellar biosynthesis regulator FlhF; Valida | 97.08 | |
| cd03232 | 192 | ABC_PDR_domain2 The pleiotropic drug resistance-li | 97.08 | |
| PRK11432 | 351 | fbpC ferric transporter ATP-binding subunit; Provi | 97.07 | |
| cd03229 | 178 | ABC_Class3 This class is comprised of all BPD (Bin | 97.07 | |
| PF07517 | 266 | SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011 | 97.07 | |
| TIGR00376 | 637 | DNA helicase, putative. The gene product may repre | 97.06 | |
| PF06862 | 442 | DUF1253: Protein of unknown function (DUF1253); In | 97.06 | |
| cd03215 | 182 | ABC_Carb_Monos_II This family represents domain II | 97.05 | |
| cd01130 | 186 | VirB11-like_ATPase Type IV secretory pathway compo | 97.04 | |
| cd03228 | 171 | ABCC_MRP_Like The MRP (Mutidrug Resistance Protein | 97.03 | |
| COG0410 | 237 | LivF ABC-type branched-chain amino acid transport | 97.03 | |
| TIGR00064 | 272 | ftsY signal recognition particle-docking protein F | 97.03 | |
| PRK13851 | 344 | type IV secretion system protein VirB11; Provision | 97.02 | |
| PRK00771 | 437 | signal recognition particle protein Srp54; Provisi | 97.02 | |
| KOG1803 | 649 | consensus DNA helicase [Replication, recombination | 96.97 | |
| PF01695 | 178 | IstB_IS21: IstB-like ATP binding protein; InterPro | 96.96 | |
| PF05729 | 166 | NACHT: NACHT domain | 96.95 | |
| PRK06893 | 229 | DNA replication initiation factor; Validated | 96.94 | |
| PRK11147 | 635 | ABC transporter ATPase component; Reviewed | 96.94 | |
| cd03217 | 200 | ABC_FeS_Assembly ABC-type transport system involve | 96.93 | |
| cd03237 | 246 | ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o | 96.92 | |
| PRK13900 | 332 | type IV secretion system ATPase VirB11; Provisiona | 96.92 | |
| PRK08727 | 233 | hypothetical protein; Validated | 96.89 | |
| PF00437 | 270 | T2SE: Type II/IV secretion system protein; InterPr | 96.88 | |
| PRK10867 | 433 | signal recognition particle protein; Provisional | 96.85 | |
| PRK15439 | 510 | autoinducer 2 ABC transporter ATP-binding protein | 96.83 | |
| PRK06835 | 329 | DNA replication protein DnaC; Validated | 96.79 | |
| COG3840 | 231 | ThiQ ABC-type thiamine transport system, ATPase co | 96.79 | |
| TIGR03771 | 223 | anch_rpt_ABC anchored repeat-type ABC transporter, | 96.77 | |
| KOG0391 | 1958 | consensus SNF2 family DNA-dependent ATPase [Genera | 96.76 | |
| TIGR02868 | 529 | CydC thiol reductant ABC exporter, CydC subunit. T | 96.75 | |
| cd03233 | 202 | ABC_PDR_domain1 The pleiotropic drug resistance (P | 96.74 | |
| KOG2373 | 514 | consensus Predicted mitochondrial DNA helicase twi | 96.73 | |
| PRK08903 | 227 | DnaA regulatory inactivator Hda; Validated | 96.73 | |
| COG4619 | 223 | ABC-type uncharacterized transport system, ATPase | 96.71 | |
| cd03248 | 226 | ABCC_TAP TAP, the Transporter Associated with Anti | 96.71 | |
| COG2256 | 436 | MGS1 ATPase related to the helicase subunit of the | 96.7 | |
| PRK13833 | 323 | conjugal transfer protein TrbB; Provisional | 96.7 | |
| PRK08084 | 235 | DNA replication initiation factor; Provisional | 96.67 | |
| TIGR03420 | 226 | DnaA_homol_Hda DnaA regulatory inactivator Hda. Me | 96.66 | |
| COG0488 | 530 | Uup ATPase components of ABC transporters with dup | 96.66 | |
| COG4181 | 228 | Predicted ABC-type transport system involved in ly | 96.64 | |
| TIGR02314 | 343 | ABC_MetN D-methionine ABC transporter, ATP-binding | 96.64 | |
| cd03115 | 173 | SRP The signal recognition particle (SRP) mediates | 96.64 | |
| PRK10851 | 353 | sulfate/thiosulfate transporter subunit; Provision | 96.63 | |
| PRK07003 | 830 | DNA polymerase III subunits gamma and tau; Validat | 96.63 | |
| PF13555 | 62 | AAA_29: P-loop containing region of AAA domain | 96.62 | |
| PRK08116 | 268 | hypothetical protein; Validated | 96.6 | |
| COG4988 | 559 | CydD ABC-type transport system involved in cytochr | 96.6 | |
| PF05127 | 177 | Helicase_RecD: Helicase; InterPro: IPR007807 This | 96.58 | |
| COG4167 | 267 | SapF ABC-type antimicrobial peptide transport syst | 96.58 | |
| PRK11607 | 377 | potG putrescine transporter ATP-binding subunit; P | 96.58 | |
| PRK14247 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 96.58 | |
| TIGR00959 | 428 | ffh signal recognition particle protein. This mode | 96.56 | |
| COG1101 | 263 | PhnK ABC-type uncharacterized transport system, AT | 96.56 | |
| PRK13646 | 286 | cbiO cobalt transporter ATP-binding subunit; Provi | 96.56 | |
| PRK05642 | 234 | DNA replication initiation factor; Validated | 96.55 | |
| PRK11153 | 343 | metN DL-methionine transporter ATP-binding subunit | 96.54 | |
| PRK14087 | 450 | dnaA chromosomal replication initiation protein; P | 96.53 | |
| PRK00149 | 450 | dnaA chromosomal replication initiation protein; R | 96.52 | |
| PRK13639 | 275 | cbiO cobalt transporter ATP-binding subunit; Provi | 96.52 | |
| COG1484 | 254 | DnaC DNA replication protein [DNA replication, rec | 96.52 | |
| cd03300 | 232 | ABC_PotA_N PotA is an ABC-type transporter and the | 96.51 | |
| cd03250 | 204 | ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. | 96.51 | |
| PRK14956 | 484 | DNA polymerase III subunits gamma and tau; Provisi | 96.5 | |
| KOG1802 | 935 | consensus RNA helicase nonsense mRNA reducing fact | 96.49 | |
| PRK13894 | 319 | conjugal transfer ATPase TrbB; Provisional | 96.48 | |
| cd01129 | 264 | PulE-GspE PulE/GspE The type II secretory pathway | 96.47 | |
| COG0396 | 251 | sufC Cysteine desulfurase activator ATPase [Posttr | 96.47 | |
| TIGR01420 | 343 | pilT_fam pilus retraction protein PilT. This model | 96.47 | |
| TIGR03375 | 694 | type_I_sec_LssB type I secretion system ATPase, Ls | 96.47 | |
| COG4987 | 573 | CydC ABC-type transport system involved in cytochr | 96.46 | |
| COG4586 | 325 | ABC-type uncharacterized transport system, ATPase | 96.45 | |
| PRK11264 | 250 | putative amino-acid ABC transporter ATP-binding pr | 96.45 | |
| COG0630 | 312 | VirB11 Type IV secretory pathway, VirB11 component | 96.45 | |
| PRK11174 | 588 | cysteine/glutathione ABC transporter membrane/ATP- | 96.43 | |
| COG1132 | 567 | MdlB ABC-type multidrug transport system, ATPase a | 96.42 | |
| PRK06921 | 266 | hypothetical protein; Provisional | 96.42 | |
| PRK12377 | 248 | putative replication protein; Provisional | 96.4 | |
| TIGR01186 | 363 | proV glycine betaine/L-proline transport ATP bindi | 96.39 | |
| PRK08533 | 230 | flagellar accessory protein FlaH; Reviewed | 96.38 | |
| PRK06645 | 507 | DNA polymerase III subunits gamma and tau; Validat | 96.37 | |
| PRK12323 | 700 | DNA polymerase III subunits gamma and tau; Provisi | 96.37 | |
| PRK14262 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 96.37 | |
| COG1134 | 249 | TagH ABC-type polysaccharide/polyol phosphate tran | 96.37 | |
| PRK14712 | 1623 | conjugal transfer nickase/helicase TraI; Provision | 96.36 | |
| COG0411 | 250 | LivG ABC-type branched-chain amino acid transport | 96.35 | |
| PLN03073 | 718 | ABC transporter F family; Provisional | 96.35 | |
| PRK12402 | 337 | replication factor C small subunit 2; Reviewed | 96.34 | |
| PRK10895 | 241 | lipopolysaccharide ABC transporter ATP-binding pro | 96.33 | |
| PRK11160 | 574 | cysteine/glutathione ABC transporter membrane/ATP- | 96.33 | |
| TIGR00362 | 405 | DnaA chromosomal replication initiator protein Dna | 96.33 | |
| PF05496 | 233 | RuvB_N: Holliday junction DNA helicase ruvB N-term | 96.32 | |
| COG1117 | 253 | PstB ABC-type phosphate transport system, ATPase c | 96.32 | |
| PRK10522 | 547 | multidrug transporter membrane component/ATP-bindi | 96.32 | |
| TIGR02858 | 270 | spore_III_AA stage III sporulation protein AA. Mem | 96.31 | |
| TIGR02881 | 261 | spore_V_K stage V sporulation protein K. Members o | 96.31 | |
| TIGR00604 | 705 | rad3 DNA repair helicase (rad3). All proteins in t | 96.29 | |
| PRK06620 | 214 | hypothetical protein; Validated | 96.28 | |
| cd01124 | 187 | KaiC KaiC is a circadian clock protein primarily f | 96.28 | |
| PF00308 | 219 | Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 | 96.28 | |
| PRK14253 | 249 | phosphate ABC transporter ATP-binding protein; Pro | 96.25 | |
| PRK14949 | 944 | DNA polymerase III subunits gamma and tau; Provisi | 96.25 | |
| KOG0057 | 591 | consensus Mitochondrial Fe/S cluster exporter, ABC | 96.24 | |
| PRK11747 | 697 | dinG ATP-dependent DNA helicase DinG; Provisional | 96.24 | |
| PRK13709 | 1747 | conjugal transfer nickase/helicase TraI; Provision | 96.23 | |
| PRK08691 | 709 | DNA polymerase III subunits gamma and tau; Validat | 96.22 | |
| PRK14962 | 472 | DNA polymerase III subunits gamma and tau; Provisi | 96.21 | |
| COG0552 | 340 | FtsY Signal recognition particle GTPase [Intracell | 96.19 | |
| TIGR03796 | 710 | NHPM_micro_ABC1 NHPM bacteriocin system ABC transp | 96.18 | |
| PRK05973 | 237 | replicative DNA helicase; Provisional | 96.15 | |
| COG2274 | 709 | SunT ABC-type bacteriocin/lantibiotic exporters, c | 96.15 | |
| PRK09087 | 226 | hypothetical protein; Validated | 96.14 | |
| PRK10070 | 400 | glycine betaine transporter ATP-binding subunit; P | 96.14 | |
| PRK14088 | 440 | dnaA chromosomal replication initiation protein; P | 96.13 | |
| PRK08939 | 306 | primosomal protein DnaI; Reviewed | 96.13 | |
| TIGR02857 | 529 | CydD thiol reductant ABC exporter, CydD subunit. U | 96.11 | |
| COG4178 | 604 | ABC-type uncharacterized transport system, permeas | 96.08 | |
| PRK13657 | 588 | cyclic beta-1,2-glucan ABC transporter; Provisiona | 96.07 | |
| COG4148 | 352 | ModC ABC-type molybdate transport system, ATPase c | 96.07 | |
| PRK11614 | 237 | livF leucine/isoleucine/valine transporter ATP-bin | 96.06 | |
| PF12340 | 229 | DUF3638: Protein of unknown function (DUF3638); In | 96.06 | |
| TIGR03719 | 552 | ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa | 96.05 | |
| PRK14960 | 702 | DNA polymerase III subunits gamma and tau; Provisi | 96.04 | |
| PRK14267 | 253 | phosphate ABC transporter ATP-binding protein; Pro | 96.03 | |
| PRK14958 | 509 | DNA polymerase III subunits gamma and tau; Provisi | 96.03 | |
| PRK10419 | 268 | nikE nickel transporter ATP-binding protein NikE; | 96.02 | |
| KOG0388 | 1185 | consensus SNF2 family DNA-dependent ATPase [Replic | 96.02 | |
| cd01122 | 271 | GP4d_helicase GP4d_helicase is a homohexameric 5'- | 96.01 | |
| PRK14957 | 546 | DNA polymerase III subunits gamma and tau; Provisi | 96.0 | |
| cd03227 | 162 | ABC_Class2 ABC-type Class 2 contains systems invol | 95.99 | |
| COG4962 | 355 | CpaF Flp pilus assembly protein, ATPase CpaF [Intr | 95.99 | |
| COG1118 | 345 | CysA ABC-type sulfate/molybdate transport systems, | 95.99 | |
| PRK07994 | 647 | DNA polymerase III subunits gamma and tau; Validat | 95.97 | |
| PRK00411 | 394 | cdc6 cell division control protein 6; Reviewed | 95.96 | |
| PRK10247 | 225 | putative ABC transporter ATP-binding protein YbbL; | 95.96 | |
| PHA02533 | 534 | 17 large terminase protein; Provisional | 95.96 | |
| COG1137 | 243 | YhbG ABC-type (unclassified) transport system, ATP | 95.94 | |
| COG3910 | 233 | Predicted ATPase [General function prediction only | 95.92 | |
| KOG1805 | 1100 | consensus DNA replication helicase [Replication, r | 95.92 | |
| COG3267 | 269 | ExeA Type II secretory pathway, component ExeA (pr | 95.91 | |
| PRK10636 | 638 | putative ABC transporter ATP-binding protein; Prov | 95.9 | |
| PRK14242 | 253 | phosphate transporter ATP-binding protein; Provisi | 95.88 | |
| KOG0060 | 659 | consensus Long-chain acyl-CoA transporter, ABC sup | 95.86 | |
| cd03259 | 213 | ABC_Carb_Solutes_like ABC Carbohydrate and Solute | 95.85 | |
| COG0553 | 866 | HepA Superfamily II DNA/RNA helicases, SNF2 family | 95.85 | |
| TIGR00954 | 659 | 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FA | 95.85 | |
| PRK13342 | 413 | recombination factor protein RarA; Reviewed | 95.85 | |
| cd03258 | 233 | ABC_MetN_methionine_transporter MetN (also known a | 95.85 | |
| TIGR03878 | 259 | thermo_KaiC_2 KaiC domain protein, AF_0795 family. | 95.85 | |
| PRK13545 | 549 | tagH teichoic acids export protein ATP-binding sub | 95.83 | |
| TIGR02315 | 243 | ABC_phnC phosphonate ABC transporter, ATP-binding | 95.83 | |
| PRK13539 | 207 | cytochrome c biogenesis protein CcmA; Provisional | 95.82 | |
| PRK10789 | 569 | putative multidrug transporter membrane\ATP-bindin | 95.81 | |
| COG4136 | 213 | ABC-type uncharacterized transport system, ATPase | 95.81 | |
| PRK14240 | 250 | phosphate transporter ATP-binding protein; Provisi | 95.81 | |
| cd03235 | 213 | ABC_Metallic_Cations ABC component of the metal-ty | 95.8 | |
| PF01637 | 234 | Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 | 95.8 | |
| cd03226 | 205 | ABC_cobalt_CbiO_domain2 Domain II of the ABC compo | 95.79 | |
| PRK14961 | 363 | DNA polymerase III subunits gamma and tau; Provisi | 95.78 | |
| PRK13543 | 214 | cytochrome c biogenesis protein CcmA; Provisional | 95.78 | |
| PRK11176 | 582 | lipid transporter ATP-binding/permease protein; Pr | 95.78 | |
| PRK11823 | 446 | DNA repair protein RadA; Provisional | 95.77 | |
| PRK13409 | 590 | putative ATPase RIL; Provisional | 95.76 | |
| PRK10938 | 490 | putative molybdenum transport ATP-binding protein | 95.75 | |
| PRK14963 | 504 | DNA polymerase III subunits gamma and tau; Provisi | 95.73 | |
| PRK14086 | 617 | dnaA chromosomal replication initiation protein; P | 95.73 | |
| TIGR01842 | 544 | type_I_sec_PrtD type I secretion system ABC transp | 95.73 | |
| PRK14955 | 397 | DNA polymerase III subunits gamma and tau; Provisi | 95.72 | |
| PRK14964 | 491 | DNA polymerase III subunits gamma and tau; Provisi | 95.72 | |
| TIGR02928 | 365 | orc1/cdc6 family replication initiation protein. M | 95.71 | |
| PRK11022 | 326 | dppD dipeptide transporter ATP-binding subunit; Pr | 95.7 | |
| TIGR02760 | 1960 | TraI_TIGR conjugative transfer relaxase protein Tr | 95.7 | |
| cd03296 | 239 | ABC_CysA_sulfate_importer Part of the ABC transpor | 95.68 | |
| COG1123 | 539 | ATPase components of various ABC-type transport sy | 95.68 | |
| PRK11124 | 242 | artP arginine transporter ATP-binding subunit; Pro | 95.68 | |
| PRK11054 | 684 | helD DNA helicase IV; Provisional | 95.67 | |
| cd01123 | 235 | Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r | 95.66 | |
| PRK04195 | 482 | replication factor C large subunit; Provisional | 95.66 | |
| TIGR00958 | 711 | 3a01208 Conjugate Transporter-2 (CT2) Family prote | 95.66 | |
| PRK14273 | 254 | phosphate ABC transporter ATP-binding protein; Pro | 95.65 | |
| cd03225 | 211 | ABC_cobalt_CbiO_domain1 Domain I of the ABC compon | 95.65 | |
| TIGR02203 | 571 | MsbA_lipidA lipid A export permease/ATP-binding pr | 95.63 | |
| PRK11000 | 369 | maltose/maltodextrin transporter ATP-binding prote | 95.63 | |
| KOG0989 | 346 | consensus Replication factor C, subunit RFC4 [Repl | 95.63 | |
| TIGR02323 | 253 | CP_lyasePhnK phosphonate C-P lyase system protein | 95.63 | |
| PRK14274 | 259 | phosphate ABC transporter ATP-binding protein; Pro | 95.61 | |
| cd01131 | 198 | PilT Pilus retraction ATPase PilT. PilT is a nucle | 95.61 | |
| cd03265 | 220 | ABC_DrrA DrrA is the ATP-binding protein component | 95.61 | |
| PRK11650 | 356 | ugpC glycerol-3-phosphate transporter ATP-binding | 95.6 | |
| PRK09111 | 598 | DNA polymerase III subunits gamma and tau; Validat | 95.6 | |
| cd03301 | 213 | ABC_MalK_N The N-terminal ATPase domain of the mal | 95.59 | |
| PRK13652 | 277 | cbiO cobalt transporter ATP-binding subunit; Provi | 95.59 | |
| PRK13536 | 340 | nodulation factor exporter subunit NodI; Provision | 95.59 | |
| cd01393 | 226 | recA_like RecA is a bacterial enzyme which has rol | 95.59 | |
| cd03263 | 220 | ABC_subfamily_A The ABCA subfamily mediates the tr | 95.59 | |
| TIGR02524 | 358 | dot_icm_DotB Dot/Icm secretion system ATPase DotB. | 95.59 | |
| PRK10790 | 592 | putative multidrug transporter membrane\ATP-bindin | 95.58 | |
| PHA02544 | 316 | 44 clamp loader, small subunit; Provisional | 95.58 | |
| PRK13540 | 200 | cytochrome c biogenesis protein CcmA; Provisional | 95.58 | |
| TIGR01192 | 585 | chvA glucan exporter ATP-binding protein. This mod | 95.57 | |
| PRK14261 | 253 | phosphate ABC transporter ATP-binding protein; Pro | 95.57 | |
| PRK14268 | 258 | phosphate ABC transporter ATP-binding protein; Pro | 95.57 | |
| TIGR01846 | 694 | type_I_sec_HlyB type I secretion system ABC transp | 95.57 | |
| cd03255 | 218 | ABC_MJ0796_Lo1CDE_FtsE This family is comprised of | 95.56 | |
| PRK14239 | 252 | phosphate transporter ATP-binding protein; Provisi | 95.56 | |
| TIGR02237 | 209 | recomb_radB DNA repair and recombination protein R | 95.56 | |
| cd03257 | 228 | ABC_NikE_OppD_transporters The ABC transporter sub | 95.54 | |
| PLN03232 | 1495 | ABC transporter C family member; Provisional | 95.54 | |
| TIGR00596 | 814 | rad1 DNA repair protein (rad1). This family is bas | 95.54 | |
| PRK10744 | 260 | pstB phosphate transporter ATP-binding protein; Pr | 95.54 | |
| cd03219 | 236 | ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans | 95.54 | |
| TIGR02880 | 284 | cbbX_cfxQ probable Rubsico expression protein CbbX | 95.54 | |
| CHL00176 | 638 | ftsH cell division protein; Validated | 95.52 | |
| PRK15093 | 330 | antimicrobial peptide ABC transporter ATP-binding | 95.51 | |
| PF00005 | 137 | ABC_tran: ABC transporter This structure is on hol | 95.51 | |
| cd03224 | 222 | ABC_TM1139_LivF_branched LivF (TM1139) is part of | 95.51 | |
| PLN03130 | 1622 | ABC transporter C family member; Provisional | 95.5 | |
| TIGR02204 | 576 | MsbA_rel ABC transporter, permease/ATP-binding pro | 95.5 | |
| PRK13538 | 204 | cytochrome c biogenesis protein CcmA; Provisional | 95.5 | |
| cd00820 | 107 | PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC | 95.49 | |
| cd03281 | 213 | ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS | 95.49 | |
| TIGR02673 | 214 | FtsE cell division ATP-binding protein FtsE. This | 95.49 | |
| TIGR01978 | 243 | sufC FeS assembly ATPase SufC. SufC is part of the | 95.49 | |
| cd03266 | 218 | ABC_NatA_sodium_exporter NatA is the ATPase compon | 95.49 | |
| PRK14251 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 95.48 | |
| PRK11231 | 255 | fecE iron-dicitrate transporter ATP-binding subuni | 95.47 | |
| PRK11247 | 257 | ssuB aliphatic sulfonates transport ATP-binding su | 95.47 | |
| cd03218 | 232 | ABC_YhbG The ABC transporters belonging to the Yhb | 95.47 | |
| PRK14969 | 527 | DNA polymerase III subunits gamma and tau; Provisi | 95.47 | |
| PRK11831 | 269 | putative ABC transporter ATP-binding protein YrbF; | 95.47 | |
| PRK11701 | 258 | phnK phosphonate C-P lyase system protein PhnK; Pr | 95.46 | |
| PF00931 | 287 | NB-ARC: NB-ARC domain; InterPro: IPR002182 This is | 95.46 | |
| cd03260 | 227 | ABC_PstB_phosphate_transporter Phosphate uptake is | 95.45 | |
| COG1199 | 654 | DinG Rad3-related DNA helicases [Transcription / D | 95.43 | |
| TIGR03608 | 206 | L_ocin_972_ABC putative bacteriocin export ABC tra | 95.43 | |
| cd03262 | 213 | ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- | 95.43 | |
| COG4133 | 209 | CcmA ABC-type transport system involved in cytochr | 95.42 | |
| TIGR02238 | 313 | recomb_DMC1 meiotic recombinase Dmc1. This model d | 95.42 | |
| PRK09984 | 262 | phosphonate/organophosphate ester transporter subu | 95.41 | |
| PRK14248 | 268 | phosphate ABC transporter ATP-binding protein; Pro | 95.41 | |
| TIGR03411 | 242 | urea_trans_UrtD urea ABC transporter, ATP-binding | 95.4 | |
| PRK14243 | 264 | phosphate transporter ATP-binding protein; Provisi | 95.4 | |
| TIGR03265 | 353 | PhnT2 putative 2-aminoethylphosphonate ABC transpo | 95.4 | |
| PF05707 | 193 | Zot: Zonular occludens toxin (Zot); InterPro: IPR0 | 95.4 | |
| cd03220 | 224 | ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo | 95.4 | |
| PTZ00112 | 1164 | origin recognition complex 1 protein; Provisional | 95.39 | |
| PRK14241 | 258 | phosphate transporter ATP-binding protein; Provisi | 95.39 |
| >KOG0922 consensus DEAH-box RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
Probab=100.00 E-value=9.6e-91 Score=678.30 Aligned_cols=432 Identities=59% Similarity=0.951 Sum_probs=416.4
Q ss_pred hhHHHhhhcCCcHHHHHHHHHHHhcCCEEEEEcCCCCcHHhHHHHHHhhcCccCCCcEEEEecchHHHHHHHHHHHHHHh
Q 011751 4 QKILQQRKSLPIASVEKRLVEEVRKNDILIIVGETGSGKTTQLPQFLFHAGFCRDGKLIGVTQPRRVAAVTVAKRVAEES 83 (478)
Q Consensus 4 ~~~~~~~~~~~~~~~q~~~~~~l~~~~~~~i~apTGsGKT~~~~~~~~~~~~~~~~~~i~~~~p~~~l~~~~~~~~~~~~ 83 (478)
..+..++..+|++.+..+++..+.+++.++|+|+|||||||++|+++.++++..+|. |.|++|+|.++..+++|++.+.
T Consensus 41 ~~i~~qR~~LPI~~~r~~il~~ve~nqvlIviGeTGsGKSTQipQyL~eaG~~~~g~-I~~TQPRRVAavslA~RVAeE~ 119 (674)
T KOG0922|consen 41 LSIQEQRESLPIYKYRDQILYAVEDNQVLIVIGETGSGKSTQIPQYLAEAGFASSGK-IACTQPRRVAAVSLAKRVAEEM 119 (674)
T ss_pred cCHHHhhccCCHHHHHHHHHHHHHHCCEEEEEcCCCCCccccHhHHHHhcccccCCc-EEeecCchHHHHHHHHHHHHHh
Confidence 467788899999999999999999999999999999999999999999999998876 9999999999999999999999
Q ss_pred CCcCCCEEEEEEeecccCChhhhHH---------HHhhCcCcCCCcceEeecccccchhhhHHHHHHHHHHHhhcccccC
Q 011751 84 GVELGQRVGYSIRFDDRTSTSTRIK---------EALLDPYLSRYSAIIVDEAHERTVHTDVLLGLLKKVQNARSKSADG 154 (478)
Q Consensus 84 ~~~~~~~vg~~~~~~~~~~~~~~~~---------~~l~~~~l~~~~~lIiDE~H~r~~~~~~~l~~l~~~~~~~~~~~~~ 154 (478)
+..+|..|||.++++..++..|+++ +++.++.++++++||+||||||+..+|+++++||++..+|
T Consensus 120 ~~~lG~~VGY~IRFed~ts~~TrikymTDG~LLRE~l~Dp~LskYsvIIlDEAHERsl~TDiLlGlLKki~~~R------ 193 (674)
T KOG0922|consen 120 GCQLGEEVGYTIRFEDSTSKDTRIKYMTDGMLLREILKDPLLSKYSVIILDEAHERSLHTDILLGLLKKILKKR------ 193 (674)
T ss_pred CCCcCceeeeEEEecccCCCceeEEEecchHHHHHHhcCCccccccEEEEechhhhhhHHHHHHHHHHHHHhcC------
Confidence 9999999999999999988877664 7888999999999999999999999999999999999988
Q ss_pred CCCCCCCCCCchhhhccCCCCCCccccccccCCCCCCceEEEEcCCCChhHHHhhhCCCCeEEeCCccccceEEecCCCC
Q 011751 155 HSNGNNNNENSDMILDRGNDTNGINTLKQCQGRKFAPLKLIIMSASLDARGFSEYFGCAKAVHVQGRQFPVEILYTLYPE 234 (478)
Q Consensus 155 ~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~lSAT~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 234 (478)
++.++|+||||+|.+.|++||++++++.++|+.+|+++.|...+.
T Consensus 194 -----------------------------------~~LklIimSATlda~kfS~yF~~a~i~~i~GR~fPVei~y~~~p~ 238 (674)
T KOG0922|consen 194 -----------------------------------PDLKLIIMSATLDAEKFSEYFNNAPILTIPGRTFPVEILYLKEPT 238 (674)
T ss_pred -----------------------------------CCceEEEEeeeecHHHHHHHhcCCceEeecCCCCceeEEeccCCc
Confidence 889999999999999999999999999999999999999999999
Q ss_pred cchHHHHHHHHHHhhhcCCCCCEEEEcCCHHHHHHHHHHHHHHHhcCCCCCCCeEEEEccCCCCHHHHHhhcCcCCCCcc
Q 011751 235 PDYLDATLITIFQVHLDEAPGDILVFLTGQEEIESVERLVQERLLQLPEASRKLVTVPIFSSLPSEQQMRVFAPAAAGFR 314 (478)
Q Consensus 235 ~~~~~~~~~~~~~~~~~~~~~~~LVF~~s~~~~~~l~~~l~~~~~~~~~~~~~~~v~~~h~~l~~~~r~~i~~~f~~g~~ 314 (478)
.+|++..+.+++++|..+++|.||||+++.++++.+++.|.+.......+.+. .+.++||.|+.+++.++++..+.|.+
T Consensus 239 ~dYv~a~~~tv~~Ih~~E~~GDILvFLtGqeEIe~~~~~l~e~~~~~~~~~~~-~~lply~aL~~e~Q~rvF~p~p~g~R 317 (674)
T KOG0922|consen 239 ADYVDAALITVIQIHLTEPPGDILVFLTGQEEIEAACELLRERAKSLPEDCPE-LILPLYGALPSEEQSRVFDPAPPGKR 317 (674)
T ss_pred hhhHHHHHHHHHHHHccCCCCCEEEEeCCHHHHHHHHHHHHHHhhhccccCcc-eeeeecccCCHHHhhccccCCCCCcc
Confidence 99999999999999999999999999999999999999999987766655544 78899999999999999999999999
Q ss_pred EEEEeccccccccccCCeEEEEeCCcccceeecCCCCcccceeeecCHHHHHHhhcccCCCCCCeEEEecCHhhHhcccC
Q 011751 315 KVILATNIAETSVTIPGIKYVIDPGFVKARLYDPVKGMESLLVVPISKAQALQRSGRAGREGPGKCFRLYPENEFDKLED 394 (478)
Q Consensus 315 ~vlvaT~~~~~Gvdip~v~~VI~~g~~~~~~yd~~~~~~~~~~~~~s~~~~~Qr~GRaGR~~~G~~~~l~~~~~~~~~~~ 394 (478)
||++|||++|.+++||+|.||||+|+.+.+.|+|..|+..+...|+|+++..||+|||||.++|+||+||++++|++|++
T Consensus 318 KvIlsTNIAETSlTI~GI~YVVDsG~vK~~~y~p~~g~~~L~v~~ISkasA~QRaGRAGRt~pGkcyRLYte~~~~~~~~ 397 (674)
T KOG0922|consen 318 KVILSTNIAETSLTIDGIRYVVDSGFVKQKKYNPRTGLDSLIVVPISKASANQRAGRAGRTGPGKCYRLYTESAYDKMPL 397 (674)
T ss_pred eEEEEcceeeeeEEecceEEEEcCCceEEEeeccccCccceeEEechHHHHhhhcccCCCCCCceEEEeeeHHHHhhccc
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CCCCcccccCchHHHHHHHHcCCCCCCCccCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHhccCCCCHhhhchh
Q 011751 395 STKPEIKRCNLSNVILQLKALGVDDIIGFDFMEKPSRASIIKSLEQLFLLGALTDDCKLSDPVGHQMARLPLDPIYSKAL 474 (478)
Q Consensus 395 ~~~pei~~~~l~~~~l~~~~~~~~~~~~~~~~~~p~~~~l~~al~~L~~~g~l~~~~~~t~~lG~~~~~~~~~p~~~~~l 474 (478)
...|||.+.+|...+|++|++|+.|+..|+|++||+.+++..|++.|..+||||++|.+|.|+|+.|+.+|++|.++|+|
T Consensus 398 ~~~PEI~R~~Ls~~vL~Lkalgi~d~l~F~f~d~P~~~~l~~AL~~L~~lgald~~g~lt~p~G~~ma~~Pl~p~lsk~l 477 (674)
T KOG0922|consen 398 QTVPEIQRVNLSSAVLQLKALGINDPLRFPFIDPPPPEALEEALEELYSLGALDDRGKLTSPLGRQMAELPLEPHLSKML 477 (674)
T ss_pred CCCCceeeechHHHHHHHHhcCCCCcccCCCCCCCChHHHHHHHHHHHhcCcccCcCCcCchHHhhhhhcCCCcchhhhh
Confidence 99999999999999999999999999999999999999999999999999999999999988999999999999999999
Q ss_pred eecC
Q 011751 475 IVAE 478 (478)
Q Consensus 475 ~~~~ 478 (478)
+.|.
T Consensus 478 l~s~ 481 (674)
T KOG0922|consen 478 LKSS 481 (674)
T ss_pred hhcc
Confidence 9873
|
|
| >KOG0923 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0924 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0925 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0926 consensus DEAH-box RNA helicase [RNA processing and modification; Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB | Back alignment and domain information |
|---|
| >PRK11664 ATP-dependent RNA helicase HrpB; Provisional | Back alignment and domain information |
|---|
| >TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA | Back alignment and domain information |
|---|
| >PRK11131 ATP-dependent RNA helicase HrpA; Provisional | Back alignment and domain information |
|---|
| >KOG0920 consensus ATP-dependent RNA helicase A [RNA processing and modification] | Back alignment and domain information |
|---|
| >PHA02653 RNA helicase NPH-II; Provisional | Back alignment and domain information |
|---|
| >PRK02362 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >PRK01172 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >KOG0331 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK00254 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >PRK11776 ATP-dependent RNA helicase DbpA; Provisional | Back alignment and domain information |
|---|
| >PTZ00110 helicase; Provisional | Back alignment and domain information |
|---|
| >KOG0330 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG1202 Superfamily II helicase, archaea-specific [General function prediction only] | Back alignment and domain information |
|---|
| >PRK04837 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >PRK10590 ATP-dependent RNA helicase RhlE; Provisional | Back alignment and domain information |
|---|
| >PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional | Back alignment and domain information |
|---|
| >KOG0921 consensus Dosage compensation complex, subunit MLE [Transcription] | Back alignment and domain information |
|---|
| >PRK11634 ATP-dependent RNA helicase DeaD; Provisional | Back alignment and domain information |
|---|
| >COG1204 Superfamily II helicase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK04537 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >PRK11192 ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase | Back alignment and domain information |
|---|
| >KOG0333 consensus U5 snRNP-like RNA helicase subunit [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK01297 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >PTZ00424 helicase 45; Provisional | Back alignment and domain information |
|---|
| >KOG0328 consensus Predicted ATP-dependent RNA helicase FAL1, involved in rRNA maturation, DEAD-box superfamily [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family | Back alignment and domain information |
|---|
| >KOG0348 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0342 consensus ATP-dependent RNA helicase pitchoune [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK11057 ATP-dependent DNA helicase RecQ; Provisional | Back alignment and domain information |
|---|
| >PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional | Back alignment and domain information |
|---|
| >PRK13767 ATP-dependent helicase; Provisional | Back alignment and domain information |
|---|
| >KOG0345 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0340 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR01389 recQ ATP-dependent DNA helicase RecQ | Back alignment and domain information |
|---|
| >KOG0335 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0341 consensus DEAD-box protein abstrakt [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0338 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG1201 Lhr Lhr-like helicases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0336 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0343 consensus RNA Helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0332 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR00580 mfd transcription-repair coupling factor (mfd) | Back alignment and domain information |
|---|
| >KOG0326 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK09751 putative ATP-dependent helicase Lhr; Provisional | Back alignment and domain information |
|---|
| >PRK10917 ATP-dependent DNA helicase RecG; Provisional | Back alignment and domain information |
|---|
| >COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0947 consensus Cytoplasmic exosomal RNA helicase SKI2, DEAD-box superfamily [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR00643 recG ATP-dependent DNA helicase RecG | Back alignment and domain information |
|---|
| >PRK10689 transcription-repair coupling factor; Provisional | Back alignment and domain information |
|---|
| >KOG0948 consensus Nuclear exosomal RNA helicase MTR4, DEAD-box superfamily [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype | Back alignment and domain information |
|---|
| >KOG0339 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0347 consensus RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0350 consensus DEAD-box ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR01587 cas3_core CRISPR-associated helicase Cas3 | Back alignment and domain information |
|---|
| >KOG0344 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0346 consensus RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG4284 consensus DEAD box protein [Transcription] | Back alignment and domain information |
|---|
| >KOG0334 consensus RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0327 consensus Translation initiation factor 4F, helicase subunit (eIF-4A) and related helicases [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type | Back alignment and domain information |
|---|
| >KOG0354 consensus DEAD-box like helicase [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02558 uvsW UvsW helicase; Provisional | Back alignment and domain information |
|---|
| >KOG0351 consensus ATP-dependent DNA helicase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK13766 Hef nuclease; Provisional | Back alignment and domain information |
|---|
| >KOG0352 consensus ATP-dependent DNA helicase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK09401 reverse gyrase; Reviewed | Back alignment and domain information |
|---|
| >KOG0337 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0950 consensus DNA polymerase theta/eta, DEAD-box superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00603 rad25 DNA repair helicase rad25 | Back alignment and domain information |
|---|
| >PRK12898 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PRK09694 helicase Cas3; Provisional | Back alignment and domain information |
|---|
| >PRK14701 reverse gyrase; Provisional | Back alignment and domain information |
|---|
| >COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] | Back alignment and domain information |
|---|
| >PRK05580 primosome assembly protein PriA; Validated | Back alignment and domain information |
|---|
| >TIGR03714 secA2 accessory Sec system translocase SecA2 | Back alignment and domain information |
|---|
| >PRK09200 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >TIGR00595 priA primosomal protein N' | Back alignment and domain information |
|---|
| >TIGR01054 rgy reverse gyrase | Back alignment and domain information |
|---|
| >COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] | Back alignment and domain information |
|---|
| >TIGR00963 secA preprotein translocase, SecA subunit | Back alignment and domain information |
|---|
| >KOG0353 consensus ATP-dependent DNA helicase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0949 consensus Predicted helicase, DEAD-box superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional | Back alignment and domain information |
|---|
| >PRK04914 ATP-dependent helicase HepA; Validated | Back alignment and domain information |
|---|
| >PRK12906 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] | Back alignment and domain information |
|---|
| >TIGR00631 uvrb excinuclease ABC, B subunit | Back alignment and domain information |
|---|
| >KOG0329 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK13104 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PRK12904 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >KOG0349 consensus Putative DEAD-box RNA helicase DDX1 [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0953 consensus Mitochondrial RNA helicase SUV3, DEAD-box superfamily [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG4150 consensus Predicted ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK13107 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PRK05298 excinuclease ABC subunit B; Provisional | Back alignment and domain information |
|---|
| >TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family | Back alignment and domain information |
|---|
| >COG1110 Reverse gyrase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases | Back alignment and domain information |
|---|
| >cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process | Back alignment and domain information |
|---|
| >PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins | Back alignment and domain information |
|---|
| >PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional | Back alignment and domain information |
|---|
| >cd00268 DEADc DEAD-box helicases | Back alignment and domain information |
|---|
| >PRK12899 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative | Back alignment and domain information |
|---|
| >PRK12900 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3 | Back alignment and domain information |
|---|
| >smart00490 HELICc helicase superfamily c-terminal domain | Back alignment and domain information |
|---|
| >PRK12326 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated | Back alignment and domain information |
|---|
| >PRK13103 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >KOG1123 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 3'-5' helicase subunit SSL2 [Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >smart00487 DEXDc DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >KOG0921 consensus Dosage compensation complex, subunit MLE [Transcription] | Back alignment and domain information |
|---|
| >PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain | Back alignment and domain information |
|---|
| >PRK14873 primosome assembly protein PriA; Provisional | Back alignment and domain information |
|---|
| >PRK12903 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated | Back alignment and domain information |
|---|
| >PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 | Back alignment and domain information |
|---|
| >cd00046 DEXDc DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >CHL00122 secA preprotein translocase subunit SecA; Validated | Back alignment and domain information |
|---|
| >PRK12902 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein | Back alignment and domain information |
|---|
| >KOG0387 consensus Transcription-coupled repair protein CSB/RAD26 (contains SNF2 family DNA-dependent ATPase domain) [Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG4889 Predicted helicase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 | Back alignment and domain information |
|---|
| >KOG0385 consensus Chromatin remodeling complex WSTF-ISWI, small subunit [Transcription] | Back alignment and domain information |
|---|
| >KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0390 consensus DNA repair protein, SNF2 family [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG1000 consensus Chromatin remodeling protein HARP/SMARCAL1, DEAD-box superfamily [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >smart00847 HA2 Helicase associated domain (HA2) Add an annotation | Back alignment and domain information |
|---|
| >PF04408 HA2: Helicase associated domain (HA2); InterPro: IPR007502 This presumed domain is about 90 amino acid residues in length | Back alignment and domain information |
|---|
| >KOG0384 consensus Chromodomain-helicase DNA-binding protein [Transcription] | Back alignment and domain information |
|---|
| >PRK12901 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >KOG0392 consensus SNF2 family DNA-dependent ATPase domain-containing protein [Transcription] | Back alignment and domain information |
|---|
| >PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] | Back alignment and domain information |
|---|
| >PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B | Back alignment and domain information |
|---|
| >PF13245 AAA_19: Part of AAA domain | Back alignment and domain information |
|---|
| >COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG0389 consensus SNF2 family DNA-dependent ATPase [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A | Back alignment and domain information |
|---|
| >COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] | Back alignment and domain information |
|---|
| >COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] | Back alignment and domain information |
|---|
| >TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA | Back alignment and domain information |
|---|
| >PRK12723 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional | Back alignment and domain information |
|---|
| >PRK13889 conjugal transfer relaxase TraA; Provisional | Back alignment and domain information |
|---|
| >TIGR01447 recD exodeoxyribonuclease V, alpha subunit | Back alignment and domain information |
|---|
| >PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A | Back alignment and domain information |
|---|
| >COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >TIGR01448 recD_rel helicase, putative, RecD/TraA family | Back alignment and domain information |
|---|
| >PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK14974 cell division protein FtsY; Provisional | Back alignment and domain information |
|---|
| >COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] | Back alignment and domain information |
|---|
| >PRK10875 recD exonuclease V subunit alpha; Provisional | Back alignment and domain information |
|---|
| >PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e | Back alignment and domain information |
|---|
| >COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13826 Dtr system oriT relaxase; Provisional | Back alignment and domain information |
|---|
| >COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >smart00489 DEXDc3 DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >smart00488 DEXDc2 DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) | Back alignment and domain information |
|---|
| >COG4604 CeuD ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >TIGR00604 rad3 DNA repair helicase (rad3) | Back alignment and domain information |
|---|
| >PRK06526 transposase; Provisional | Back alignment and domain information |
|---|
| >COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI | Back alignment and domain information |
|---|
| >PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function | Back alignment and domain information |
|---|
| >PRK12726 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >smart00382 AAA ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins | Back alignment and domain information |
|---|
| >COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids | Back alignment and domain information |
|---|
| >cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth | Back alignment and domain information |
|---|
| >TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion | Back alignment and domain information |
|---|
| >cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome | Back alignment and domain information |
|---|
| >PRK12727 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK10416 signal recognition particle-docking protein FtsY; Provisional | Back alignment and domain information |
|---|
| >PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity | Back alignment and domain information |
|---|
| >COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14250 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain | Back alignment and domain information |
|---|
| >COG4152 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK04296 thymidine kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB | Back alignment and domain information |
|---|
| >PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed | Back alignment and domain information |
|---|
| >COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] | Back alignment and domain information |
|---|
| >PRK07952 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >PRK08181 transposase; Validated | Back alignment and domain information |
|---|
| >PF13173 AAA_14: AAA domain | Back alignment and domain information |
|---|
| >PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed | Back alignment and domain information |
|---|
| >PF13307 Helicase_C_2: Helicase C-terminal domain; PDB: 4A15_A 2VSF_A 3CRV_A 3CRW_1 2VL7_A | Back alignment and domain information |
|---|
| >COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis | Back alignment and domain information |
|---|
| >TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 | Back alignment and domain information |
|---|
| >PRK10536 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0058 consensus Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] | Back alignment and domain information |
|---|
| >PRK12724 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea | Back alignment and domain information |
|---|
| >COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) | Back alignment and domain information |
|---|
| >PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >TIGR01425 SRP54_euk signal recognition particle protein SRP54 | Back alignment and domain information |
|---|
| >COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport | Back alignment and domain information |
|---|
| >PRK13537 nodulation ABC transporter NodI; Provisional | Back alignment and domain information |
|---|
| >COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins | Back alignment and domain information |
|---|
| >cd01120 RecA-like_NTPases RecA-like NTPases | Back alignment and domain information |
|---|
| >cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA | Back alignment and domain information |
|---|
| >PF02456 Adeno_IVa2: Adenovirus IVa2 protein; InterPro: IPR003389 Va2 protein can interact with the adenoviral packaging signal and this interaction involves DNA sequences that have previously been demonstrated to be required for packaging [] | Back alignment and domain information |
|---|
| >TIGR03499 FlhF flagellar biosynthetic protein FlhF | Back alignment and domain information |
|---|
| >PRK09183 transposase/IS protein; Provisional | Back alignment and domain information |
|---|
| >COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] | Back alignment and domain information |
|---|
| >PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters | Back alignment and domain information |
|---|
| >PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment | Back alignment and domain information |
|---|
| >PF07517 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011115 SecA protein binds to the plasma membrane where it interacts with proOmpA to support translocation of proOmpA through the membrane | Back alignment and domain information |
|---|
| >TIGR00376 DNA helicase, putative | Back alignment and domain information |
|---|
| >PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ] | Back alignment and domain information |
|---|
| >cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) | Back alignment and domain information |
|---|
| >cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases | Back alignment and domain information |
|---|
| >cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export | Back alignment and domain information |
|---|
| >COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00064 ftsY signal recognition particle-docking protein FtsY | Back alignment and domain information |
|---|
| >PRK13851 type IV secretion system protein VirB11; Provisional | Back alignment and domain information |
|---|
| >PRK00771 signal recognition particle protein Srp54; Provisional | Back alignment and domain information |
|---|
| >KOG1803 consensus DNA helicase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif | Back alignment and domain information |
|---|
| >PF05729 NACHT: NACHT domain | Back alignment and domain information |
|---|
| >PRK06893 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >PRK11147 ABC transporter ATPase component; Reviewed | Back alignment and domain information |
|---|
| >cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component | Back alignment and domain information |
|---|
| >cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor | Back alignment and domain information |
|---|
| >PRK13900 type IV secretion system ATPase VirB11; Provisional | Back alignment and domain information |
|---|
| >PRK08727 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] | Back alignment and domain information |
|---|
| >PRK10867 signal recognition particle protein; Provisional | Back alignment and domain information |
|---|
| >PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional | Back alignment and domain information |
|---|
| >PRK06835 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit | Back alignment and domain information |
|---|
| >KOG0391 consensus SNF2 family DNA-dependent ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02868 CydC thiol reductant ABC exporter, CydC subunit | Back alignment and domain information |
|---|
| >cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters | Back alignment and domain information |
|---|
| >KOG2373 consensus Predicted mitochondrial DNA helicase twinkle [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK08903 DnaA regulatory inactivator Hda; Validated | Back alignment and domain information |
|---|
| >COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules | Back alignment and domain information |
|---|
| >COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK13833 conjugal transfer protein TrbB; Provisional | Back alignment and domain information |
|---|
| >PRK08084 DNA replication initiation factor; Provisional | Back alignment and domain information |
|---|
| >TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda | Back alignment and domain information |
|---|
| >COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] | Back alignment and domain information |
|---|
| >COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes | Back alignment and domain information |
|---|
| >PRK10851 sulfate/thiosulfate transporter subunit; Provisional | Back alignment and domain information |
|---|
| >PRK07003 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PF13555 AAA_29: P-loop containing region of AAA domain | Back alignment and domain information |
|---|
| >PRK08116 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF05127 Helicase_RecD: Helicase; InterPro: IPR007807 This domain is about 350 amino acid residues long and appears to have a P-loop motif, suggesting this is an ATPase | Back alignment and domain information |
|---|
| >COG4167 SapF ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK11607 potG putrescine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14247 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00959 ffh signal recognition particle protein | Back alignment and domain information |
|---|
| >COG1101 PhnK ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK05642 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14087 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK00149 dnaA chromosomal replication initiation protein; Reviewed | Back alignment and domain information |
|---|
| >PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D | Back alignment and domain information |
|---|
| >cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C | Back alignment and domain information |
|---|
| >PRK14956 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >KOG1802 consensus RNA helicase nonsense mRNA reducing factor (pNORF1) [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK13894 conjugal transfer ATPase TrbB; Provisional | Back alignment and domain information |
|---|
| >cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) | Back alignment and domain information |
|---|
| >COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR01420 pilT_fam pilus retraction protein PilT | Back alignment and domain information |
|---|
| >TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family | Back alignment and domain information |
|---|
| >COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG4586 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional | Back alignment and domain information |
|---|
| >COG0630 VirB11 Type IV secretory pathway, VirB11 components, and related ATPases involved in archaeal flagella biosynthesis [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed | Back alignment and domain information |
|---|
| >COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK06921 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK12377 putative replication protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit | Back alignment and domain information |
|---|
| >PRK08533 flagellar accessory protein FlaH; Reviewed | Back alignment and domain information |
|---|
| >PRK06645 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK12323 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14262 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PRK14712 conjugal transfer nickase/helicase TraI; Provisional | Back alignment and domain information |
|---|
| >COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PLN03073 ABC transporter F family; Provisional | Back alignment and domain information |
|---|
| >PRK12402 replication factor C small subunit 2; Reviewed | Back alignment and domain information |
|---|
| >PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed | Back alignment and domain information |
|---|
| >TIGR00362 DnaA chromosomal replication initiator protein DnaA | Back alignment and domain information |
|---|
| >PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair | Back alignment and domain information |
|---|
| >COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional | Back alignment and domain information |
|---|
| >TIGR02858 spore_III_AA stage III sporulation protein AA | Back alignment and domain information |
|---|
| >TIGR02881 spore_V_K stage V sporulation protein K | Back alignment and domain information |
|---|
| >TIGR00604 rad3 DNA repair helicase (rad3) | Back alignment and domain information |
|---|
| >PRK06620 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs | Back alignment and domain information |
|---|
| >PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication | Back alignment and domain information |
|---|
| >PRK14253 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14949 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >KOG0057 consensus Mitochondrial Fe/S cluster exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional | Back alignment and domain information |
|---|
| >PRK13709 conjugal transfer nickase/helicase TraI; Provisional | Back alignment and domain information |
|---|
| >PRK08691 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14962 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein | Back alignment and domain information |
|---|
| >PRK05973 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK09087 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK10070 glycine betaine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14088 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK08939 primosomal protein DnaI; Reviewed | Back alignment and domain information |
|---|
| >TIGR02857 CydD thiol reductant ABC exporter, CydD subunit | Back alignment and domain information |
|---|
| >COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] | Back alignment and domain information |
|---|
| >PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional | Back alignment and domain information |
|---|
| >COG4148 ModC ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PF12340 DUF3638: Protein of unknown function (DUF3638); InterPro: IPR022099 This domain family is found in eukaryotes, and is approximately 230 amino acids in length | Back alignment and domain information |
|---|
| >TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family | Back alignment and domain information |
|---|
| >PRK14960 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14267 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14958 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional | Back alignment and domain information |
|---|
| >KOG0388 consensus SNF2 family DNA-dependent ATPase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases | Back alignment and domain information |
|---|
| >PRK14957 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >cd03227 ABC_Class2 ABC-type Class 2 contains systems involved in cellular processes other than transport | Back alignment and domain information |
|---|
| >COG4962 CpaF Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK07994 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK00411 cdc6 cell division control protein 6; Reviewed | Back alignment and domain information |
|---|
| >PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional | Back alignment and domain information |
|---|
| >PHA02533 17 large terminase protein; Provisional | Back alignment and domain information |
|---|
| >COG1137 YhbG ABC-type (unclassified) transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >COG3910 Predicted ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1805 consensus DNA replication helicase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK10636 putative ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14242 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >KOG0060 consensus Long-chain acyl-CoA transporter, ABC superfamily (involved in peroxisome organization and biogenesis) [Lipid transport and metabolism; General function prediction only] | Back alignment and domain information |
|---|
| >cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup | Back alignment and domain information |
|---|
| >COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR00954 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FAT) Family protei | Back alignment and domain information |
|---|
| >PRK13342 recombination factor protein RarA; Reviewed | Back alignment and domain information |
|---|
| >cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport | Back alignment and domain information |
|---|
| >TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family | Back alignment and domain information |
|---|
| >PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK13539 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional | Back alignment and domain information |
|---|
| >COG4136 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14240 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters | Back alignment and domain information |
|---|
| >PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP | Back alignment and domain information |
|---|
| >cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota | Back alignment and domain information |
|---|
| >PRK14961 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK13543 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >PRK11176 lipid transporter ATP-binding/permease protein; Provisional | Back alignment and domain information |
|---|
| >PRK11823 DNA repair protein RadA; Provisional | Back alignment and domain information |
|---|
| >PRK13409 putative ATPase RIL; Provisional | Back alignment and domain information |
|---|
| >PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional | Back alignment and domain information |
|---|
| >PRK14963 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14086 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family | Back alignment and domain information |
|---|
| >PRK14955 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14964 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR02928 orc1/cdc6 family replication initiation protein | Back alignment and domain information |
|---|
| >PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI | Back alignment and domain information |
|---|
| >cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import | Back alignment and domain information |
|---|
| >COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11124 artP arginine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11054 helD DNA helicase IV; Provisional | Back alignment and domain information |
|---|
| >cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B | Back alignment and domain information |
|---|
| >PRK04195 replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein | Back alignment and domain information |
|---|
| >PRK14273 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota | Back alignment and domain information |
|---|
| >TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA | Back alignment and domain information |
|---|
| >PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK | Back alignment and domain information |
|---|
| >PRK14274 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd01131 PilT Pilus retraction ATPase PilT | Back alignment and domain information |
|---|
| >cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin | Back alignment and domain information |
|---|
| >PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK09111 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK | Back alignment and domain information |
|---|
| >PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13536 nodulation factor exporter subunit NodI; Provisional | Back alignment and domain information |
|---|
| >cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds | Back alignment and domain information |
|---|
| >TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB | Back alignment and domain information |
|---|
| >PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional | Back alignment and domain information |
|---|
| >PHA02544 44 clamp loader, small subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13540 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >TIGR01192 chvA glucan exporter ATP-binding protein | Back alignment and domain information |
|---|
| >PRK14261 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14268 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01846 type_I_sec_HlyB type I secretion system ABC transporter, HlyB family | Back alignment and domain information |
|---|
| >cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) | Back alignment and domain information |
|---|
| >PRK14239 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02237 recomb_radB DNA repair and recombination protein RadB | Back alignment and domain information |
|---|
| >cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) | Back alignment and domain information |
|---|
| >PLN03232 ABC transporter C family member; Provisional | Back alignment and domain information |
|---|
| >TIGR00596 rad1 DNA repair protein (rad1) | Back alignment and domain information |
|---|
| >PRK10744 pstB phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine | Back alignment and domain information |
|---|
| >TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX | Back alignment and domain information |
|---|
| >CHL00176 ftsH cell division protein; Validated | Back alignment and domain information |
|---|
| >PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems | Back alignment and domain information |
|---|
| >cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids | Back alignment and domain information |
|---|
| >PLN03130 ABC transporter C family member; Provisional | Back alignment and domain information |
|---|
| >TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein | Back alignment and domain information |
|---|
| >PRK13538 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis | Back alignment and domain information |
|---|
| >cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes | Back alignment and domain information |
|---|
| >TIGR02673 FtsE cell division ATP-binding protein FtsE | Back alignment and domain information |
|---|
| >TIGR01978 sufC FeS assembly ATPase SufC | Back alignment and domain information |
|---|
| >cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake | Back alignment and domain information |
|---|
| >PRK14251 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids | Back alignment and domain information |
|---|
| >PRK14969 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional | Back alignment and domain information |
|---|
| >PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional | Back alignment and domain information |
|---|
| >PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] | Back alignment and domain information |
|---|
| >cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient | Back alignment and domain information |
|---|
| >COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group | Back alignment and domain information |
|---|
| >cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively | Back alignment and domain information |
|---|
| >COG4133 CcmA ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02238 recomb_DMC1 meiotic recombinase Dmc1 | Back alignment and domain information |
|---|
| >PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14248 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD | Back alignment and domain information |
|---|
| >PRK14243 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PF05707 Zot: Zonular occludens toxin (Zot); InterPro: IPR008900 This entry consists of bacterial and viral proteins which are very similar to the Zonular occludens toxin (Zot) | Back alignment and domain information |
|---|
| >cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export | Back alignment and domain information |
|---|
| >PTZ00112 origin recognition complex 1 protein; Provisional | Back alignment and domain information |
|---|
| >PRK14241 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 478 | ||||
| 3kx2_B | 767 | Crystal Structure Of Prp43p In Complex With Adp Len | 1e-100 | ||
| 2xau_A | 773 | Crystal Structure Of The Prp43p Deah-Box Rna Helica | 1e-100 | ||
| 3llm_A | 235 | Crystal Structure Analysis Of A Rna Helicase Length | 2e-16 |
| >pdb|3KX2|B Chain B, Crystal Structure Of Prp43p In Complex With Adp Length = 767 | Back alignment and structure |
|
| >pdb|2XAU|A Chain A, Crystal Structure Of The Prp43p Deah-Box Rna Helicase In Complex With Adp Length = 773 | Back alignment and structure |
| >pdb|3LLM|A Chain A, Crystal Structure Analysis Of A Rna Helicase Length = 235 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Length = 773 | Back alignment and structure |
|---|
Score = 691 bits (1785), Expect = 0.0
Identities = 220/494 (44%), Positives = 299/494 (60%), Gaps = 60/494 (12%)
Query: 3 RQKILQQRKSLPIASVEKRLVEEVRKNDILIIVGETGSGKTTQLPQFL-FHAGFCRDGKL 61
IL+ R+ LP+ + ++ + N I++ VGETGSGKTTQ+PQF+ F +
Sbjct: 83 YVDILKIRRELPVHAQRDEFLKLYQNNQIMVFVGETGSGKTTQIPQFVLFDEMPHLENTQ 142
Query: 62 IGVTQPRRVAAVTVAKRVAEESGVELGQRVGYSIRFDDRTSTSTRIK---------EALL 112
+ TQPRRVAA++VA+RVAEE V+LG+ VGYSIRF+++TS T +K EA+
Sbjct: 143 VACTQPRRVAAMSVAQRVAEEMDVKLGEEVGYSIRFENKTSNKTILKYMTDGMLLREAME 202
Query: 113 DPYLSRYSAIIVDEAHERTVHTDVLLGLLKKVQNARSKSADGHSNGNNNNENSDMILDRG 172
D LSRYS II+DEAHERT+ TD+L+GLLK+V R
Sbjct: 203 DHDLSRYSCIILDEAHERTLATDILMGLLKQVVKRRP----------------------- 239
Query: 173 NDTNGINTLKQCQGRKFAPLKLIIMSASLDARGFSEYFGCAKAVHVQGRQFPVEILYTLY 232
LK+IIMSA+LDA F YF A + V GR +PVE+ YT
Sbjct: 240 ------------------DLKIIIMSATLDAEKFQRYFNDAPLLAVPGRTYPVELYYTPE 281
Query: 233 PEPDYLDATLITIFQVHLDEAPGDILVFLTGQEEIESVERLVQERLLQLP--EASRKLVT 290
+ DYLD+ + T+ Q+H E GDIL+FLTG++EIE R + QL E L
Sbjct: 282 FQRDYLDSAIRTVLQIHATEEAGDILLFLTGEDEIEDAVRKISLEGDQLVREEGCGPLSV 341
Query: 291 VPIFSSLPSEQQMRVFAPAAAGF-----RKVILATNIAETSVTIPGIKYVIDPGFVKARL 345
P++ SLP QQ R+F PA RKV+++TNIAETS+TI GI YV+DPGF K ++
Sbjct: 342 YPLYGSLPPHQQQRIFEPAPESHNGRPGRKVVISTNIAETSLTIDGIVYVVDPGFSKQKV 401
Query: 346 YDPVKGMESLLVVPISKAQALQRSGRAGREGPGKCFRLYPENEFDK-LEDSTKPEIKRCN 404
Y+P +ESLLV PISKA A QR+GRAGR PGKCFRLY E F K L + + PEI R N
Sbjct: 402 YNPRIRVESLLVSPISKASAQQRAGRAGRTRPGKCFRLYTEEAFQKELIEQSYPEILRSN 461
Query: 405 LSNVILQLKALGVDDIIGFDFMEKPSRASIIKSLEQLFLLGALTDDCKLSDPVGHQMARL 464
LS+ +L+LK LG+DD++ FDFM+ P+ +++++LE+L L L D+ L+ P+G ++
Sbjct: 462 LSSTVLELKKLGIDDLVHFDFMDPPAPETMMRALEELNYLACLDDEGNLT-PLGRLASQF 520
Query: 465 PLDPIYSKALIVAE 478
PLDP+ + LI +
Sbjct: 521 PLDPMLAVMLIGSF 534
|
| >2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Length = 451 | Back alignment and structure |
|---|
| >2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Length = 431 | Back alignment and structure |
|---|
| >2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Length = 459 | Back alignment and structure |
|---|
| >2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Length = 618 | Back alignment and structure |
|---|
| >1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Length = 440 | Back alignment and structure |
|---|
| >3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Length = 235 | Back alignment and structure |
|---|
| >2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Length = 673 | Back alignment and structure |
|---|
| >3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4a92_A* 1cu1_A 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A 8ohm_A 2f55_A 1jr6_A 1onb_A Length = 666 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3i4u_A ATP-dependent RNA helicase DHX8; splicing, ATP-binding, hydrolase, mRNA processing, splicing, nucleotide-binding, nucleus, phosphoprotein, SPLI; 2.10A {Homo sapiens} Length = 270 | Back alignment and structure |
|---|
| >1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Length = 494 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 478 | |||
| 2xau_A | 773 | PRE-mRNA-splicing factor ATP-dependent RNA helica; | 100.0 | |
| 2p6r_A | 702 | Afuhel308 helicase; protein-DNA complex, SF2 helic | 100.0 | |
| 2va8_A | 715 | SSO2462, SKI2-type helicase; hydrolase, DNA repair | 100.0 | |
| 2zj8_A | 720 | DNA helicase, putative SKI2-type helicase; RECA fo | 100.0 | |
| 4f92_B | 1724 | U5 small nuclear ribonucleoprotein 200 kDa helica; | 100.0 | |
| 4f92_B | 1724 | U5 small nuclear ribonucleoprotein 200 kDa helica; | 100.0 | |
| 2db3_A | 434 | ATP-dependent RNA helicase VASA; DEAD-BOX, protein | 100.0 | |
| 3eiq_A | 414 | Eukaryotic initiation factor 4A-I; PDCD4, anti-onc | 100.0 | |
| 3fht_A | 412 | ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box | 100.0 | |
| 2i4i_A | 417 | ATP-dependent RNA helicase DDX3X; DEAD, structural | 100.0 | |
| 1hv8_A | 367 | Putative ATP-dependent RNA helicase MJ0669; RNA-bi | 100.0 | |
| 3pey_A | 395 | ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A | 100.0 | |
| 2j0s_A | 410 | ATP-dependent RNA helicase DDX48; mRNA processing, | 100.0 | |
| 3l9o_A | 1108 | ATP-dependent RNA helicase DOB1; REC-A fold, winge | 100.0 | |
| 1xti_A | 391 | Probable ATP-dependent RNA helicase P47; alpha-bet | 100.0 | |
| 2v1x_A | 591 | ATP-dependent DNA helicase Q1; DNA strand annealin | 100.0 | |
| 1s2m_A | 400 | Putative ATP-dependent RNA helicase DHH1; ATP-bind | 100.0 | |
| 2xgj_A | 1010 | ATP-dependent RNA helicase DOB1; hydrolase-RNA com | 100.0 | |
| 3fmp_B | 479 | ATP-dependent RNA helicase DDX19B; nuclear porin, | 100.0 | |
| 3i5x_A | 563 | ATP-dependent RNA helicase MSS116; protein-RNA com | 100.0 | |
| 4a4z_A | 997 | Antiviral helicase SKI2; hydrolase, ATPase, mRNA d | 100.0 | |
| 1oyw_A | 523 | RECQ helicase, ATP-dependent DNA helicase; winged | 100.0 | |
| 3sqw_A | 579 | ATP-dependent RNA helicase MSS116, mitochondrial; | 100.0 | |
| 3o8b_A | 666 | HCV NS3 protease/helicase; ntpase, RNA, translocat | 100.0 | |
| 1fuu_A | 394 | Yeast initiation factor 4A; IF4A, helicase, DEAD-b | 100.0 | |
| 2z83_A | 459 | Helicase/nucleoside triphosphatase; hydrolase, mem | 100.0 | |
| 2z0m_A | 337 | 337AA long hypothetical ATP-dependent RNA helicase | 100.0 | |
| 2jlq_A | 451 | Serine protease subunit NS3; ribonucleoprotein, nu | 100.0 | |
| 2whx_A | 618 | Serine protease/ntpase/helicase NS3; transcription | 100.0 | |
| 3fho_A | 508 | ATP-dependent RNA helicase DBP5; mRNA export, ATPa | 100.0 | |
| 3oiy_A | 414 | Reverse gyrase helicase domain; topoisomerase, DNA | 100.0 | |
| 3rc3_A | 677 | ATP-dependent RNA helicase SUPV3L1, mitochondrial; | 100.0 | |
| 1yks_A | 440 | Genome polyprotein [contains: flavivirin protease | 100.0 | |
| 2ykg_A | 696 | Probable ATP-dependent RNA helicase DDX58; hydrola | 100.0 | |
| 2v6i_A | 431 | RNA helicase; membrane, hydrolase, transmembrane, | 100.0 | |
| 2wv9_A | 673 | Flavivirin protease NS2B regulatory subunit, FLAV | 100.0 | |
| 4a2p_A | 556 | RIG-I, retinoic acid inducible protein I; hydrolas | 100.0 | |
| 1wp9_A | 494 | ATP-dependent RNA helicase, putative; ATPase, DNA | 100.0 | |
| 3tbk_A | 555 | RIG-I helicase domain; DECH helicase, ATP binding, | 100.0 | |
| 4a2q_A | 797 | RIG-I, retinoic acid inducible protein I; hydrolas | 100.0 | |
| 2eyq_A | 1151 | TRCF, transcription-repair coupling factor; MFD, S | 100.0 | |
| 1gm5_A | 780 | RECG; helicase, replication restart; HET: DNA ADP; | 100.0 | |
| 4gl2_A | 699 | Interferon-induced helicase C domain-containing P; | 100.0 | |
| 4ddu_A | 1104 | Reverse gyrase; topoisomerase, DNA supercoiling, a | 99.98 | |
| 4a2w_A | 936 | RIG-I, retinoic acid inducible protein I; hydrolas | 99.98 | |
| 1gku_B | 1054 | Reverse gyrase, TOP-RG; topoisomerase, DNA superco | 99.97 | |
| 2fwr_A | 472 | DNA repair protein RAD25; DNA unwinding, XPB, DNA | 99.97 | |
| 2oca_A | 510 | DAR protein, ATP-dependent DNA helicase UVSW; ATP- | 99.96 | |
| 1tf5_A | 844 | Preprotein translocase SECA subunit; ATPase, helic | 99.96 | |
| 3h1t_A | 590 | Type I site-specific restriction-modification syst | 99.96 | |
| 2fsf_A | 853 | Preprotein translocase SECA subunit; ATPase, DNA-R | 99.95 | |
| 3eaq_A | 212 | Heat resistant RNA dependent ATPase; DEAD box RNA | 99.94 | |
| 1nkt_A | 922 | Preprotein translocase SECA 1 subunit; preprotein | 99.94 | |
| 3dmq_A | 968 | RNA polymerase-associated protein RAPA; SWF2/SNF2, | 99.93 | |
| 3i32_A | 300 | Heat resistant RNA dependent ATPase; RNA helicase, | 99.93 | |
| 3llm_A | 235 | ATP-dependent RNA helicase A; alpha-beta-alpha, st | 99.9 | |
| 1c4o_A | 664 | DNA nucleotide excision repair enzyme UVRB; uvrabc | 99.9 | |
| 1z63_A | 500 | Helicase of the SNF2/RAD54 hamily; protein-DNA com | 99.9 | |
| 2w00_A | 1038 | HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri | 99.89 | |
| 3jux_A | 822 | Protein translocase subunit SECA; protein transloc | 99.89 | |
| 2rb4_A | 175 | ATP-dependent RNA helicase DDX25; rossmann fold, s | 99.88 | |
| 2hjv_A | 163 | ATP-dependent RNA helicase DBPA; parallel alpha-be | 99.88 | |
| 1z3i_X | 644 | Similar to RAD54-like; recombination ATPase helica | 99.87 | |
| 1t5i_A | 172 | C_terminal domain of A probable ATP-dependent RNA | 99.87 | |
| 1fuk_A | 165 | Eukaryotic initiation factor 4A; helicase, DEAD-bo | 99.87 | |
| 2jgn_A | 185 | DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp | 99.86 | |
| 2p6n_A | 191 | ATP-dependent RNA helicase DDX41; DEAD, structural | 99.86 | |
| 2yjt_D | 170 | ATP-dependent RNA helicase SRMB, regulator of ribo | 99.74 | |
| 3mwy_W | 800 | Chromo domain-containing protein 1; SWI2/SNF2 ATPa | 99.84 | |
| 2d7d_A | 661 | Uvrabc system protein B; helicase, protein-DNA-ADP | 99.84 | |
| 3iuy_A | 228 | Probable ATP-dependent RNA helicase DDX53; REC-A-l | 99.74 | |
| 1q0u_A | 219 | Bstdead; DEAD protein, RNA binding protein; 1.85A | 99.73 | |
| 2oxc_A | 230 | Probable ATP-dependent RNA helicase DDX20; DEAD, s | 99.73 | |
| 1qde_A | 224 | EIF4A, translation initiation factor 4A; DEAD box | 99.73 | |
| 2gxq_A | 207 | Heat resistant RNA dependent ATPase; RNA helicase, | 99.72 | |
| 3ly5_A | 262 | ATP-dependent RNA helicase DDX18; alpha-beta, stru | 99.72 | |
| 3fe2_A | 242 | Probable ATP-dependent RNA helicase DDX5; DEAD, AD | 99.72 | |
| 2pl3_A | 236 | Probable ATP-dependent RNA helicase DDX10; DEAD, s | 99.72 | |
| 1vec_A | 206 | ATP-dependent RNA helicase P54; DEAD-box protein, | 99.72 | |
| 3fmo_B | 300 | ATP-dependent RNA helicase DDX19B; nuclear porin, | 99.72 | |
| 3ber_A | 249 | Probable ATP-dependent RNA helicase DDX47; DEAD, A | 99.72 | |
| 3bor_A | 237 | Human initiation factor 4A-II; translation initiat | 99.71 | |
| 1t6n_A | 220 | Probable ATP-dependent RNA helicase; RECA-like fol | 99.7 | |
| 3dkp_A | 245 | Probable ATP-dependent RNA helicase DDX52; DEAD, A | 99.69 | |
| 1wrb_A | 253 | DJVLGB; RNA helicase, DEAD BOX, VASA, structural g | 99.68 | |
| 2ipc_A | 997 | Preprotein translocase SECA subunit; nucleotide bi | 99.59 | |
| 2vl7_A | 540 | XPD; helicase, unknown function; 2.25A {Sulfolobus | 99.55 | |
| 3b6e_A | 216 | Interferon-induced helicase C domain-containing P; | 99.53 | |
| 1z5z_A | 271 | Helicase of the SNF2/RAD54 family; hydrolase, reco | 99.52 | |
| 1rif_A | 282 | DAR protein, DNA helicase UVSW; bacteriophage, REC | 99.42 | |
| 2fz4_A | 237 | DNA repair protein RAD25; RECA-like domain, DNA da | 99.39 | |
| 3crv_A | 551 | XPD/RAD3 related DNA helicase; XPD helicase DNA re | 99.31 | |
| 3i4u_A | 270 | ATP-dependent RNA helicase DHX8; splicing, ATP-bin | 98.87 | |
| 1w36_D | 608 | RECD, exodeoxyribonuclease V alpha chain; recombin | 98.27 | |
| 3upu_A | 459 | ATP-dependent DNA helicase DDA; RECA-like domain, | 97.94 | |
| 3e1s_A | 574 | Exodeoxyribonuclease V, subunit RECD; alpha and be | 97.94 | |
| 4a15_A | 620 | XPD helicase, ATP-dependent DNA helicase TA0057; h | 97.6 | |
| 3kl4_A | 433 | SRP54, signal recognition 54 kDa protein; signal r | 97.55 | |
| 4a15_A | 620 | XPD helicase, ATP-dependent DNA helicase TA0057; h | 97.54 | |
| 2kjq_A | 149 | DNAA-related protein; solution structure, NESG, st | 97.4 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 97.32 | |
| 3te6_A | 318 | Regulatory protein SIR3; heterochromatin, gene sil | 97.24 | |
| 2orw_A | 184 | Thymidine kinase; TMTK, TP4A, transferase; HET: 4T | 97.22 | |
| 2b8t_A | 223 | Thymidine kinase; deoxyribonucleoside kinase, zinc | 97.22 | |
| 4b3f_X | 646 | DNA-binding protein smubp-2; hydrolase, helicase; | 97.21 | |
| 3dm5_A | 443 | SRP54, signal recognition 54 kDa protein; protein- | 97.15 | |
| 2w0m_A | 235 | SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus | 97.15 | |
| 2pt7_A | 330 | CAG-ALFA; ATPase, protein-protein complex, type IV | 97.12 | |
| 1vma_A | 306 | Cell division protein FTSY; TM0570, structural gen | 97.07 | |
| 3cpe_A | 592 | Terminase, DNA packaging protein GP17; large termi | 97.02 | |
| 2o0j_A | 385 | Terminase, DNA packaging protein GP17; nucleotide- | 97.02 | |
| 2gk6_A | 624 | Regulator of nonsense transcripts 1; UPF1, helicas | 97.01 | |
| 2px0_A | 296 | Flagellar biosynthesis protein FLHF; SRP GTPase, f | 96.92 | |
| 3tui_C | 366 | Methionine import ATP-binding protein METN; ABC-tr | 96.92 | |
| 1cr0_A | 296 | DNA primase/helicase; RECA-type protein fold, tran | 96.88 | |
| 1l8q_A | 324 | Chromosomal replication initiator protein DNAA; AA | 96.85 | |
| 3e70_C | 328 | DPA, signal recognition particle receptor; FTSY, S | 96.84 | |
| 2w58_A | 202 | DNAI, primosome component (helicase loader); ATP-b | 96.81 | |
| 2wjy_A | 800 | Regulator of nonsense transcripts 1; nonsense medi | 96.8 | |
| 2xzl_A | 802 | ATP-dependent helicase NAM7; hydrolase-RNA complex | 96.8 | |
| 1ls1_A | 295 | Signal recognition particle protein; FFH, SRP54, S | 96.79 | |
| 3jvv_A | 356 | Twitching mobility protein; hexameric P-loop ATPas | 96.75 | |
| 3h4m_A | 285 | Proteasome-activating nucleotidase; ATPase, PAN, A | 96.72 | |
| 2cvh_A | 220 | DNA repair and recombination protein RADB; filamen | 96.69 | |
| 1njg_A | 250 | DNA polymerase III subunit gamma; rossman-like fol | 96.68 | |
| 1xx6_A | 191 | Thymidine kinase; NESG, northeast structural genom | 96.67 | |
| 1z47_A | 355 | CYSA, putative ABC-transporter ATP-binding protein | 96.62 | |
| 3bos_A | 242 | Putative DNA replication factor; P-loop containing | 96.61 | |
| 3vkw_A | 446 | Replicase large subunit; alpha/beta domain, helica | 96.57 | |
| 3b85_A | 208 | Phosphate starvation-inducible protein; PHOH2, ATP | 96.57 | |
| 2j9r_A | 214 | Thymidine kinase; TK1, DNK, lasso, transferase, AT | 96.56 | |
| 1fnn_A | 389 | CDC6P, cell division control protein 6; ORC1, AAA | 96.52 | |
| 2chg_A | 226 | Replication factor C small subunit; DNA-binding pr | 96.51 | |
| 2v9p_A | 305 | Replication protein E1; AAA+ molecular motor, DNA | 96.47 | |
| 3b9q_A | 302 | Chloroplast SRP receptor homolog, alpha subunit CP | 96.38 | |
| 3syl_A | 309 | Protein CBBX; photosynthesis, rubisco activase, AA | 96.35 | |
| 2z4s_A | 440 | Chromosomal replication initiator protein DNAA; AA | 96.3 | |
| 1sxj_A | 516 | Activator 1 95 kDa subunit; clamp loader, processi | 96.28 | |
| 2qen_A | 350 | Walker-type ATPase; unknown function; HET: ADP; 2. | 96.28 | |
| 3cf0_A | 301 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 96.21 | |
| 2zpa_A | 671 | Uncharacterized protein YPFI; RNA modification enz | 96.2 | |
| 3lfu_A | 647 | DNA helicase II; SF1 helicase, ATP-binding, DNA da | 96.2 | |
| 2qz4_A | 262 | Paraplegin; AAA+, SPG7, protease, ADP, structural | 96.2 | |
| 1htw_A | 158 | HI0065; nucleotide-binding fold, structural genomi | 96.18 | |
| 2v1u_A | 387 | Cell division control protein 6 homolog; DNA repli | 96.16 | |
| 2og2_A | 359 | Putative signal recognition particle receptor; nuc | 96.15 | |
| 2r2a_A | 199 | Uncharacterized protein; zonular occludens toxin, | 96.13 | |
| 1d2n_A | 272 | N-ethylmaleimide-sensitive fusion protein; hexamer | 96.13 | |
| 1w4r_A | 195 | Thymidine kinase; type II, human, cytosolic, phosp | 96.07 | |
| 1vpl_A | 256 | ABC transporter, ATP-binding protein; TM0544, stru | 96.07 | |
| 2eyu_A | 261 | Twitching motility protein PILT; pilus retraction | 96.05 | |
| 2d2e_A | 250 | SUFC protein; ABC-ATPase, SUF protein, 310-helix, | 96.05 | |
| 1z6g_A | 218 | Guanylate kinase; structural genomics, SGC, struct | 96.04 | |
| 1zu4_A | 320 | FTSY; GTPase, signal recognition particle, SRP, re | 96.03 | |
| 2qby_A | 386 | CDC6 homolog 1, cell division control protein 6 ho | 96.02 | |
| 2gza_A | 361 | Type IV secretion system protein VIRB11; ATPase, h | 96.01 | |
| 1znw_A | 207 | Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans | 96.01 | |
| 3eie_A | 322 | Vacuolar protein sorting-associated protein 4; AAA | 95.99 | |
| 2qby_B | 384 | CDC6 homolog 3, cell division control protein 6 ho | 95.98 | |
| 1yqt_A | 538 | RNAse L inhibitor; ATP-binding cassette, ribosome | 95.98 | |
| 2cbz_A | 237 | Multidrug resistance-associated protein 1; ABC pro | 95.95 | |
| 3vfd_A | 389 | Spastin; ATPase, microtubule severing, hydrolase; | 95.95 | |
| 3bk7_A | 607 | ABC transporter ATP-binding protein; ABC ATPase, i | 95.94 | |
| 3ozx_A | 538 | RNAse L inhibitor; ATP binding cassette protein, h | 95.91 | |
| 3rlf_A | 381 | Maltose/maltodextrin import ATP-binding protein M; | 95.89 | |
| 1kgd_A | 180 | CASK, peripheral plasma membrane CASK; maguk, guan | 95.86 | |
| 3b9p_A | 297 | CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc | 95.85 | |
| 2qp9_X | 355 | Vacuolar protein sorting-associated protein 4; ATP | 95.85 | |
| 3lnc_A | 231 | Guanylate kinase, GMP kinase; ALS collaborative cr | 95.84 | |
| 4g1u_C | 266 | Hemin import ATP-binding protein HMUV; membrane tr | 95.83 | |
| 2oap_1 | 511 | GSPE-2, type II secretion system protein; hexameri | 95.81 | |
| 1g6h_A | 257 | High-affinity branched-chain amino acid transport | 95.81 | |
| 2ffh_A | 425 | Protein (FFH); SRP54, signal recognition particle, | 95.81 | |
| 3tr0_A | 205 | Guanylate kinase, GMP kinase; purines, pyrimidines | 95.79 | |
| 2orv_A | 234 | Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 | 95.78 | |
| 3nwj_A | 250 | ATSK2; P loop, shikimate, nucleoside monophosphate | 95.76 | |
| 2r6a_A | 454 | DNAB helicase, replicative helicase; replication, | 95.7 | |
| 1j8m_F | 297 | SRP54, signal recognition 54 kDa protein; signalin | 95.69 | |
| 3u61_B | 324 | DNA polymerase accessory protein 44; AAA+, ATP hyd | 95.68 | |
| 4gp7_A | 171 | Metallophosphoesterase; polynucleotide kinase phos | 95.67 | |
| 1lvg_A | 198 | Guanylate kinase, GMP kinase; transferase; HET: AD | 95.66 | |
| 1jr3_A | 373 | DNA polymerase III subunit gamma; processivity, pr | 95.64 | |
| 1sxj_E | 354 | Activator 1 40 kDa subunit; clamp loader, processi | 95.64 | |
| 1iqp_A | 327 | RFCS; clamp loader, extended AAA-ATPase domain, co | 95.63 | |
| 3lda_A | 400 | DNA repair protein RAD51; DNA binding protein, ATP | 95.59 | |
| 2it1_A | 362 | 362AA long hypothetical maltose/maltodextrin trans | 95.57 | |
| 3fvq_A | 359 | Fe(3+) IONS import ATP-binding protein FBPC; nucle | 95.55 | |
| 3tif_A | 235 | Uncharacterized ABC transporter ATP-binding prote; | 95.53 | |
| 2yyz_A | 359 | Sugar ABC transporter, ATP-binding protein; sugar | 95.5 | |
| 2yhs_A | 503 | FTSY, cell division protein FTSY; cell cycle, prot | 95.49 | |
| 3pfi_A | 338 | Holliday junction ATP-dependent DNA helicase RUVB; | 95.47 | |
| 1zp6_A | 191 | Hypothetical protein ATU3015; alpha-beta protein., | 95.45 | |
| 1v43_A | 372 | Sugar-binding transport ATP-binding protein; ATPas | 95.44 | |
| 3j16_B | 608 | RLI1P; ribosome recycling, translation, eukarya, r | 95.41 | |
| 1rj9_A | 304 | FTSY, signal recognition protein; SRP-GTPase domai | 95.4 | |
| 1xwi_A | 322 | SKD1 protein; VPS4B, AAA ATPase, protein transport | 95.39 | |
| 2j41_A | 207 | Guanylate kinase; GMP, GMK, transferase, ATP-bindi | 95.37 | |
| 1s96_A | 219 | Guanylate kinase, GMP kinase; E.coli, dimer, SAD, | 95.36 | |
| 3tau_A | 208 | Guanylate kinase, GMP kinase; structural genomics, | 95.35 | |
| 4a1f_A | 338 | DNAB helicase, replicative DNA helicase; hydrolase | 95.34 | |
| 2pcj_A | 224 | ABC transporter, lipoprotein-releasing system ATP- | 95.33 | |
| 1a5t_A | 334 | Delta prime, HOLB; zinc finger, DNA replication; 2 | 95.32 | |
| 1g29_1 | 372 | MALK, maltose transport protein MALK; ATPase, acti | 95.31 | |
| 3a00_A | 186 | Guanylate kinase, GMP kinase; domain movement, dim | 95.3 | |
| 2ehv_A | 251 | Hypothetical protein PH0186; KAIC, RECA ATPase, un | 95.29 | |
| 3hgt_A | 328 | HDA1 complex subunit 3; RECA-like domain, SWI2/SNF | 95.29 | |
| 3gfo_A | 275 | Cobalt import ATP-binding protein CBIO 1; structur | 95.26 | |
| 2q6t_A | 444 | DNAB replication FORK helicase; hydrolase; 2.90A { | 95.26 | |
| 1oxx_K | 353 | GLCV, glucose, ABC transporter, ATP binding protei | 95.24 | |
| 2ce7_A | 476 | Cell division protein FTSH; metalloprotease; HET: | 95.21 | |
| 3d8b_A | 357 | Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s | 95.21 | |
| 1uaa_A | 673 | REP helicase, protein (ATP-dependent DNA helicase | 95.2 | |
| 3ney_A | 197 | 55 kDa erythrocyte membrane protein; structural ge | 95.19 | |
| 3e2i_A | 219 | Thymidine kinase; Zn-binding, ATP-binding, DNA syn | 95.18 | |
| 3vaa_A | 199 | Shikimate kinase, SK; structural genomics, center | 95.17 | |
| 2fna_A | 357 | Conserved hypothetical protein; structural genomic | 95.16 | |
| 3pvs_A | 447 | Replication-associated recombination protein A; ma | 95.16 | |
| 4f4c_A | 1321 | Multidrug resistance protein PGP-1; ABC transporte | 95.13 | |
| 1sgw_A | 214 | Putative ABC transporter; structural genomics, P p | 95.13 | |
| 2pze_A | 229 | Cystic fibrosis transmembrane conductance regulat; | 95.12 | |
| 4b4t_J | 405 | 26S protease regulatory subunit 8 homolog; hydrola | 95.08 | |
| 1p9r_A | 418 | General secretion pathway protein E; bacterial typ | 95.06 | |
| 1sq5_A | 308 | Pantothenate kinase; P-loop, transferase; HET: PAU | 95.05 | |
| 1b0u_A | 262 | Histidine permease; ABC transporter, transport pro | 95.04 | |
| 1ji0_A | 240 | ABC transporter; ATP binding protein, structural g | 95.04 | |
| 2ff7_A | 247 | Alpha-hemolysin translocation ATP-binding protein | 95.04 | |
| 2zu0_C | 267 | Probable ATP-dependent transporter SUFC; iron-sulf | 95.01 | |
| 2olj_A | 263 | Amino acid ABC transporter; ABC domain, ATPase, hy | 94.99 | |
| 1pjr_A | 724 | PCRA; DNA repair, DNA replication, SOS response, h | 94.98 | |
| 2qm8_A | 337 | GTPase/ATPase; G protein, G3E, metallochaperone, c | 94.98 | |
| 2npi_A | 460 | Protein CLP1; CLP1-PCF11 complex, ATP binding, ter | 94.97 | |
| 2qi9_C | 249 | Vitamin B12 import ATP-binding protein BTUD; inner | 94.91 | |
| 2ghi_A | 260 | Transport protein; multidrug resistance protein, M | 94.9 | |
| 4f4c_A | 1321 | Multidrug resistance protein PGP-1; ABC transporte | 94.9 | |
| 3n70_A | 145 | Transport activator; sigma-54, ntpase, PSI, MCSG, | 94.89 | |
| 1mv5_A | 243 | LMRA, multidrug resistance ABC transporter ATP-bin | 94.87 | |
| 2j37_W | 504 | Signal recognition particle 54 kDa protein (SRP54) | 94.86 | |
| 2ihy_A | 279 | ABC transporter, ATP-binding protein; ATPase, ABC | 94.86 | |
| 3c8u_A | 208 | Fructokinase; YP_612366.1, putative fructose trans | 94.83 | |
| 2nq2_C | 253 | Hypothetical ABC transporter ATP-binding protein H | 94.81 | |
| 2ixe_A | 271 | Antigen peptide transporter 1; ABC ATPase, hydrola | 94.81 | |
| 3hu3_A | 489 | Transitional endoplasmic reticulum ATPase; VCP, tr | 94.8 | |
| 3u4q_A | 1232 | ATP-dependent helicase/nuclease subunit A; helicas | 94.77 | |
| 3aez_A | 312 | Pantothenate kinase; transferase, homodimer, COA b | 94.77 | |
| 2jeo_A | 245 | Uridine-cytidine kinase 1; UCK, transferase, ATP-b | 94.76 | |
| 2yz2_A | 266 | Putative ABC transporter ATP-binding protein TM_0; | 94.75 | |
| 1hqc_A | 324 | RUVB; extended AAA-ATPase domain, complex with nuc | 94.74 | |
| 2zan_A | 444 | Vacuolar protein sorting-associating protein 4B; S | 94.74 | |
| 4eun_A | 200 | Thermoresistant glucokinase; putative sugar kinase | 94.72 | |
| 3co5_A | 143 | Putative two-component system transcriptional RES | 94.71 | |
| 4a74_A | 231 | DNA repair and recombination protein RADA; hydrola | 94.71 | |
| 1sxj_B | 323 | Activator 1 37 kDa subunit; clamp loader, processi | 94.67 | |
| 2ewv_A | 372 | Twitching motility protein PILT; pilus retraction | 94.66 | |
| 3nh6_A | 306 | ATP-binding cassette SUB-family B member 6, mitoc; | 94.63 | |
| 1ye8_A | 178 | Protein THEP1, hypothetical UPF0334 kinase-like pr | 94.63 | |
| 2gno_A | 305 | DNA polymerase III, gamma subunit-related protein; | 94.61 | |
| 3tqc_A | 321 | Pantothenate kinase; biosynthesis of cofactors, pr | 94.6 | |
| 1n0w_A | 243 | DNA repair protein RAD51 homolog 1; DNA repair, ho | 94.56 | |
| 3asz_A | 211 | Uridine kinase; cytidine phosphorylation, transfer | 94.54 | |
| 1tf7_A | 525 | KAIC; homohexamer, hexamer, circadian clock protei | 94.5 | |
| 1in4_A | 334 | RUVB, holliday junction DNA helicase RUVB; AAA+-cl | 94.49 | |
| 2bbs_A | 290 | Cystic fibrosis transmembrane conductance regulato | 94.36 | |
| 3cmu_A | 2050 | Protein RECA, recombinase A; homologous recombinat | 94.35 | |
| 1jbk_A | 195 | CLPB protein; beta barrel, chaperone; 1.80A {Esche | 94.32 | |
| 1kag_A | 173 | SKI, shikimate kinase I; transferase, structural g | 94.32 | |
| 3uie_A | 200 | Adenylyl-sulfate kinase 1, chloroplastic; rossmann | 94.32 | |
| 2i3b_A | 189 | HCR-ntpase, human cancer-related ntpase; AAA, ross | 94.29 | |
| 2bdt_A | 189 | BH3686; alpha-beta protein, structural genomics, P | 94.26 | |
| 2xxa_A | 433 | Signal recognition particle protein; protein trans | 94.25 | |
| 4b4t_H | 467 | 26S protease regulatory subunit 7 homolog; hydrola | 94.24 | |
| 2qor_A | 204 | Guanylate kinase; phosphotransferase, purine metab | 94.18 | |
| 2onk_A | 240 | Molybdate/tungstate ABC transporter, ATP-binding p | 94.16 | |
| 1knq_A | 175 | Gluconate kinase; ALFA/beta structure, transferase | 94.16 | |
| 4b4t_I | 437 | 26S protease regulatory subunit 4 homolog; hydrola | 94.03 | |
| 2dr3_A | 247 | UPF0273 protein PH0284; RECA superfamily ATPase, h | 94.02 | |
| 2pjz_A | 263 | Hypothetical protein ST1066; ATP binding protein, | 93.97 | |
| 2v3c_C | 432 | SRP54, signal recognition 54 kDa protein; nucleoti | 93.95 | |
| 3d31_A | 348 | Sulfate/molybdate ABC transporter, ATP-binding pro | 93.9 | |
| 2p65_A | 187 | Hypothetical protein PF08_0063; CLPB, malaria, str | 93.83 | |
| 3gd7_A | 390 | Fusion complex of cystic fibrosis transmembrane co | 93.77 | |
| 1w5s_A | 412 | Origin recognition complex subunit 2 ORC2; replica | 93.75 | |
| 1tq4_A | 413 | IIGP1, interferon-inducible GTPase; interferon gam | 93.62 | |
| 2zts_A | 251 | Putative uncharacterized protein PH0186; KAIC like | 93.54 | |
| 2obl_A | 347 | ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O | 93.52 | |
| 3b5x_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 93.52 | |
| 2bbw_A | 246 | Adenylate kinase 4, AK4; nucleotide kinase, nucleo | 93.51 | |
| 1qvr_A | 854 | CLPB protein; coiled coil, AAA ATPase, chaperone; | 93.46 | |
| 3trf_A | 185 | Shikimate kinase, SK; amino acid biosynthesis, tra | 93.43 | |
| 1kht_A | 192 | Adenylate kinase; phosphotransferase, signaling pr | 93.42 | |
| 2dpy_A | 438 | FLII, flagellum-specific ATP synthase; beta barrel | 93.42 | |
| 1pui_A | 210 | ENGB, probable GTP-binding protein ENGB; structura | 93.41 | |
| 2qag_B | 427 | Septin-6, protein NEDD5; cell cycle, cell division | 93.4 | |
| 1qhx_A | 178 | CPT, protein (chloramphenicol phosphotransferase); | 93.4 | |
| 1ex7_A | 186 | Guanylate kinase; substrate-induced FIT, domain mo | 93.39 | |
| 3cf2_A | 806 | TER ATPase, transitional endoplasmic reticulum ATP | 93.32 | |
| 3a8t_A | 339 | Adenylate isopentenyltransferase; rossmann fold pr | 93.22 | |
| 3lw7_A | 179 | Adenylate kinase related protein (ADKA-like); AMP, | 93.15 | |
| 3cm0_A | 186 | Adenylate kinase; ATP-binding, cytoplasm, nucleoti | 93.13 | |
| 3kb2_A | 173 | SPBC2 prophage-derived uncharacterized protein YOR | 93.11 | |
| 2ze6_A | 253 | Isopentenyl transferase; crown GALL tumor, cytokin | 93.08 | |
| 4e22_A | 252 | Cytidylate kinase; P-loop, CMP/ATP binding, transf | 93.03 | |
| 3exa_A | 322 | TRNA delta(2)-isopentenylpyrophosphate transferase | 93.02 | |
| 2f1r_A | 171 | Molybdopterin-guanine dinucleotide biosynthesis pr | 93.01 | |
| 1nlf_A | 279 | Regulatory protein REPA; replicative DNA helicase | 92.99 | |
| 2qmh_A | 205 | HPR kinase/phosphorylase; V267F mutation, ATP-bind | 92.98 | |
| 2qt1_A | 207 | Nicotinamide riboside kinase 1; non-protein kinase | 92.94 | |
| 1tf7_A | 525 | KAIC; homohexamer, hexamer, circadian clock protei | 92.94 | |
| 1cke_A | 227 | CK, MSSA, protein (cytidine monophosphate kinase); | 92.89 | |
| 2bwj_A | 199 | Adenylate kinase 5; phosphoryl transfer reaction, | 92.88 | |
| 1y63_A | 184 | LMAJ004144AAA protein; structural genomics, protei | 92.87 | |
| 3kta_A | 182 | Chromosome segregation protein SMC; structural mai | 92.87 | |
| 1g5t_A | 196 | COB(I)alamin adenosyltransferase; P-loop protein, | 92.83 | |
| 3umf_A | 217 | Adenylate kinase; rossmann fold, transferase; 2.05 | 92.83 | |
| 1gm5_A | 780 | RECG; helicase, replication restart; HET: DNA ADP; | 92.81 | |
| 1rz3_A | 201 | Hypothetical protein rbstp0775; MCSG, structural g | 92.79 | |
| 1svm_A | 377 | Large T antigen; AAA+ fold, viral protein; HET: AT | 92.68 | |
| 1nij_A | 318 | Hypothetical protein YJIA; structural genomics, P- | 92.63 | |
| 2pez_A | 179 | Bifunctional 3'-phosphoadenosine 5'- phosphosulfat | 92.63 | |
| 3iij_A | 180 | Coilin-interacting nuclear ATPase protein; alpha a | 92.6 | |
| 1f2t_A | 149 | RAD50 ABC-ATPase; DNA double-strand break repair, | 92.59 | |
| 2qgz_A | 308 | Helicase loader, putative primosome component; str | 92.57 | |
| 2c95_A | 196 | Adenylate kinase 1; transferase, AP4A, nucleotide | 92.56 | |
| 2yv5_A | 302 | YJEQ protein; hydrolase, GTPase, permutation, stru | 92.51 | |
| 3sop_A | 270 | Neuronal-specific septin-3; hydrolase; HET: GDP; 2 | 92.5 | |
| 3k1j_A | 604 | LON protease, ATP-dependent protease LON; ATP-bind | 92.49 | |
| 1sxj_C | 340 | Activator 1 40 kDa subunit; clamp loader, processi | 92.48 | |
| 4ag6_A | 392 | VIRB4 ATPase, type IV secretory pathway VIRB4 comp | 92.44 | |
| 2v54_A | 204 | DTMP kinase, thymidylate kinase; nucleotide biosyn | 92.41 | |
| 1ly1_A | 181 | Polynucleotide kinase; PNK, phosphatase, transfera | 92.4 | |
| 2rhm_A | 193 | Putative kinase; P-loop containing nucleoside trip | 92.39 | |
| 3t61_A | 202 | Gluconokinase; PSI-biology, structural genomics, p | 92.27 | |
| 1gvn_B | 287 | Zeta; postsegregational killing system, plasmid; 1 | 92.14 | |
| 1m7g_A | 211 | Adenylylsulfate kinase; APS kinase, transferase, s | 92.11 | |
| 2r44_A | 331 | Uncharacterized protein; putative ATPase, structur | 92.09 | |
| 3foz_A | 316 | TRNA delta(2)-isopentenylpyrophosphate transferas; | 92.08 | |
| 1yqt_A | 538 | RNAse L inhibitor; ATP-binding cassette, ribosome | 92.07 | |
| 1e9r_A | 437 | Conjugal transfer protein TRWB; coupling protein, | 92.06 | |
| 1v5w_A | 343 | DMC1, meiotic recombination protein DMC1/LIM15 hom | 92.05 | |
| 2vp4_A | 230 | Deoxynucleoside kinase; ATP-binding, DNA synthesis | 92.04 | |
| 1pzn_A | 349 | RAD51, DNA repair and recombination protein RAD51, | 92.02 | |
| 1zd8_A | 227 | GTP:AMP phosphotransferase mitochondrial; ATP:AMP | 91.98 | |
| 1tev_A | 196 | UMP-CMP kinase; ploop, NMP binding region, LID reg | 91.96 | |
| 2bjv_A | 265 | PSP operon transcriptional activator; AAA, transcr | 91.9 | |
| 1lv7_A | 257 | FTSH; alpha/beta domain, four helix bundle, hydrol | 91.86 | |
| 1ofh_A | 310 | ATP-dependent HSL protease ATP-binding subunit HSL | 91.84 | |
| 1ixz_A | 254 | ATP-dependent metalloprotease FTSH; AAA domain fol | 91.84 | |
| 3b60_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 91.83 | |
| 3sr0_A | 206 | Adenylate kinase; phosphoryl transfer analogue, AL | 91.83 | |
| 2yvu_A | 186 | Probable adenylyl-sulfate kinase; transferase, str | 91.83 | |
| 2if2_A | 204 | Dephospho-COA kinase; alpha-beta protein, structur | 91.82 | |
| 3tlx_A | 243 | Adenylate kinase 2; structural genomics, structura | 91.81 | |
| 2rcn_A | 358 | Probable GTPase ENGC; YJEQ, circularly permuted, G | 91.75 | |
| 3hr8_A | 356 | Protein RECA; alpha and beta proteins (A/B, A+B), | 91.73 | |
| 2d7d_A | 661 | Uvrabc system protein B; helicase, protein-DNA-ADP | 91.68 | |
| 3nbx_X | 500 | ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu | 91.66 | |
| 1jjv_A | 206 | Dephospho-COA kinase; P-loop nucleotide-binding fo | 91.64 | |
| 2plr_A | 213 | DTMP kinase, probable thymidylate kinase; TMP-bind | 91.61 | |
| 2z43_A | 324 | DNA repair and recombination protein RADA; archaea | 91.6 | |
| 3hws_A | 363 | ATP-dependent CLP protease ATP-binding subunit CL; | 91.55 | |
| 1lw7_A | 365 | Transcriptional regulator NADR; NMN, NMN adenylyl | 91.51 | |
| 3bh0_A | 315 | DNAB-like replicative helicase; ATPase, replicatio | 91.49 | |
| 2wwf_A | 212 | Thymidilate kinase, putative; transferase, malaria | 91.47 | |
| 1zuh_A | 168 | Shikimate kinase; alpha-beta protein, transferase; | 91.41 | |
| 1aky_A | 220 | Adenylate kinase; ATP:AMP phosphotransferase, myok | 91.39 | |
| 4fcw_A | 311 | Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 | 91.38 | |
| 3qf4_B | 598 | Uncharacterized ABC transporter ATP-binding prote | 91.37 | |
| 3fb4_A | 216 | Adenylate kinase; psychrophIle, phosphotransferase | 91.35 | |
| 3dl0_A | 216 | Adenylate kinase; phosphotransferase, zinc coordin | 91.35 | |
| 1u0l_A | 301 | Probable GTPase ENGC; permutation, OB-fold, zinc-f | 91.31 | |
| 2jaq_A | 205 | Deoxyguanosine kinase; transferase, deoxyribonucle | 91.29 | |
| 4a82_A | 578 | Cystic fibrosis transmembrane conductance regulat; | 91.25 | |
| 3qf7_A | 365 | RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. | 91.21 | |
| 1nn5_A | 215 | Similar to deoxythymidylate kinase (thymidylate K; | 91.21 | |
| 2cdn_A | 201 | Adenylate kinase; phosphoryl transfer, associative | 91.21 | |
| 1nks_A | 194 | Adenylate kinase; thermophilic, transferase; HET: | 91.2 | |
| 1np6_A | 174 | Molybdopterin-guanine dinucleotide biosynthesis pr | 91.17 | |
| 3j16_B | 608 | RLI1P; ribosome recycling, translation, eukarya, r | 91.15 | |
| 2zr9_A | 349 | Protein RECA, recombinase A; recombination, RECA m | 91.14 | |
| 1iy2_A | 278 | ATP-dependent metalloprotease FTSH; AAA domain fol | 91.12 | |
| 3d3q_A | 340 | TRNA delta(2)-isopentenylpyrophosphate transferase | 91.12 | |
| 1via_A | 175 | Shikimate kinase; structural genomics, transferase | 91.12 | |
| 3crm_A | 323 | TRNA delta(2)-isopentenylpyrophosphate transferase | 91.1 | |
| 2yl4_A | 595 | ATP-binding cassette SUB-family B member 10, mitoc | 91.06 | |
| 1zak_A | 222 | Adenylate kinase; ATP:AMP-phosphotransferase, tran | 90.97 | |
| 3bk7_A | 607 | ABC transporter ATP-binding protein; ABC ATPase, i | 90.96 | |
| 1xjc_A | 169 | MOBB protein homolog; structural genomics, midwest | 90.91 | |
| 1odf_A | 290 | YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser | 90.88 | |
| 2ius_A | 512 | DNA translocase FTSK; nucleotide-binding, chromoso | 90.76 | |
| 4eaq_A | 229 | DTMP kinase, thymidylate kinase; structural genomi | 90.74 | |
| 2vli_A | 183 | Antibiotic resistance protein; transferase, tunica | 90.65 | |
| 3ozx_A | 538 | RNAse L inhibitor; ATP binding cassette protein, h | 90.62 | |
| 1e6c_A | 173 | Shikimate kinase; phosphoryl transfer, ADP, shikim | 90.53 | |
| 3qf4_A | 587 | ABC transporter, ATP-binding protein; multidrug tr | 90.5 | |
| 2x8a_A | 274 | Nuclear valosin-containing protein-like; nuclear p | 90.47 | |
| 1gtv_A | 214 | TMK, thymidylate kinase; transferase, transferase | 90.46 | |
| 1ukz_A | 203 | Uridylate kinase; transferase; HET: ADP AMP; 1.90A | 90.4 | |
| 3be4_A | 217 | Adenylate kinase; malaria, cryptosporidium parvum | 90.27 | |
| 2i1q_A | 322 | DNA repair and recombination protein RADA; ATPase, | 90.23 | |
| 1qf9_A | 194 | UMP/CMP kinase, protein (uridylmonophosphate/cytid | 90.22 | |
| 2p67_A | 341 | LAO/AO transport system kinase; ARGK, structural G | 90.18 | |
| 3io5_A | 333 | Recombination and repair protein; storage dimer, i | 90.17 | |
| 2iyv_A | 184 | Shikimate kinase, SK; transferase, aromatic amino | 90.11 | |
| 3eph_A | 409 | TRNA isopentenyltransferase; transferase, alternat | 90.07 | |
| 2eyq_A | 1151 | TRCF, transcription-repair coupling factor; MFD, S | 90.07 | |
| 3qks_A | 203 | DNA double-strand break repair RAD50 ATPase; RECA- | 90.06 | |
| 2z0h_A | 197 | DTMP kinase, thymidylate kinase; ATP-binding, nucl | 90.05 | |
| 1e4v_A | 214 | Adenylate kinase; transferase(phosphotransferase); | 90.05 | |
| 2pt5_A | 168 | Shikimate kinase, SK; aromatic amino acid biosynth | 90.01 | |
| 2pbr_A | 195 | DTMP kinase, thymidylate kinase; transferase, nucl | 90.0 | |
| 1ak2_A | 233 | Adenylate kinase isoenzyme-2; nucleoside monophosp | 89.99 | |
| 1uf9_A | 203 | TT1252 protein; P-loop, nucleotide binding domain, | 89.88 | |
| 3bgw_A | 444 | DNAB-like replicative helicase; ATPase, replicatio | 89.72 | |
| 2p5t_B | 253 | PEZT; postsegregational killing system, phosphoryl | 89.68 | |
| 1t9h_A | 307 | YLOQ, probable GTPase ENGC; N-terminal beta-barrel | 89.67 | |
| 2xb4_A | 223 | Adenylate kinase; ATP-binding, nucleotide-binding, | 89.65 | |
| 1oix_A | 191 | RAS-related protein RAB-11A; small G protein, intr | 89.64 | |
| 1sxj_D | 353 | Activator 1 41 kDa subunit; clamp loader, processi | 89.64 | |
| 3ux8_A | 670 | Excinuclease ABC, A subunit; UVRA, nucleotide exci | 89.61 | |
| 3ux8_A | 670 | Excinuclease ABC, A subunit; UVRA, nucleotide exci | 89.57 | |
| 1vht_A | 218 | Dephospho-COA kinase; structural genomics, transfe | 89.45 | |
| 1u94_A | 356 | RECA protein, recombinase A; homologous recombinat | 89.37 | |
| 1ojl_A | 304 | Transcriptional regulatory protein ZRAR; response | 89.37 | |
| 2f9l_A | 199 | RAB11B, member RAS oncogene family; RAB11B GTPase, | 89.32 | |
| 1c9k_A | 180 | COBU, adenosylcobinamide kinase; alpha/beta struct | 89.28 | |
| 3euj_A | 483 | Chromosome partition protein MUKB, linker; MUKB, M | 89.25 | |
| 1tue_A | 212 | Replication protein E1; helicase, replication, E1E | 89.25 | |
| 2iw3_A | 986 | Elongation factor 3A; acetylation, ATP-binding, pr | 89.24 | |
| 3a4m_A | 260 | L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m | 89.14 | |
| 3t15_A | 293 | Ribulose bisphosphate carboxylase/oxygenase activ | 89.1 | |
| 3cmu_A | 2050 | Protein RECA, recombinase A; homologous recombinat | 88.79 | |
| 3uk6_A | 368 | RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding | 88.79 | |
| 2oxc_A | 230 | Probable ATP-dependent RNA helicase DDX20; DEAD, s | 88.78 | |
| 2www_A | 349 | Methylmalonic aciduria type A protein, mitochondri | 88.73 | |
| 3qkt_A | 339 | DNA double-strand break repair RAD50 ATPase; RECA- | 88.68 | |
| 3r20_A | 233 | Cytidylate kinase; structural genomics, seattle st | 88.46 | |
| 4tmk_A | 213 | Protein (thymidylate kinase); ATP:DTMP phosphotran | 88.46 | |
| 3cf2_A | 806 | TER ATPase, transitional endoplasmic reticulum ATP | 88.36 | |
| 3auy_A | 371 | DNA double-strand break repair RAD50 ATPase; DNA r | 88.29 | |
| 2grj_A | 192 | Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp | 88.26 | |
| 4edh_A | 213 | DTMP kinase, thymidylate kinase; structural genomi | 88.24 | |
| 1q3t_A | 236 | Cytidylate kinase; nucleotide monophosphate kinase | 88.09 | |
| 1wb9_A | 800 | DNA mismatch repair protein MUTS; DNA-binding, ATP | 88.03 | |
| 3cr8_A | 552 | Sulfate adenylyltranferase, adenylylsulfate kinase | 88.02 | |
| 3ice_A | 422 | Transcription termination factor RHO; transcriptio | 87.92 | |
| 1vec_A | 206 | ATP-dependent RNA helicase P54; DEAD-box protein, | 87.88 | |
| 3lv8_A | 236 | DTMP kinase, thymidylate kinase; structural genomi | 87.82 | |
| 2gj8_A | 172 | MNME, tRNA modification GTPase TRME; G-domain dime | 87.77 | |
| 3pxg_A | 468 | Negative regulator of genetic competence CLPC/MEC; | 87.75 | |
| 3tmk_A | 216 | Thymidylate kinase; phosphotransferase; HET: T5A; | 87.65 | |
| 3v9p_A | 227 | DTMP kinase, thymidylate kinase; ssgcid, STRU geno | 87.64 | |
| 1xp8_A | 366 | RECA protein, recombinase A; recombination, radior | 87.58 | |
| 2wji_A | 165 | Ferrous iron transport protein B homolog; membrane | 87.58 | |
| 1ewq_A | 765 | DNA mismatch repair protein MUTS; multiple domains | 87.54 | |
| 1t6n_A | 220 | Probable ATP-dependent RNA helicase; RECA-like fol | 87.52 | |
| 1w1w_A | 430 | Structural maintenance of chromosome 1; cohesin, c | 87.47 | |
| 3m6a_A | 543 | ATP-dependent protease LA 1; alpha, beta, ATP-bind | 87.47 | |
| 3oiy_A | 414 | Reverse gyrase helicase domain; topoisomerase, DNA | 87.45 | |
| 3thx_B | 918 | DNA mismatch repair protein MSH3; ABC family ATPas | 87.37 | |
| 4b4t_M | 434 | 26S protease regulatory subunit 6A; hydrolase, AAA | 87.36 | |
| 2dyk_A | 161 | GTP-binding protein; GTPase, ribosome-binding prot | 87.34 | |
| 1q57_A | 503 | DNA primase/helicase; dntpase, DNA replication, tr | 87.25 | |
| 4aby_A | 415 | DNA repair protein RECN; hydrolase, double strand | 87.21 | |
| 2vhj_A | 331 | Ntpase P4, P4; non- hydrolysable ATP analogue, hyd | 87.16 | |
| 2o5v_A | 359 | DNA replication and repair protein RECF; ABC ATPas | 87.14 | |
| 1e69_A | 322 | Chromosome segregation SMC protein; structural mai | 87.07 | |
| 2ce2_X | 166 | GTPase HRAS; signaling protein, guanine nucleotide | 86.98 | |
| 1um8_A | 376 | ATP-dependent CLP protease ATP-binding subunit CL; | 86.92 | |
| 4b4t_L | 437 | 26S protease subunit RPT4; hydrolase, AAA-atpases, | 86.91 | |
| 1z2a_A | 168 | RAS-related protein RAB-23; RAB GTPase, vesicular | 86.89 | |
| 4b4t_K | 428 | 26S protease regulatory subunit 6B homolog; hydrol | 86.63 | |
| 3ake_A | 208 | Cytidylate kinase; CMP kinase, CMP complex, open c | 86.61 | |
| 2iw3_A | 986 | Elongation factor 3A; acetylation, ATP-binding, pr | 86.6 | |
| 1uj2_A | 252 | Uridine-cytidine kinase 2; alpha/beta mononucleoti | 86.55 | |
| 2ged_A | 193 | SR-beta, signal recognition particle receptor beta | 86.52 | |
| 1ltq_A | 301 | Polynucleotide kinase; phosphatase, alpha/beta, P- | 86.42 | |
| 2wjg_A | 188 | FEOB, ferrous iron transport protein B homolog; me | 86.28 | |
| 1z0j_A | 170 | RAB-22, RAS-related protein RAB-22A; RAB GTPase, R | 86.25 | |
| 1ky3_A | 182 | GTP-binding protein YPT7P; vesicular traffic, GTP | 86.24 | |
| 1kao_A | 167 | RAP2A; GTP-binding protein, small G protein, GDP, | 86.19 | |
| 2f6r_A | 281 | COA synthase, bifunctional coenzyme A synthase; 18 | 86.17 | |
| 3tqf_A | 181 | HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co | 86.14 | |
| 1g8p_A | 350 | Magnesium-chelatase 38 kDa subunit; parallel beta | 86.13 | |
| 1g16_A | 170 | RAS-related protein SEC4; G protein RAB, signaling | 86.06 | |
| 2zej_A | 184 | Dardarin, leucine-rich repeat kinase 2; parkinson' | 86.03 | |
| 1ek0_A | 170 | Protein (GTP-binding protein YPT51); vesicular tra | 86.03 | |
| 3thx_A | 934 | DNA mismatch repair protein MSH2; ABC family ATPas | 85.99 | |
| 2c9o_A | 456 | RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- | 85.98 | |
| 2r62_A | 268 | Cell division protease FTSH homolog; ATPase domain | 85.93 | |
| 1u8z_A | 168 | RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH | 85.87 | |
| 1a7j_A | 290 | Phosphoribulokinase; transferase, calvin cycle; 2. | 85.82 | |
| 2chq_A | 319 | Replication factor C small subunit; DNA-binding pr | 85.78 | |
| 1qhl_A | 227 | Protein (cell division protein MUKB); SMC, chromos | 85.77 | |
| 1qde_A | 224 | EIF4A, translation initiation factor 4A; DEAD box | 85.74 | |
| 1wms_A | 177 | RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p | 85.71 | |
| 3g5u_A | 1284 | MCG1178, multidrug resistance protein 1A; P-glycop | 85.7 | |
| 2ga8_A | 359 | Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn | 85.68 | |
| 2erx_A | 172 | GTP-binding protein DI-RAS2; GTP hydrolysis, trans | 85.63 | |
| 2iut_A | 574 | DNA translocase FTSK; nucleotide-binding, chromoso | 85.59 | |
| 1svi_A | 195 | GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro | 85.58 | |
| 3fe2_A | 242 | Probable ATP-dependent RNA helicase DDX5; DEAD, AD | 85.47 |
| >2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* | Back alignment and structure |
|---|
Probab=100.00 E-value=6.6e-69 Score=572.66 Aligned_cols=434 Identities=49% Similarity=0.799 Sum_probs=390.0
Q ss_pred chhHHHhhhcCCcHHHHHHHHHHHhcCCEEEEEcCCCCcHHhHHHHHHhhcCccCC-CcEEEEecchHHHHHHHHHHHHH
Q 011751 3 RQKILQQRKSLPIASVEKRLVEEVRKNDILIIVGETGSGKTTQLPQFLFHAGFCRD-GKLIGVTQPRRVAAVTVAKRVAE 81 (478)
Q Consensus 3 ~~~~~~~~~~~~~~~~q~~~~~~l~~~~~~~i~apTGsGKT~~~~~~~~~~~~~~~-~~~i~~~~p~~~l~~~~~~~~~~ 81 (478)
+.+++..+..+|.+..|+.+...+..+++++++||||||||+++|+++.......+ +..+++++|+++++.++++++..
T Consensus 83 ~~~~l~~r~~lP~~~q~~~i~~~l~~~~~vii~gpTGSGKTtllp~ll~~~~~~~~~g~~ilvl~P~r~La~q~~~~l~~ 162 (773)
T 2xau_A 83 YVDILKIRRELPVHAQRDEFLKLYQNNQIMVFVGETGSGKTTQIPQFVLFDEMPHLENTQVACTQPRRVAAMSVAQRVAE 162 (773)
T ss_dssp HHHHHHHHTTSGGGGGHHHHHHHHHHCSEEEEECCTTSSHHHHHHHHHHHHHCGGGGTCEEEEEESCHHHHHHHHHHHHH
T ss_pred HHHHHHHhhcCChHHHHHHHHHHHhCCCeEEEECCCCCCHHHHHHHHHHHhccccCCCceEEecCchHHHHHHHHHHHHH
Confidence 45667777889999999999999999999999999999999999999876554332 55799999999999999999999
Q ss_pred HhCCcCCCEEEEEEeecccC---------ChhhhHHHHhhCcCcCCCcceEeecccccchhhhHHHHHHHHHHHhhcccc
Q 011751 82 ESGVELGQRVGYSIRFDDRT---------STSTRIKEALLDPYLSRYSAIIVDEAHERTVHTDVLLGLLKKVQNARSKSA 152 (478)
Q Consensus 82 ~~~~~~~~~vg~~~~~~~~~---------~~~~~~~~~l~~~~l~~~~~lIiDE~H~r~~~~~~~l~~l~~~~~~~~~~~ 152 (478)
..+..++..+|+....+... +.......++.+..+.++++||+||+|+|..+.+.++.+++.+...+
T Consensus 163 ~~~~~v~~~vG~~i~~~~~~~~~~~I~v~T~G~l~r~l~~~~~l~~~~~lIlDEah~R~ld~d~~~~~l~~l~~~~---- 238 (773)
T 2xau_A 163 EMDVKLGEEVGYSIRFENKTSNKTILKYMTDGMLLREAMEDHDLSRYSCIILDEAHERTLATDILMGLLKQVVKRR---- 238 (773)
T ss_dssp HTTCCBTTTEEEEETTEEECCTTCSEEEEEHHHHHHHHHHSTTCTTEEEEEECSGGGCCHHHHHHHHHHHHHHHHC----
T ss_pred HhCCchhheecceeccccccCCCCCEEEECHHHHHHHHhhCccccCCCEEEecCccccccchHHHHHHHHHHHHhC----
Confidence 99988999999876554322 22233345666788999999999999999999999999999887665
Q ss_pred cCCCCCCCCCCCchhhhccCCCCCCccccccccCCCCCCceEEEEcCCCChhHHHhhhCCCCeEEeCCccccceEEecCC
Q 011751 153 DGHSNGNNNNENSDMILDRGNDTNGINTLKQCQGRKFAPLKLIIMSASLDARGFSEYFGCAKAVHVQGRQFPVEILYTLY 232 (478)
Q Consensus 153 ~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~lSAT~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 232 (478)
++.++|+||||++.+.+++|+++.+++.++++.+|++.+|...
T Consensus 239 -------------------------------------~~~~iIl~SAT~~~~~l~~~~~~~~vi~v~gr~~pv~~~~~~~ 281 (773)
T 2xau_A 239 -------------------------------------PDLKIIIMSATLDAEKFQRYFNDAPLLAVPGRTYPVELYYTPE 281 (773)
T ss_dssp -------------------------------------TTCEEEEEESCSCCHHHHHHTTSCCEEECCCCCCCEEEECCSS
T ss_pred -------------------------------------CCceEEEEeccccHHHHHHHhcCCCcccccCcccceEEEEecC
Confidence 6789999999999999999999999999999999999999999
Q ss_pred CCcchHHHHHHHHHHhhhcCCCCCEEEEcCCHHHHHHHHHHHHHHHhcC--CCCCCCeEEEEccCCCCHHHHHhhcCcCC
Q 011751 233 PEPDYLDATLITIFQVHLDEAPGDILVFLTGQEEIESVERLVQERLLQL--PEASRKLVTVPIFSSLPSEQQMRVFAPAA 310 (478)
Q Consensus 233 ~~~~~~~~~~~~~~~~~~~~~~~~~LVF~~s~~~~~~l~~~l~~~~~~~--~~~~~~~~v~~~h~~l~~~~r~~i~~~f~ 310 (478)
+..++....+..+..++...+++++||||+++++++.+++.|.+..... .....++.+.++||+|++++|..+++.|+
T Consensus 282 ~~~~~~~~~l~~l~~~~~~~~~g~iLVF~~~~~~i~~l~~~L~~~~~~l~~~~~~~~~~v~~lhg~l~~~eR~~v~~~f~ 361 (773)
T 2xau_A 282 FQRDYLDSAIRTVLQIHATEEAGDILLFLTGEDEIEDAVRKISLEGDQLVREEGCGPLSVYPLYGSLPPHQQQRIFEPAP 361 (773)
T ss_dssp CCSCHHHHHHHHHHHHHHHSCSCEEEEECSCHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECTTCCHHHHGGGGSCCC
T ss_pred CchhHHHHHHHHHHHHHHhcCCCCEEEECCCHHHHHHHHHHHHHHHHhhcccccCCCeEEEEeCCCCCHHHHHHHHhhcc
Confidence 9889988888888888877778999999999999999999998643221 11223788999999999999999999999
Q ss_pred -----CCccEEEEeccccccccccCCeEEEEeCCcccceeecCCCCcccceeeecCHHHHHHhhcccCCCCCCeEEEecC
Q 011751 311 -----AGFRKVILATNIAETSVTIPGIKYVIDPGFVKARLYDPVKGMESLLVVPISKAQALQRSGRAGREGPGKCFRLYP 385 (478)
Q Consensus 311 -----~g~~~vlvaT~~~~~Gvdip~v~~VI~~g~~~~~~yd~~~~~~~~~~~~~s~~~~~Qr~GRaGR~~~G~~~~l~~ 385 (478)
+|.++|||||+++++|||+|+|++|||+|+.+.+.||+..++..+...|.|.++|.||+|||||.++|.||+||+
T Consensus 362 ~~~~~~g~~kVlVAT~iae~GidIp~v~~VId~g~~k~~~yd~~~g~~~L~~~p~S~~s~~QR~GRaGR~~~G~~~~l~~ 441 (773)
T 2xau_A 362 ESHNGRPGRKVVISTNIAETSLTIDGIVYVVDPGFSKQKVYNPRIRVESLLVSPISKASAQQRAGRAGRTRPGKCFRLYT 441 (773)
T ss_dssp CCSSSSCCEEEEEECTHHHHTCCCTTEEEEEECSEEEEEEEETTTTEEEEEEEECCHHHHHHHHHGGGSSSSEEEEESSC
T ss_pred cccCCCCceEEEEeCcHHHhCcCcCCeEEEEeCCCccceeeccccCccccccccCCHHHHHhhccccCCCCCCEEEEEec
Confidence 999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HhhH-hcccCCCCCcccccCchHHHHHHHHcCCCCCCCccCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHhccC
Q 011751 386 ENEF-DKLEDSTKPEIKRCNLSNVILQLKALGVDDIIGFDFMEKPSRASIIKSLEQLFLLGALTDDCKLSDPVGHQMARL 464 (478)
Q Consensus 386 ~~~~-~~~~~~~~pei~~~~l~~~~l~~~~~~~~~~~~~~~~~~p~~~~l~~al~~L~~~g~l~~~~~~t~~lG~~~~~~ 464 (478)
++++ +.+.+...|||.+.+|.+++|+++.+|+.+...|+|++||+.+.+..|++.|..+|+||+++++|+ +|+.|+.+
T Consensus 442 ~~~~~~~l~~~~~pEi~r~~L~~~~L~l~~~gi~~~~~f~~~~~p~~~~i~~a~~~L~~lgald~~~~lT~-lG~~~a~~ 520 (773)
T 2xau_A 442 EEAFQKELIEQSYPEILRSNLSSTVLELKKLGIDDLVHFDFMDPPAPETMMRALEELNYLACLDDEGNLTP-LGRLASQF 520 (773)
T ss_dssp HHHHHHTSCSSCCCGGGGSCCHHHHHHHHHTTCCCGGGCCCSSCCCHHHHHHHHHHHHHTTSBCTTSCBCH-HHHHHTTS
T ss_pred HHHhcccccccCCCccccCcHHHHHHHHHHcCCCChhhccccCCCcHHHHHHHHHHHHHcCCcccCCCcCh-hhhhhccc
Confidence 9999 569999999999999999999999999999999999999999999999999999999999999996 99999999
Q ss_pred CCCHhhhchheecC
Q 011751 465 PLDPIYSKALIVAE 478 (478)
Q Consensus 465 ~~~p~~~~~l~~~~ 478 (478)
|++|++||||+.|+
T Consensus 521 pl~p~~~~~l~~~~ 534 (773)
T 2xau_A 521 PLDPMLAVMLIGSF 534 (773)
T ss_dssp SSCHHHHHHHHHGG
T ss_pred cCCHHHHHHHHhhc
Confidence 99999999999763
|
| >2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A | Back alignment and structure |
|---|
| >2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* | Back alignment and structure |
|---|
| >4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B | Back alignment and structure |
|---|
| >4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B | Back alignment and structure |
|---|
| >2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B | Back alignment and structure |
|---|
| >2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* | Back alignment and structure |
|---|
| >2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A | Back alignment and structure |
|---|
| >3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A | Back alignment and structure |
|---|
| >2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* | Back alignment and structure |
|---|
| >1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A | Back alignment and structure |
|---|
| >2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} | Back alignment and structure |
|---|
| >3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A | Back alignment and structure |
|---|
| >4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A | Back alignment and structure |
|---|
| >1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* | Back alignment and structure |
|---|
| >3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... | Back alignment and structure |
|---|
| >1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* | Back alignment and structure |
|---|
| >2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A | Back alignment and structure |
|---|
| >2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A | Back alignment and structure |
|---|
| >2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A | Back alignment and structure |
|---|
| >3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* | Back alignment and structure |
|---|
| >3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A | Back alignment and structure |
|---|
| >1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* | Back alignment and structure |
|---|
| >2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* | Back alignment and structure |
|---|
| >2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A | Back alignment and structure |
|---|
| >2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} | Back alignment and structure |
|---|
| >4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* | Back alignment and structure |
|---|
| >1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} | Back alignment and structure |
|---|
| >4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} | Back alignment and structure |
|---|
| >2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 | Back alignment and structure |
|---|
| >1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} | Back alignment and structure |
|---|
| >4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A | Back alignment and structure |
|---|
| >4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} | Back alignment and structure |
|---|
| >1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* | Back alignment and structure |
|---|
| >2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* | Back alignment and structure |
|---|
| >2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A | Back alignment and structure |
|---|
| >3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* | Back alignment and structure |
|---|
| >3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A | Back alignment and structure |
|---|
| >1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A | Back alignment and structure |
|---|
| >3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} | Back alignment and structure |
|---|
| >3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* | Back alignment and structure |
|---|
| >1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A | Back alignment and structure |
|---|
| >2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* | Back alignment and structure |
|---|
| >3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* | Back alignment and structure |
|---|
| >2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} | Back alignment and structure |
|---|
| >2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} | Back alignment and structure |
|---|
| >3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* | Back alignment and structure |
|---|
| >3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* | Back alignment and structure |
|---|
| >1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A | Back alignment and structure |
|---|
| >2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A | Back alignment and structure |
|---|
| >3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A | Back alignment and structure |
|---|
| >2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} | Back alignment and structure |
|---|
| >3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* | Back alignment and structure |
|---|
| >1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 | Back alignment and structure |
|---|
| >2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* | Back alignment and structure |
|---|
| >3i4u_A ATP-dependent RNA helicase DHX8; splicing, ATP-binding, hydrolase, mRNA processing, splicing, nucleotide-binding, nucleus, phosphoprotein, SPLI; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* | Back alignment and structure |
|---|
| >3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* | Back alignment and structure |
|---|
| >4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* | Back alignment and structure |
|---|
| >3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A | Back alignment and structure |
|---|
| >4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* | Back alignment and structure |
|---|
| >2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* | Back alignment and structure |
|---|
| >2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* | Back alignment and structure |
|---|
| >4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A | Back alignment and structure |
|---|
| >3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A | Back alignment and structure |
|---|
| >1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 | Back alignment and structure |
|---|
| >3cpe_A Terminase, DNA packaging protein GP17; large terminase, alternative initiation, ATP-binding, DNA- binding, hydrolase, nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB: 3ezk_A* | Back alignment and structure |
|---|
| >2o0j_A Terminase, DNA packaging protein GP17; nucleotide-binding fold, hydrolase; HET: DNA ADP; 1.80A {Enterobacteria phage T4} PDB: 2o0h_A* 2o0k_A* | Back alignment and structure |
|---|
| >2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A | Back alignment and structure |
|---|
| >2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* | Back alignment and structure |
|---|
| >3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C | Back alignment and structure |
|---|
| >1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* | Back alignment and structure |
|---|
| >1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* | Back alignment and structure |
|---|
| >3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* | Back alignment and structure |
|---|
| >2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A | Back alignment and structure |
|---|
| >2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* | Back alignment and structure |
|---|
| >3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* | Back alignment and structure |
|---|
| >3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* | Back alignment and structure |
|---|
| >1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* | Back alignment and structure |
|---|
| >1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 | Back alignment and structure |
|---|
| >1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} | Back alignment and structure |
|---|
| >3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A | Back alignment and structure |
|---|
| >3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} | Back alignment and structure |
|---|
| >3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* | Back alignment and structure |
|---|
| >1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* | Back alignment and structure |
|---|
| >3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* | Back alignment and structure |
|---|
| >2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* | Back alignment and structure |
|---|
| >1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} | Back alignment and structure |
|---|
| >3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >2zpa_A Uncharacterized protein YPFI; RNA modification enzyme, RNA helicase, acetyltransferase, GCN5 acetyltransferase; HET: ACO ADP; 2.35A {Escherichia coli K12} | Back alignment and structure |
|---|
| >3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* | Back alignment and structure |
|---|
| >2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} | Back alignment and structure |
|---|
| >1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A | Back alignment and structure |
|---|
| >2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} | Back alignment and structure |
|---|
| >1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* | Back alignment and structure |
|---|
| >1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* | Back alignment and structure |
|---|
| >1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* | Back alignment and structure |
|---|
| >1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A | Back alignment and structure |
|---|
| >2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} | Back alignment and structure |
|---|
| >1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A | Back alignment and structure |
|---|
| >3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C | Back alignment and structure |
|---|
| >2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} | Back alignment and structure |
|---|
| >3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* | Back alignment and structure |
|---|
| >3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A | Back alignment and structure |
|---|
| >1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* | Back alignment and structure |
|---|
| >3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} | Back alignment and structure |
|---|
| >4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} | Back alignment and structure |
|---|
| >2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 | Back alignment and structure |
|---|
| >1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* | Back alignment and structure |
|---|
| >2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A | Back alignment and structure |
|---|
| >3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 | Back alignment and structure |
|---|
| >3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A | Back alignment and structure |
|---|
| >1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F | Back alignment and structure |
|---|
| >3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* | Back alignment and structure |
|---|
| >4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* | Back alignment and structure |
|---|
| >1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* | Back alignment and structure |
|---|
| >1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* | Back alignment and structure |
|---|
| >2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* | Back alignment and structure |
|---|
| >2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A | Back alignment and structure |
|---|
| >3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* | Back alignment and structure |
|---|
| >3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* | Back alignment and structure |
|---|
| >1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* | Back alignment and structure |
|---|
| >3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} | Back alignment and structure |
|---|
| >2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A | Back alignment and structure |
|---|
| >1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* | Back alignment and structure |
|---|
| >1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A | Back alignment and structure |
|---|
| >3hgt_A HDA1 complex subunit 3; RECA-like domain, SWI2/SNF2 helical domain, chromatin regulator, coiled coil, nucleus, repressor, transcription; 2.20A {Saccharomyces cerevisiae} PDB: 3hgq_A | Back alignment and structure |
|---|
| >3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} | Back alignment and structure |
|---|
| >2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} | Back alignment and structure |
|---|
| >1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* | Back alignment and structure |
|---|
| >2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* | Back alignment and structure |
|---|
| >3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1uaa_A REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} | Back alignment and structure |
|---|
| >4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A | Back alignment and structure |
|---|
| >4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* | Back alignment and structure |
|---|
| >1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* | Back alignment and structure |
|---|
| >1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* | Back alignment and structure |
|---|
| >2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A | Back alignment and structure |
|---|
| >2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* | Back alignment and structure |
|---|
| >1pjr_A PCRA; DNA repair, DNA replication, SOS response, helicase, ATP- binding, DNA-binding; 2.50A {Geobacillus stearothermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1qhg_A* 3pjr_A* 2pjr_A* 1qhh_B* 1qhh_D* 1qhh_A* 1qhh_C* 2pjr_B* | Back alignment and structure |
|---|
| >2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* | Back alignment and structure |
|---|
| >2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C | Back alignment and structure |
|---|
| >2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} | Back alignment and structure |
|---|
| >4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A | Back alignment and structure |
|---|
| >2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} | Back alignment and structure |
|---|
| >2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* | Back alignment and structure |
|---|
| >3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* | Back alignment and structure |
|---|
| >3u4q_A ATP-dependent helicase/nuclease subunit A; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_A* | Back alignment and structure |
|---|
| >3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* | Back alignment and structure |
|---|
| >2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* | Back alignment and structure |
|---|
| >2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* | Back alignment and structure |
|---|
| >2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A | Back alignment and structure |
|---|
| >4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} | Back alignment and structure |
|---|
| >3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* | Back alignment and structure |
|---|
| >1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* | Back alignment and structure |
|---|
| >3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* | Back alignment and structure |
|---|
| >1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* | Back alignment and structure |
|---|
| >1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* | Back alignment and structure |
|---|
| >1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* | Back alignment and structure |
|---|
| >2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* | Back alignment and structure |
|---|
| >3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} | Back alignment and structure |
|---|
| >1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* | Back alignment and structure |
|---|
| >2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 | Back alignment and structure |
|---|
| >4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} | Back alignment and structure |
|---|
| >2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* | Back alignment and structure |
|---|
| >4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B | Back alignment and structure |
|---|
| >3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 | Back alignment and structure |
|---|
| >2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* | Back alignment and structure |
|---|
| >1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* | Back alignment and structure |
|---|
| >2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* | Back alignment and structure |
|---|
| >3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} | Back alignment and structure |
|---|
| >2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A | Back alignment and structure |
|---|
| >1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 | Back alignment and structure |
|---|
| >3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A | Back alignment and structure |
|---|
| >2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* | Back alignment and structure |
|---|
| >1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A | Back alignment and structure |
|---|
| >3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* | Back alignment and structure |
|---|
| >3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} | Back alignment and structure |
|---|
| >3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A | Back alignment and structure |
|---|
| >3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* | Back alignment and structure |
|---|
| >2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A | Back alignment and structure |
|---|
| >4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} | Back alignment and structure |
|---|
| >3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A | Back alignment and structure |
|---|
| >2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A | Back alignment and structure |
|---|
| >2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* | Back alignment and structure |
|---|
| >2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* | Back alignment and structure |
|---|
| >1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* | Back alignment and structure |
|---|
| >1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* | Back alignment and structure |
|---|
| >2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} | Back alignment and structure |
|---|
| >1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* | Back alignment and structure |
|---|
| >1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* | Back alignment and structure |
|---|
| >3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} | Back alignment and structure |
|---|
| >1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A | Back alignment and structure |
|---|
| >1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 | Back alignment and structure |
|---|
| >2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* | Back alignment and structure |
|---|
| >3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A | Back alignment and structure |
|---|
| >1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* | Back alignment and structure |
|---|
| >2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} | Back alignment and structure |
|---|
| >2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A | Back alignment and structure |
|---|
| >2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} | Back alignment and structure |
|---|
| >3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} | Back alignment and structure |
|---|
| >1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A | Back alignment and structure |
|---|
| >2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* | Back alignment and structure |
|---|
| >1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} | Back alignment and structure |
|---|
| >3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* | Back alignment and structure |
|---|
| >1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* | Back alignment and structure |
|---|
| >2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} | Back alignment and structure |
|---|
| >3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A | Back alignment and structure |
|---|
| >1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >1e9r_A Conjugal transfer protein TRWB; coupling protein, bacterial conjugation, F1-ATPase-like quaternary structure, ring helicases; 2.4A {Escherichia coli} SCOP: c.37.1.11 PDB: 1e9s_A 1gki_A* 1gl7_A* 1gl6_A* | Back alignment and structure |
|---|
| >1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A | Back alignment and structure |
|---|
| >2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* | Back alignment and structure |
|---|
| >1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 | Back alignment and structure |
|---|
| >1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* | Back alignment and structure |
|---|
| >1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* | Back alignment and structure |
|---|
| >1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* | Back alignment and structure |
|---|
| >1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* | Back alignment and structure |
|---|
| >3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A | Back alignment and structure |
|---|
| >3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* | Back alignment and structure |
|---|
| >2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V | Back alignment and structure |
|---|
| >3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* | Back alignment and structure |
|---|
| >3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} | Back alignment and structure |
|---|
| >1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* | Back alignment and structure |
|---|
| >3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A | Back alignment and structure |
|---|
| >1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 | Back alignment and structure |
|---|
| >3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* | Back alignment and structure |
|---|
| >1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* | Back alignment and structure |
|---|
| >1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* | Back alignment and structure |
|---|
| >4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* | Back alignment and structure |
|---|
| >3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} | Back alignment and structure |
|---|
| >3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* | Back alignment and structure |
|---|
| >1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 | Back alignment and structure |
|---|
| >2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* | Back alignment and structure |
|---|
| >4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A | Back alignment and structure |
|---|
| >3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* | Back alignment and structure |
|---|
| >1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* | Back alignment and structure |
|---|
| >2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A | Back alignment and structure |
|---|
| >1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A | Back alignment and structure |
|---|
| >3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... | Back alignment and structure |
|---|
| >1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} | Back alignment and structure |
|---|
| >1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A | Back alignment and structure |
|---|
| >1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 | Back alignment and structure |
|---|
| >3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* | Back alignment and structure |
|---|
| >1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A* | Back alignment and structure |
|---|
| >4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A | Back alignment and structure |
|---|
| >2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* | Back alignment and structure |
|---|
| >3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* | Back alignment and structure |
|---|
| >1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* | Back alignment and structure |
|---|
| >3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* | Back alignment and structure |
|---|
| >1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* | Back alignment and structure |
|---|
| >2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* | Back alignment and structure |
|---|
| >3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* | Back alignment and structure |
|---|
| >2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 | Back alignment and structure |
|---|
| >3qks_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATPase, exonuclease, endonucle binding, DNA binding; HET: DNA; 2.10A {Pyrococcus furiosus} PDB: 3qkr_A* | Back alignment and structure |
|---|
| >1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* | Back alignment and structure |
|---|
| >2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* | Back alignment and structure |
|---|
| >1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 | Back alignment and structure |
|---|
| >2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* | Back alignment and structure |
|---|
| >1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* | Back alignment and structure |
|---|
| >1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} | Back alignment and structure |
|---|
| >3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} | Back alignment and structure |
|---|
| >1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A | Back alignment and structure |
|---|
| >1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A | Back alignment and structure |
|---|
| >1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* | Back alignment and structure |
|---|
| >1c9k_A COBU, adenosylcobinamide kinase; alpha/beta structure rossmann fold P-loop, transferase; HET: 5GP; 2.20A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1cbu_A | Back alignment and structure |
|---|
| >3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* | Back alignment and structure |
|---|
| >1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A | Back alignment and structure |
|---|
| >3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* | Back alignment and structure |
|---|
| >3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A | Back alignment and structure |
|---|
| >3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} | Back alignment and structure |
|---|
| >3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* | Back alignment and structure |
|---|
| >2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* | Back alignment and structure |
|---|
| >2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} | Back alignment and structure |
|---|
| >3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B | Back alignment and structure |
|---|
| >3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* | Back alignment and structure |
|---|
| >4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* | Back alignment and structure |
|---|
| >3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* | Back alignment and structure |
|---|
| >3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B* | Back alignment and structure |
|---|
| >2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} | Back alignment and structure |
|---|
| >4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* | Back alignment and structure |
|---|
| >1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A* | Back alignment and structure |
|---|
| >3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} | Back alignment and structure |
|---|
| >3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A | Back alignment and structure |
|---|
| >1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* | Back alignment and structure |
|---|
| >2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A | Back alignment and structure |
|---|
| >3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3tmk_A Thymidylate kinase; phosphotransferase; HET: T5A; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 2tmk_A* 1tmk_A* | Back alignment and structure |
|---|
| >3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 | Back alignment and structure |
|---|
| >2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* | Back alignment and structure |
|---|
| >1ewq_A DNA mismatch repair protein MUTS; multiple domains of protein, mostly mixed alpha-beta structures, one domain is entirely helical; HET: DNA; 2.20A {Thermus aquaticus} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1nne_A* 1fw6_A* 1ewr_A* | Back alignment and structure |
|---|
| >1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A | Back alignment and structure |
|---|
| >3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* | Back alignment and structure |
|---|
| >3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* | Back alignment and structure |
|---|
| >4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 | Back alignment and structure |
|---|
| >4aby_A DNA repair protein RECN; hydrolase, double strand break repair, ATPase, nucleotide binding domain; HET: DNA; 3.00A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* | Back alignment and structure |
|---|
| >2o5v_A DNA replication and repair protein RECF; ABC ATPase, walker A motif, P-loop, signature motif, replication/recombination complex; HET: DNA; 1.61A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >1e69_A Chromosome segregation SMC protein; structural maintenance of chromosomes, coiled coil; 3.1A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... | Back alignment and structure |
|---|
| >1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* | Back alignment and structure |
|---|
| >4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* | Back alignment and structure |
|---|
| >2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A | Back alignment and structure |
|---|
| >1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* | Back alignment and structure |
|---|
| >2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A | Back alignment and structure |
|---|
| >2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* | Back alignment and structure |
|---|
| >1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* | Back alignment and structure |
|---|
| >1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* | Back alignment and structure |
|---|
| >2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G | Back alignment and structure |
|---|
| >1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A | Back alignment and structure |
|---|
| >2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* | Back alignment and structure |
|---|
| >1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* | Back alignment and structure |
|---|
| >2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* | Back alignment and structure |
|---|
| >2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* | Back alignment and structure |
|---|
| >1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* | Back alignment and structure |
|---|
| >1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A | Back alignment and structure |
|---|
| >1qhl_A Protein (cell division protein MUKB); SMC, chromosome partitioning; 2.20A {Escherichia coli} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A | Back alignment and structure |
|---|
| >1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* | Back alignment and structure |
|---|
| >3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* | Back alignment and structure |
|---|
| >2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* | Back alignment and structure |
|---|
| >2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2iut_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- cell division, DNA translocation, KOPS, membrane; HET: DNA SAP; 2.25A {Pseudomonas aeruginosa} PDB: 2iuu_A* | Back alignment and structure |
|---|
| >1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* | Back alignment and structure |
|---|
| >3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 478 | ||||
| d2bmfa2 | 305 | c.37.1.14 (A:178-482) Dengue virus helicase {Dengu | 2e-39 | |
| d1yksa2 | 299 | c.37.1.14 (A:325-623) YFV helicase domain {Yellow | 6e-39 | |
| d1a1va1 | 136 | c.37.1.14 (A:190-325) HCV helicase domain {Human h | 2e-22 | |
| d1yksa1 | 140 | c.37.1.14 (A:185-324) YFV helicase domain {Yellow | 5e-11 | |
| d1wp9a2 | 286 | c.37.1.19 (A:201-486) putative ATP-dependent RNA h | 4e-06 | |
| d2fwra1 | 200 | c.37.1.19 (A:257-456) DNA repair protein RAD25 {Ar | 8e-04 | |
| d2fz4a1 | 206 | c.37.1.19 (A:24-229) DNA repair protein RAD25 {Arc | 0.004 |
| >d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: RNA helicase domain: Dengue virus helicase species: Dengue virus type 2 [TaxId: 11060]
Score = 142 bits (359), Expect = 2e-39
Identities = 46/373 (12%), Positives = 98/373 (26%), Gaps = 79/373 (21%)
Query: 24 EEVRKNDILIIVGETGSGKTTQLPQFLFHAGFCRDGKLIGVTQPRRVAAVTVAKRVAEES 83
+ RK + I+ G+GKT + + R + + P RV A + + +
Sbjct: 4 DIFRKKRLTIMDLHPGAGKTKRYLPAIVREAIKRGLR-TLILAPTRVVAAEMEEALRGLP 62
Query: 84 GVELGQRVGYSIRFDDRTSTSTR---IKEALLDPYLSRYSAIIVDEAHERTVHTDVLLGL 140
+ + L + Y+ II+DEAH + G
Sbjct: 63 IRYQTPAIRAEHTGREIVDLMCHATFTMRLLSPIRVPNYNLIIMDEAHFTDPASIAARGY 122
Query: 141 LKKVQNARSKSADGHSNGNNNNENSDMILDRGNDTNGINTLKQCQGRKFAPLKLIIMSAS 200
+ I M+A+
Sbjct: 123 ISTRVEMG------------------------------------------EAAGIFMTAT 140
Query: 201 LDARGFSEYFGCAKAVHVQGRQFPVEILYTLYPEPDYLDATLITIFQVHLDEAPGDILVF 260
P+ PE + + + G + F
Sbjct: 141 PPGS----------RDPFPQSNAPIMDEEREIPERSWNSG------HEWVTDFKGKTVWF 184
Query: 261 LTGQEEIESVERLVQERLLQLPEASRKLVTVPIFSSLPSEQQMRVFAPAAAGFRKVILAT 320
+ + + +++ + + + ++ ++ T
Sbjct: 185 VPSIKAGNDIAACLRKN---------GKKVIQLSRKTFDSEYIKTRTN----DWDFVVTT 231
Query: 321 NIAETSVTIPGIKYVIDPGFVKARL--YDPVKGMESLLVVPISKAQALQRSGRAGREGPG 378
+I+E + VIDP + D + + +P++ + A QR GR GR
Sbjct: 232 DISEMGANFK-AERVIDPRRCMKPVILTDGEERVILAGPMPVTHSSAAQRRGRVGRNPKN 290
Query: 379 KCFR-LYPENEFD 390
+ + +Y +
Sbjct: 291 ENDQYIYMGEPLE 303
|
| >d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Length = 299 | Back information, alignment and structure |
|---|
| >d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 136 | Back information, alignment and structure |
|---|
| >d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Length = 140 | Back information, alignment and structure |
|---|
| >d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 286 | Back information, alignment and structure |
|---|
| >d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 200 | Back information, alignment and structure |
|---|
| >d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 206 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 478 | |||
| d2bmfa2 | 305 | Dengue virus helicase {Dengue virus type 2 [TaxId: | 100.0 | |
| d1yksa2 | 299 | YFV helicase domain {Yellow fever virus [TaxId: 11 | 99.92 | |
| d1oywa3 | 200 | RecQ helicase domain {Escherichia coli [TaxId: 562 | 99.9 | |
| d1c4oa2 | 174 | Nucleotide excision repair enzyme UvrB {Thermus th | 99.9 | |
| d1fuka_ | 162 | Initiation factor 4a {Baker's yeast (Saccharomyces | 99.9 | |
| d1s2ma2 | 171 | Putative ATP-dependent RNA helicase DHH1 {Baker's | 99.9 | |
| d1hv8a2 | 155 | Putative DEAD box RNA helicase {Archaeon Methanoco | 99.9 | |
| d2j0sa2 | 168 | Probable ATP-dependent RNA helicase DDX48 {Human ( | 99.9 | |
| d2rb4a1 | 168 | ATP-dependent RNA helicase DDX25 {Human (Homo sapi | 99.89 | |
| d1t5la2 | 181 | Nucleotide excision repair enzyme UvrB {Bacillus c | 99.89 | |
| d1t5ia_ | 168 | Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo | 99.88 | |
| d1jr6a_ | 138 | HCV helicase domain {Human hepatitis C virus (HCV) | 99.86 | |
| d2p6ra4 | 201 | Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 | 99.86 | |
| d1veca_ | 206 | DEAD box RNA helicase rck/p54 {Human (Homo sapiens | 99.78 | |
| d2p6ra3 | 202 | Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 | 99.77 | |
| d1wp9a2 | 286 | putative ATP-dependent RNA helicase PF2015 {Pyroco | 99.77 | |
| d2j0sa1 | 222 | Probable ATP-dependent RNA helicase DDX48 {Human ( | 99.77 | |
| d1hv8a1 | 208 | Putative DEAD box RNA helicase {Archaeon Methanoco | 99.77 | |
| d2g9na1 | 218 | Initiation factor 4a {Human (Homo sapiens) [TaxId: | 99.76 | |
| d1qdea_ | 212 | Initiation factor 4a {Baker's yeast (Saccharomyces | 99.75 | |
| d1t6na_ | 207 | Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo | 99.75 | |
| d1a1va2 | 299 | HCV helicase domain {Human hepatitis C virus (HCV) | 99.73 | |
| d1a1va1 | 136 | HCV helicase domain {Human hepatitis C virus (HCV) | 99.71 | |
| d1wrba1 | 238 | putative ATP-dependent RNA helicase VlgB {Flatworm | 99.69 | |
| d2eyqa5 | 211 | Transcription-repair coupling factor, TRCF {Escher | 99.69 | |
| d1gm5a4 | 206 | RecG helicase domain {Thermotoga maritima [TaxId: | 99.68 | |
| d1s2ma1 | 206 | Putative ATP-dependent RNA helicase DHH1 {Baker's | 99.68 | |
| d1q0ua_ | 209 | Probable DEAD box RNA helicase YqfR {Bacillus stea | 99.67 | |
| d1gkub1 | 237 | Helicase-like "domain" of reverse gyrase {Archaeon | 99.65 | |
| d1oywa2 | 206 | RecQ helicase domain {Escherichia coli [TaxId: 562 | 99.64 | |
| d1yksa1 | 140 | YFV helicase domain {Yellow fever virus [TaxId: 11 | 99.61 | |
| d1wp9a1 | 200 | putative ATP-dependent RNA helicase PF2015 {Pyroco | 99.59 | |
| d2fwra1 | 200 | DNA repair protein RAD25 {Archaeoglobus fulgidus [ | 99.57 | |
| d1gkub2 | 248 | Helicase-like "domain" of reverse gyrase {Archaeon | 99.52 | |
| d2fz4a1 | 206 | DNA repair protein RAD25 {Archaeoglobus fulgidus [ | 99.48 | |
| d1gm5a3 | 264 | RecG helicase domain {Thermotoga maritima [TaxId: | 99.4 | |
| d2eyqa3 | 233 | Transcription-repair coupling factor, TRCF {Escher | 99.39 | |
| d1rifa_ | 282 | DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] | 99.33 | |
| d1z3ix1 | 346 | Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI | 99.06 | |
| d1tf5a4 | 175 | Translocation ATPase SecA, nucleotide-binding doma | 98.98 | |
| d1z5za1 | 244 | Helicase of the SNF2/Rad54 hamily {Sulfolobus solf | 98.91 | |
| d1nkta4 | 219 | Translocation ATPase SecA, nucleotide-binding doma | 98.29 | |
| d1z3ix2 | 298 | Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI | 98.07 | |
| d1w36d1 | 359 | Exodeoxyribonuclease V alpha chain (RecD) {Escheri | 98.0 | |
| d1okkd2 | 207 | GTPase domain of the signal recognition particle r | 97.99 | |
| d2qy9a2 | 211 | GTPase domain of the signal recognition particle r | 97.95 | |
| d1vmaa2 | 213 | GTPase domain of the signal recognition particle r | 97.9 | |
| d1z63a1 | 230 | Helicase of the SNF2/Rad54 hamily {Sulfolobus solf | 97.87 | |
| d1ls1a2 | 207 | GTPase domain of the signal sequence recognition p | 97.86 | |
| d1v43a3 | 239 | Hypothetical protein PH0022, N-terminal domain {Py | 97.78 | |
| d1g2912 | 240 | Maltose transport protein MalK, N-terminal domain | 97.77 | |
| d1j8yf2 | 211 | GTPase domain of the signal sequence recognition p | 97.75 | |
| d1sgwa_ | 200 | Putative ABC transporter PF0895 {Pyrococcus furios | 97.4 | |
| d1oxxk2 | 242 | Glucose transport protein GlcV, N-terminal domain | 97.39 | |
| d1l2ta_ | 230 | MJ0796 {Archaeon Methanococcus jannaschii [TaxId: | 97.38 | |
| d2awna2 | 232 | Maltose transport protein MalK, N-terminal domain | 97.3 | |
| d1uaaa1 | 306 | DEXX box DNA helicase {Escherichia coli, RepD [Tax | 97.22 | |
| d3dhwc1 | 240 | Methionine import ATP-binding protein MetN {Escher | 97.2 | |
| d3d31a2 | 229 | Sulfate/molybdate ABC transporter, ATP-binding pro | 97.15 | |
| d1ji0a_ | 240 | Branched chain aminoacid ABC transporter {Thermoto | 97.11 | |
| d1tf5a3 | 273 | Translocation ATPase SecA, nucleotide-binding doma | 97.01 | |
| d1ye8a1 | 178 | Hypothetical kinase-like protein Aq_1292 {Aquifex | 96.96 | |
| d1pjra1 | 318 | DEXX box DNA helicase {Bacillus stearothermophilus | 96.9 | |
| d2onka1 | 240 | Molybdate/tungstate import ATP-binding protein Wtp | 96.67 | |
| d1nkta3 | 288 | Translocation ATPase SecA, nucleotide-binding doma | 96.46 | |
| d1ixza_ | 247 | AAA domain of cell division protein FtsH {Thermus | 96.4 | |
| d1g6ha_ | 254 | MJ1267 {Archaeon Methanococcus jannaschii [TaxId: | 96.39 | |
| d1r6bx2 | 268 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 96.33 | |
| d1gm5a3 | 264 | RecG helicase domain {Thermotoga maritima [TaxId: | 96.3 | |
| d2i3ba1 | 189 | Cancer-related NTPase, C1orf57 {Human (Homo sapien | 96.28 | |
| d2eyqa3 | 233 | Transcription-repair coupling factor, TRCF {Escher | 96.14 | |
| d1a5ta2 | 207 | delta prime subunit of DNA polymerase III, N-domai | 96.09 | |
| g1qhh.1 | 623 | DEXX box DNA helicase {Bacillus stearothermophilus | 96.07 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 95.95 | |
| d1g6oa_ | 323 | Hexameric traffic ATPase, HP0525 {Helicobacter pyl | 95.93 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 95.92 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 95.82 | |
| d1e32a2 | 258 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 95.55 | |
| d1zp6a1 | 176 | Hypothetical protein Atu3015 {Agrobacterium tumefa | 95.52 | |
| d1ly1a_ | 152 | Polynucleotide kinase, kinase domain {Bacteriophag | 95.52 | |
| d1kaga_ | 169 | Shikimate kinase (AroK) {Escherichia coli [TaxId: | 95.45 | |
| d1njfa_ | 239 | delta prime subunit of DNA polymerase III, N-domai | 95.43 | |
| d2pmka1 | 241 | Haemolysin B ATP-binding protein {Escherichia coli | 95.38 | |
| d1jj7a_ | 251 | Peptide transporter Tap1, C-terminal ABC domain {H | 95.36 | |
| d1lw7a2 | 192 | Transcriptional regulator NadR, ribosylnicotinamid | 95.27 | |
| d1r7ra3 | 265 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 95.25 | |
| d3b60a1 | 253 | Multidrug resistance ABC transporter MsbA, C-termi | 95.25 | |
| d1r0wa_ | 281 | Cystic fibrosis transmembrane conductance regulato | 95.14 | |
| d1mv5a_ | 242 | Multidrug resistance ABC transporter LmrA, C-termi | 95.14 | |
| d1qhxa_ | 178 | Chloramphenicol phosphotransferase {Streptomyces v | 95.13 | |
| d1y63a_ | 174 | Probable kinase LmjF30.1890 {Leishmania major [Tax | 95.08 | |
| d3adka_ | 194 | Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | 95.08 | |
| d1khta_ | 190 | Adenylate kinase {Archaeon Methanococcus voltae [T | 95.04 | |
| d1p9ra_ | 401 | Extracellular secretion NTPase EpsE {Vibrio choler | 94.98 | |
| d2bdta1 | 176 | Hypothetical protein BH3686 {Bacillus halodurans [ | 94.97 | |
| d1znwa1 | 182 | Guanylate kinase {Mycobacterium tuberculosis [TaxI | 94.92 | |
| d1rkba_ | 173 | Adenylate kinase {Human (Homo sapiens), isoenzyme | 94.91 | |
| d1t5la1 | 413 | Nucleotide excision repair enzyme UvrB {Bacillus c | 94.9 | |
| d1np6a_ | 170 | Molybdopterin-guanine dinucleotide biosynthesis pr | 94.84 | |
| d2gnoa2 | 198 | gamma subunit of DNA polymerase III, N-domain {The | 94.83 | |
| d1knqa_ | 171 | Gluconate kinase {Escherichia coli [TaxId: 562]} | 94.82 | |
| d1qvra2 | 387 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 94.71 | |
| d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 94.7 | |
| d2hyda1 | 255 | Putative multidrug export ATP-binding/permease pro | 94.66 | |
| d2b8ta1 | 139 | Thymidine kinase, TK1, N-terminal domain {Ureaplas | 94.6 | |
| d1l7vc_ | 231 | ABC transporter involved in vitamin B12 uptake, Bt | 94.58 | |
| d1vpla_ | 238 | Putative ABC transporter TM0544 {Thermotoga mariti | 94.32 | |
| d1m8pa3 | 183 | ATP sulfurylase C-terminal domain {Fungus (Penicil | 94.31 | |
| d1b0ua_ | 258 | ATP-binding subunit of the histidine permease {Sal | 94.25 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 94.2 | |
| d1n0wa_ | 242 | DNA repair protein Rad51, catalytic domain {Human | 94.2 | |
| d1s96a_ | 205 | Guanylate kinase {Escherichia coli [TaxId: 562]} | 94.15 | |
| d1ak2a1 | 190 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 94.13 | |
| d1szpa2 | 251 | DNA repair protein Rad51, catalytic domain {Baker' | 94.11 | |
| d1viaa_ | 161 | Shikimate kinase (AroK) {Campylobacter jejuni [Tax | 94.09 | |
| d1g41a_ | 443 | HslU {Haemophilus influenzae [TaxId: 727]} | 94.03 | |
| d1zina1 | 182 | Adenylate kinase {Bacillus stearothermophilus [Tax | 94.02 | |
| d1tf7a2 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 93.99 | |
| d1qf9a_ | 194 | UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 | 93.93 | |
| d1yj5a2 | 172 | 5' polynucleotide kinase-3' phosphatase, C-termina | 93.82 | |
| d1e4va1 | 179 | Adenylate kinase {Escherichia coli [TaxId: 562]} | 93.74 | |
| d1s3ga1 | 182 | Adenylate kinase {Bacillus globisporus [TaxId: 145 | 93.74 | |
| d1gkya_ | 186 | Guanylate kinase {Baker's yeast (Saccharomyces cer | 93.73 | |
| d1ukza_ | 196 | Uridylate kinase {Baker's yeast (Saccharomyces cer | 93.71 | |
| d1e6ca_ | 170 | Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax | 93.65 | |
| d1teva_ | 194 | UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] | 93.6 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 93.52 | |
| d2cdna1 | 181 | Adenylate kinase {Mycobacterium tuberculosis [TaxI | 93.5 | |
| d1pzna2 | 254 | DNA repair protein Rad51, catalytic domain {Archae | 93.49 | |
| d1xjca_ | 165 | Molybdopterin-guanine dinucleotide biosynthesis pr | 93.46 | |
| d1zaka1 | 189 | Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | 93.45 | |
| d1x6va3 | 195 | Adenosine-5'phosphosulfate kinase (APS kinase) {Hu | 93.41 | |
| d2p6ra1 | 85 | Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 | 93.39 | |
| d1cr2a_ | 277 | Gene 4 protein (g4p, DNA primase), helicase domain | 93.23 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 93.23 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 93.16 | |
| d1rz3a_ | 198 | Hypothetical protein rbstp0775 {Bacillus stearothe | 93.12 | |
| d1kgda_ | 178 | Guanylate kinase-like domain of Cask {Human (Homo | 93.09 | |
| d2ak3a1 | 189 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 93.0 | |
| d1nksa_ | 194 | Adenylate kinase {Archaeon Sulfolobus acidocaldari | 92.93 | |
| d1lvga_ | 190 | Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 | 92.92 | |
| d1um8a_ | 364 | ClpX {Helicobacter pylori [TaxId: 210]} | 92.89 | |
| d1sxjb2 | 224 | Replication factor C4 {Baker's yeast (Saccharomyce | 92.88 | |
| d1tf7a1 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 92.82 | |
| d1akya1 | 180 | Adenylate kinase {Baker's yeast (Saccharomyces cer | 92.62 | |
| d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 92.61 | |
| d1e9ra_ | 433 | Bacterial conjugative coupling protein TrwB {Esche | 92.59 | |
| d1v5wa_ | 258 | Meiotic recombination protein DMC1/LIM15 homolog { | 92.39 | |
| d1sxjd2 | 237 | Replication factor C2 {Baker's yeast (Saccharomyce | 92.19 | |
| d1uj2a_ | 213 | Uridine-cytidine kinase 2 {Human (Homo sapiens) [T | 92.12 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 92.0 | |
| d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 91.97 | |
| d1ckea_ | 225 | CMP kinase {Escherichia coli [TaxId: 562]} | 91.89 | |
| d1u0la2 | 225 | Probable GTPase EngC (YjeQ), C-terminal domain {Th | 91.78 | |
| d2i1qa2 | 258 | DNA repair protein Rad51, catalytic domain {Archae | 91.67 | |
| d4tmka_ | 210 | Thymidylate kinase {Escherichia coli [TaxId: 562]} | 91.63 | |
| d1q3ta_ | 223 | CMP kinase {Streptococcus pneumoniae [TaxId: 1313] | 91.52 | |
| d1w36b1 | 485 | Exodeoxyribonuclease V beta chain (RecB), N-termin | 91.46 | |
| d1yrba1 | 244 | ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss | 91.25 | |
| d1htwa_ | 158 | Hypothetical protein HI0065 {Haemophilus influenza | 91.08 | |
| d1bifa1 | 213 | 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata | 91.04 | |
| d2iyva1 | 165 | Shikimate kinase (AroK) {Mycobacterium tuberculosi | 91.01 | |
| d1xx6a1 | 141 | Thymidine kinase, TK1, N-terminal domain {Clostrid | 90.87 | |
| d2p67a1 | 327 | LAO/AO transport system kinase ArgK {Escherichia c | 90.84 | |
| d1jbka_ | 195 | ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | 90.77 | |
| d1c4oa1 | 408 | Nucleotide excision repair enzyme UvrB {Thermus th | 90.27 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 90.05 | |
| d2a5yb3 | 277 | CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI | 89.73 | |
| d1sxje2 | 252 | Replication factor C5 {Baker's yeast (Saccharomyce | 89.52 | |
| d1nn5a_ | 209 | Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 | 89.48 | |
| d2vp4a1 | 197 | Deoxyribonucleoside kinase {Fruit fly (Drosophila | 89.31 | |
| g1f2t.1 | 292 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 89.22 | |
| d1u94a1 | 263 | RecA protein, ATPase-domain {Escherichia coli [Tax | 89.21 | |
| d2fh5b1 | 207 | Signal recognition particle receptor beta-subunit | 89.19 | |
| d2qm8a1 | 323 | Metallochaperone MeaB {Methylobacterium extorquens | 88.93 | |
| d1sq5a_ | 308 | Pantothenate kinase PanK {Escherichia coli [TaxId: | 88.9 | |
| d2fnaa2 | 283 | Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ | 88.74 | |
| d1nija1 | 222 | Hypothetical protein YjiA, N-terminal domain {Esch | 88.64 | |
| d1g8pa_ | 333 | ATPase subunit of magnesium chelatase, BchI {Rhodo | 88.55 | |
| g1xew.1 | 329 | Smc head domain {Pyrococcus furiosus [TaxId: 2261] | 88.43 | |
| d1qhla_ | 222 | Cell division protein MukB {Escherichia coli [TaxI | 88.12 | |
| d1nlfa_ | 274 | Hexameric replicative helicase repA {Escherichia c | 88.03 | |
| d1uf9a_ | 191 | Dephospho-CoA kinase {Thermus thermophilus [TaxId: | 87.88 | |
| d1r8sa_ | 160 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 87.86 | |
| d1tmka_ | 214 | Thymidylate kinase {Baker's yeast (Saccharomyces c | 87.8 | |
| d1svma_ | 362 | Papillomavirus large T antigen helicase domain {Si | 87.69 | |
| d1m7ga_ | 208 | Adenosine-5'phosphosulfate kinase (APS kinase) {Fu | 87.66 | |
| g1ii8.1 | 369 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 87.56 | |
| d1wb9a2 | 234 | DNA repair protein MutS, the C-terminal domain {Es | 87.36 | |
| d1w1wa_ | 427 | Smc head domain {Baker's yeast (Saccharomyces cere | 87.3 | |
| d1jjva_ | 205 | Dephospho-CoA kinase {Haemophilus influenzae [TaxI | 87.26 | |
| d1mkya1 | 171 | Probable GTPase Der, N-terminal and middle domains | 87.23 | |
| d1hv8a1 | 208 | Putative DEAD box RNA helicase {Archaeon Methanoco | 87.17 | |
| d1knxa2 | 177 | HPr kinase HprK C-terminal domain {Mycoplasma pneu | 86.94 | |
| d1ny5a2 | 247 | Transcriptional activator sigm54 (NtrC1), C-termin | 86.82 | |
| d1p5zb_ | 241 | Deoxycytidine kinase {Human (Homo sapiens) [TaxId: | 86.78 | |
| d1vhta_ | 208 | Dephospho-CoA kinase {Escherichia coli [TaxId: 562 | 86.75 | |
| d1r6bx3 | 315 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 86.57 | |
| d1odfa_ | 286 | Hypothetical protein Ygr205W {Baker's yeast (Sacch | 86.49 | |
| d1kkma_ | 176 | HPr kinase HprK C-terminal domain {Lactobacillus c | 86.22 | |
| d1nrjb_ | 209 | Signal recognition particle receptor beta-subunit | 86.18 | |
| d1ewqa2 | 224 | DNA repair protein MutS, the C-terminal domain {Th | 86.17 | |
| d1f6ba_ | 186 | SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: | 86.08 | |
| d1wmsa_ | 174 | Rab9a {Human (Homo sapiens) [TaxId: 9606]} | 86.06 | |
| d1upta_ | 169 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 86.01 | |
| d1veca_ | 206 | DEAD box RNA helicase rck/p54 {Human (Homo sapiens | 85.99 | |
| d1e69a_ | 308 | Smc head domain {Thermotoga maritima [TaxId: 2336] | 85.99 | |
| d2j0sa1 | 222 | Probable ATP-dependent RNA helicase DDX48 {Human ( | 85.98 | |
| d2cxxa1 | 184 | GTP-binding protein engB {Pyrococcus horikoshii [T | 85.93 | |
| d1svia_ | 195 | Probable GTPase EngB {Bacillus subtilis [TaxId: 14 | 85.37 | |
| d1ksha_ | 165 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 85.33 | |
| d2qtvb1 | 166 | SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 85.04 | |
| d1ko7a2 | 169 | HPr kinase HprK C-terminal domain {Staphylococcus | 84.88 | |
| d3raba_ | 169 | Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | 84.55 | |
| d1z2aa1 | 164 | Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | 84.31 | |
| d1mo6a1 | 269 | RecA protein, ATPase-domain {Mycobacterium tubercu | 84.26 | |
| d2gj8a1 | 161 | Probable tRNA modification GTPase TrmE (MnmE), G d | 84.19 | |
| d1t9ha2 | 231 | Probable GTPase EngC (YjeQ), C-terminal domain {Ba | 84.05 | |
| d1z06a1 | 165 | Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | 83.95 | |
| d2ocpa1 | 241 | Deoxyguanosine kinase {Human (Homo sapiens) [TaxId | 83.87 | |
| d2erxa1 | 171 | di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 83.77 | |
| d1h65a_ | 257 | Chloroplast protein translocon GTPase Toc34 {Garde | 83.47 | |
| d2atva1 | 168 | Ras-like estrogen-regulated growth inhibitor, RERG | 83.45 | |
| d2a5ja1 | 173 | Rab2b {Human (Homo sapiens) [TaxId: 9606]} | 83.43 | |
| d1zj6a1 | 177 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 83.3 | |
| d2bv3a2 | 276 | Elongation factor G (EF-G), N-terminal (G) domain | 83.23 | |
| d1gsia_ | 208 | Thymidylate kinase {Mycobacterium tuberculosis [Ta | 83.22 | |
| d1wf3a1 | 178 | GTPase Era, N-terminal domain {Thermus thermophilu | 83.09 | |
| d1kaoa_ | 167 | Rap2a {Human (Homo sapiens) [TaxId: 9606]} | 83.02 | |
| d2f7sa1 | 186 | Rab27b {Human (Homo sapiens) [TaxId: 9606]} | 82.91 | |
| d1ky3a_ | 175 | Rab-related protein ypt7p {Baker's yeast (Saccharo | 82.74 | |
| d1t6na_ | 207 | Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo | 82.6 | |
| d1xp8a1 | 268 | RecA protein, ATPase-domain {Deinococcus radiodura | 82.58 | |
| d2f9la1 | 175 | Rab11b {Human (Homo sapiens) [TaxId: 9606]} | 82.58 | |
| d2erya1 | 171 | r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 82.35 | |
| d1r2qa_ | 170 | Rab5a {Human (Homo sapiens) [TaxId: 9606]} | 82.14 | |
| d1kmqa_ | 177 | RhoA {Human (Homo sapiens) [TaxId: 9606]} | 82.06 | |
| d1zd9a1 | 164 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 82.05 | |
| d2fn4a1 | 173 | r-Ras {Human (Homo sapiens) [TaxId: 9606]} | 81.92 | |
| d1a7ja_ | 288 | Phosphoribulokinase {Rhodobacter sphaeroides [TaxI | 81.74 | |
| d1xpua3 | 289 | Transcription termination factor Rho, ATPase domai | 81.54 | |
| d1g16a_ | 166 | Rab-related protein Sec4 {Baker's yeast (Saccharom | 81.43 | |
| d1vg8a_ | 184 | Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | 81.43 | |
| d1deka_ | 241 | Deoxynucleoside monophosphate kinase {Bacteriophag | 81.42 | |
| d1xtqa1 | 167 | GTP-binding protein RheB {Human (Homo sapiens) [Ta | 81.42 | |
| d1mkya2 | 186 | Probable GTPase Der, N-terminal and middle domains | 81.27 | |
| d1z0fa1 | 166 | Rab14 {Human (Homo sapiens) [TaxId: 9606]} | 81.03 | |
| d1byia_ | 224 | Dethiobiotin synthetase {Escherichia coli [TaxId: | 81.0 | |
| d1z08a1 | 167 | Rab21 {Human (Homo sapiens) [TaxId: 9606]} | 80.9 | |
| d1ctqa_ | 166 | cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 | 80.79 | |
| d1yzqa1 | 164 | Rab6 {Human (Homo sapiens) [TaxId: 9606]} | 80.76 | |
| d1x1ra1 | 169 | Ras-related protein M-Ras (XRas) {Mouse (Mus muscu | 80.57 | |
| d1qvra3 | 315 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 80.54 | |
| d2bmea1 | 174 | Rab4a {Human (Homo sapiens) [TaxId: 9606]} | 80.49 | |
| d1z0ja1 | 167 | Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | 80.46 | |
| d1mh1a_ | 183 | Rac {Human (Homo sapiens) [TaxId: 9606]} | 80.45 | |
| d1fzqa_ | 176 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 80.4 | |
| d2ew1a1 | 171 | Rab30 {Human (Homo sapiens) [TaxId: 9606]} | 80.27 | |
| d1lnza2 | 185 | Obg GTP-binding protein middle domain {Bacillus su | 80.18 | |
| d1bg2a_ | 323 | Kinesin {Human (Homo sapiens) [TaxId: 9606]} | 80.13 |
| >d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: RNA helicase domain: Dengue virus helicase species: Dengue virus type 2 [TaxId: 11060]
Probab=100.00 E-value=3.9e-35 Score=279.88 Aligned_cols=290 Identities=16% Similarity=0.149 Sum_probs=195.9
Q ss_pred HHhcCCEEEEEcCCCCcHHhHHHHHHhhcCccCCCcEEEEecchHHHHHHHHHHHHHHhCCcCCCEEEEEEeecc--cCC
Q 011751 25 EVRKNDILIIVGETGSGKTTQLPQFLFHAGFCRDGKLIGVTQPRRVAAVTVAKRVAEESGVELGQRVGYSIRFDD--RTS 102 (478)
Q Consensus 25 ~l~~~~~~~i~apTGsGKT~~~~~~~~~~~~~~~~~~i~~~~p~~~l~~~~~~~~~~~~~~~~~~~vg~~~~~~~--~~~ 102 (478)
.+.+|+++++.||||||||+.+...+...... .+.+++++.|+++|+.|+++++.................... ...
T Consensus 5 ~~~~~~~~lv~~~TGsGKT~~~l~~~~~~~~~-~~~~~lvi~Ptr~La~q~~~~l~~~~~~~~~~~~~~~~~~~~~i~~~ 83 (305)
T d2bmfa2 5 IFRKKRLTIMDLHPGAGKTKRYLPAIVREAIK-RGLRTLILAPTRVVAAEMEEALRGLPIRYQTPAIRAEHTGREIVDLM 83 (305)
T ss_dssp SSSTTCEEEECCCTTSSTTTTHHHHHHHHHHH-HTCCEEEEESSHHHHHHHHHHTTTSCCBCCC--------CCCSEEEE
T ss_pred HhhcCCcEEEEECCCCCHHHHHHHHHHHHHHh-cCCEEEEEccHHHHHHHHHHHHhcCCcceeeeEEeecccCccccccC
Confidence 35689999999999999996544334332222 245789999999999999888754322111111111111111 112
Q ss_pred hhhhHH-HHhhCcCcCCCcceEeecccccchhhhHHHHHHHHHHHhhcccccCCCCCCCCCCCchhhhccCCCCCCcccc
Q 011751 103 TSTRIK-EALLDPYLSRYSAIIVDEAHERTVHTDVLLGLLKKVQNARSKSADGHSNGNNNNENSDMILDRGNDTNGINTL 181 (478)
Q Consensus 103 ~~~~~~-~~l~~~~l~~~~~lIiDE~H~r~~~~~~~l~~l~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~ 181 (478)
+...+. .+.....+.+++++|+||+|....+...++++++.....
T Consensus 84 t~~~l~~~~~~~~~~~~~~~vViDE~H~~~~~~~~~~~~l~~~~~~---------------------------------- 129 (305)
T d2bmfa2 84 CHATFTMRLLSPIRVPNYNLIIMDEAHFTDPASIAARGYISTRVEM---------------------------------- 129 (305)
T ss_dssp EHHHHHHHHTSSSCCCCCSEEEEESTTCCSHHHHHHHHHHHHHHHH----------------------------------
T ss_pred CcHHHHHHHhcCccccceeEEEeeeeeecchhhHHHHHHHHHhhcc----------------------------------
Confidence 222222 344456788999999999999988888888877765443
Q ss_pred ccccCCCCCCceEEEEcCCCChhHHHhhhCCCCeEEeCCccccceEEecCCCCcchHHHHHHHHHHhhhcCCCCCEEEEc
Q 011751 182 KQCQGRKFAPLKLIIMSASLDARGFSEYFGCAKAVHVQGRQFPVEILYTLYPEPDYLDATLITIFQVHLDEAPGDILVFL 261 (478)
Q Consensus 182 ~~~~~~~~~~~~~i~lSAT~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LVF~ 261 (478)
.+.+++++|||++......... ..++.......+....... .. .....++++||||
T Consensus 130 --------~~~~~v~~SAT~~~~~~~~~~~----------~~~~~~~~~~~~~~~~~~~-----~~-~~~~~~~~~lvf~ 185 (305)
T d2bmfa2 130 --------GEAAGIFMTATPPGSRDPFPQS----------NAPIMDEEREIPERSWNSG-----HE-WVTDFKGKTVWFV 185 (305)
T ss_dssp --------TSCEEEEECSSCTTCCCSSCCC----------SSCEEEEECCCCCSCCSSC-----CH-HHHSSCSCEEEEC
T ss_pred --------ccceEEEeecCCCcceeeeccc----------CCcceEEEEeccHHHHHHH-----HH-HHHhhCCCEEEEe
Confidence 5678999999994332211111 1121111111111110000 00 1123478899999
Q ss_pred CCHHHHHHHHHHHHHHHhcCCCCCCCeEEEEccCCCCHHHHHhhcCcCCCCccEEEEeccccccccccCCeEEEEeCCcc
Q 011751 262 TGQEEIESVERLVQERLLQLPEASRKLVTVPIFSSLPSEQQMRVFAPAAAGFRKVILATNIAETSVTIPGIKYVIDPGFV 341 (478)
Q Consensus 262 ~s~~~~~~l~~~l~~~~~~~~~~~~~~~v~~~h~~l~~~~r~~i~~~f~~g~~~vlvaT~~~~~Gvdip~v~~VI~~g~~ 341 (478)
++++++++++..|++. ++.+..+||++++..+. .|++|..+++|||+++++|+|+ ++++||++|..
T Consensus 186 ~~~~~~~~l~~~L~~~---------~~~~~~l~~~~~~~~~~----~~~~~~~~~lvaT~~~~~G~~~-~~~~Vi~~~~~ 251 (305)
T d2bmfa2 186 PSIKAGNDIAACLRKN---------GKKVIQLSRKTFDSEYI----KTRTNDWDFVVTTDISEMGANF-KAERVIDPRRC 251 (305)
T ss_dssp SCHHHHHHHHHHHHHH---------TCCCEECCTTCHHHHGG----GGGTSCCSEEEECGGGGTTCCC-CCSEEEECCEE
T ss_pred ccHHHHHHHHHHHHhC---------CCCEEEeCCcChHHHHh----hhhccchhhhhhhHHHHhcCCC-CccEEEEcCCc
Confidence 9999999999999987 77889999999766554 5678899999999999999999 68899999876
Q ss_pred cce--eecCCCCcccceeeecCHHHHHHhhcccCCCCC-CeEEEecCHh
Q 011751 342 KAR--LYDPVKGMESLLVVPISKAQALQRSGRAGREGP-GKCFRLYPEN 387 (478)
Q Consensus 342 ~~~--~yd~~~~~~~~~~~~~s~~~~~Qr~GRaGR~~~-G~~~~l~~~~ 387 (478)
... .||+..+...+...|.|.++|.||+|||||.|. |....+|..+
T Consensus 252 ~~~~~~~~~~~~~~~~~~~~~s~~~~~Qr~GR~GR~~~~~~~~~~~~~~ 300 (305)
T d2bmfa2 252 MKPVILTDGEERVILAGPMPVTHSSAAQRRGRVGRNPKNENDQYIYMGE 300 (305)
T ss_dssp EEEEEECSSSCEEEEEEEEECCHHHHHHHHTTSSCSSSCCCEEEEECSC
T ss_pred eeeeEecCCCCceEEeccccCCHHHHhhhhcCcCcCCCCceEEEEECCC
Confidence 543 578877777778899999999999999999994 4455666544
|
| >d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} | Back information, alignment and structure |
|---|
| >d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} | Back information, alignment and structure |
|---|
| >d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} | Back information, alignment and structure |
|---|
| >d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} | Back information, alignment and structure |
|---|
| >d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} | Back information, alignment and structure |
|---|
| >d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} | Back information, alignment and structure |
|---|
| >d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} | Back information, alignment and structure |
|---|
| >d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} | Back information, alignment and structure |
|---|
| >d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1nkta4 c.37.1.19 (A:397-615) Translocation ATPase SecA, nucleotide-binding domains {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} | Back information, alignment and structure |
|---|
| >d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} | Back information, alignment and structure |
|---|
| >d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} | Back information, alignment and structure |
|---|
| >d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} | Back information, alignment and structure |
|---|
| >d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} | Back information, alignment and structure |
|---|
| >d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} | Back information, alignment and structure |
|---|
| >d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} | Back information, alignment and structure |
|---|
| >d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} | Back information, alignment and structure |
|---|
| >d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2p6ra1 a.4.5.43 (A:404-488) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} | Back information, alignment and structure |
|---|
| >d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1w36b1 c.37.1.19 (B:1-485) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1xx6a1 c.37.1.24 (A:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]} | Back information, alignment and structure |
|---|
| >d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1c4oa1 c.37.1.19 (A:2-409) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} | Back information, alignment and structure |
|---|
| >d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} | Back information, alignment and structure |
|---|
| >d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} | Back information, alignment and structure |
|---|
| >d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} | Back information, alignment and structure |
|---|
| >d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1bg2a_ c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|