Citrus Sinensis ID: 011759

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------48
MAEEEGSQTVAEQTAQPTETVGTTQASVEATMESVTVSGTESTCNNNCETSGAIADGEREKTVEFADELMEKGTNALKESDYGEAAECFSRALEIRVSHYGELALECVNAYYQYGRALLYKAQEEADPLVSVPKKEGDSQQGSDKDDSVKNAVNGESSTASVSSSAEQHGSSNNQDEAADDVPGDNEEDEEGNDGENVAEADEDESDLDLAWKMLDVARAIAEKHWGDSMEKVDILSALAEVALEREDIETSLSDYQKALTILERMVEPDSRHIAELNFRICLCLEIGSKPQEAIPYCQKAISVCKSRVQRLLNEVKSLGESATSSAPAELDDGIQQSSSEFQNDKLLTDKEAEIETLSGLCGDLEKKLEDLQQVALFPKSILSEILGMASAKAKGDEKSSTSAVLSSSRMGTANSDGDFDSPTVSTAHTSGAAGVTHLGVVGRGVKRVSMSTGSAESRPSKKSTSDPSSDKGDGSVC
cccccccccccccccccccccccccccHHHHHcccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHccccccHHHcccHHHHHcccccccHHcccccccccccccccccccHHHHHHHHccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHccHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHcccccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
cccEcccccccccccccccccccccccEEEEEEEccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccHccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccccccccccHHHHcccccccccccccEEEcccccccccccccEEcccEEEEEEccccccccccccccccccccccccccc
maeeegsqtvaeqtaqptetvgttQASVEATMESVTVsgtestcnnncetsgaiadgereKTVEFADELMEKGTnalkesdygeAAECFSRALEIRVSHYGELALECVNAYYQYGRALLYKAqeeadplvsvpkkegdsqqgsdkddsvknavngesstasvsssaeqhgssnnqdeaaddvpgdneedeegndgenvaeadedesDLDLAWKMLDVARAIAEkhwgdsmeKVDILSALAEVALEREDIETSLSDYQKALTILERmvepdsrhIAELNFRICLCLeigskpqeaipYCQKAISVCKSRVQRLLNEVKSLgesatssapaelddgiqqsssefqndklltdkEAEIETLSGLCGDLEKKLEDLQQVALFPKSILSEILGMASAkakgdeksstsavlsssrmgtansdgdfdsptvstahtsgaagvthlGVVGRGVKRvsmstgsaesrpskkstsdpssdkgdgsvc
maeeegsqtvaeqtaqptetvgttqasVEATMESVtvsgtestcnnncetsgaiadgereKTVEFADELMEKGtnalkesdyGEAAECFSRALEIRVSHYGELALECVNAYYQYGRALLYKAQEEADPLVSvpkkegdsqqgsdkddsvkNAVNGESSTASvsssaeqhgssnnqdeaaddvPGDNEEDeegndgenvaeadedesDLDLAWKMLDVARAIAEkhwgdsmekVDILSALAEVALEREDIETSLSDYQKALTILERMVEPDSRHIAELNFRICLCLEIGSKPQEAIPYCQKAISVCKSRVQRLLNEVKSLgesatssapaelddgiqQSSSEFQNDKLLTDKEAEIETLSGLCGDLEKKLEDLQQVALFPKSILSEILGMASakakgdekssTSAVLSSSRMGTANSDGDFDSPTVSTAhtsgaagvthlgvvGRGVKRVsmstgsaesrpskkstsdpssdkgdgsvc
MAEEEGSQTVAEQTAQPTETVGTTQASVEATMESVTVSGTESTCNNNCETSGAIADGEREKTVEFADELMEKGTNALKESDYGEAAECFSRALEIRVSHYGELALECVNAYYQYGRALLYKAQEEADPLVSVPKKEgdsqqgsdkddsVKNAVNGEsstasvsssaEQHGSSNNQDEAADDVPgdneedeegndgenVaeadedesdldlaWKMLDVARAIAEKHWGDSMEKVDILSALAEVALEREDIETSLSDYQKALTILERMVEPDSRHIAELNFRICLCLEIGSKPQEAIPYCQKAISVCKSRVQRLLNEVKSLGESATSSAPAELDDGIQQSSSEFQNDKLLTDKEAEIETLSGLCGDLEKKLEDLQQVALFPKSILSEILGMASAKAKGDEKSSTSAVLSSSRMGTANSDGDFDSPTVSTAHTSGAAGVTHLGVVGRGVKRVSMSTGSAEsrpskkstsdpssdkgdgsVC
*********************************************************************************YGEAAECFSRALEIRVSHYGELALECVNAYYQYGRALLYKA*************************************************************************************LDLAWKMLDVARAIAEKHWGDSMEKVDILSALAEVALEREDIETSLSDYQKALTILERMVEPDSRHIAELNFRICLCLEIGSKPQEAIPYCQKAISVCKSRVQRLLN*****************************************ETLSGLCGDLEKKLEDLQQVALFPKSILSEIL************************************************VTHLGVVG***********************************
******************************************************************DELMEKGTNALKESDYGEAAECFSRALEIRVSHYGELALECVNAYYQYGRALLYKAQEEADPLV***********************************************************EEGNDGENVAEADEDESDLDLAWKMLDVARAIAEKHWGDSMEKVDILSALAEVALEREDIETSLSDYQKALTILERMVEPDSRHIAELNFRICLCLEIGSKPQEAIPYCQKAISVCKSRVQ*****************************************EAEIETLSGLCGDLE****************************************************************************************************************
***************************VEATME**********CNNNCETSGAIADGEREKTVEFADELMEKGTNALKESDYGEAAECFSRALEIRVSHYGELALECVNAYYQYGRALLYKAQEEADPLV***************************************************************************SDLDLAWKMLDVARAIAEKHWGDSMEKVDILSALAEVALEREDIETSLSDYQKALTILERMVEPDSRHIAELNFRICLCLEIGSKPQEAIPYCQKAISVCKSRVQRLLNEVKS**********AELDDGIQQSSSEFQNDKLLTDKEAEIETLSGLCGDLEKKLEDLQQVALFPKSILSEILGM**************************SDGDFDSPTVSTAHTSGAAGVTHLGVVGRGVK*******************************
**************************SVE*TMESVT************************KTVEFADELMEKGTNALKESDYGEAAECFSRALEIRVSHYGELALECVNAYYQYGRALLYKAQEEADPL***************************************************************************ESDLDLAWKMLDVARAIAEKHWGDSMEKVDILSALAEVALEREDIETSLSDYQKALTILERMVEPDSRHIAELNFRICLCLEIGSKPQEAIPYCQKAISVCKSRVQRLLNEV*******************************LTDKEAEIETLSGLCGDLEKKLEDLQQVALFPKSILSEILGMASAK****************************************AGVTHLGVVGRGVKRVSMST*************************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAEEEGSQTVAEQTAQPTETVGTTQASVEATMESVTVSGTESTCNNNCETSGAIADGEREKTVEFADELMEKGTNALKESDYGEAAECFSRALEIRVSHYGELALECVNAYYQYGRALLYKAQEEADPLVSVPKKEGDSQQGSDKDDSVKNAVNGESSTASVSSSAEQHGSSNNQDEAADDVPGDNEEDEEGNDGENVAEADEDESDLDLAWKMLDVARAIAEKHWGDSMEKVDILSALAEVALEREDIETSLSDYQKALTILERMVEPDSRHIAELNFRICLCLEIGSKPQEAIPYCQKAISVCKSRVQRLLNEVKSLGESATSSAPAELDDGIQQSSSEFQNDKLLTDKEAExxxxxxxxxxxxxxxxxxxxxALFPKSILSEILGMASAKAKGDEKSSTSAVLSSSRMGTANSDGDFDSPTVSTAHTSGAAGVTHLGVVGRGVKRVSMSTGSAESRPSKKSTSDPSSDKGDGSVC
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query478 2.2.26 [Sep-21-2011]
Q9USQ4396 NASP-related protein sim3 yes no 0.508 0.613 0.243 1e-08
P06180590 Histone-binding protein N N/A no 0.466 0.377 0.242 1e-07
Q66HD3776 Nuclear autoantigenic spe yes no 0.242 0.149 0.282 2e-07
P49321788 Nuclear autoantigenic spe no no 0.309 0.187 0.256 2e-07
Q2T9P4777 Nuclear autoantigenic spe yes no 0.236 0.145 0.301 1e-06
P27123693 Nuclear autoantigenic spe yes no 0.255 0.176 0.270 2e-06
Q99MD9773 Nuclear autoantigenic spe no no 0.242 0.150 0.275 2e-06
Q02508510 Protein HGV2 OS=Halocynth N/A no 0.236 0.221 0.273 1e-05
>sp|Q9USQ4|SIM3_SCHPO NASP-related protein sim3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sim3 PE=1 SV=1 Back     alignment and function desciption
 Score = 62.0 bits (149), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 64/263 (24%), Positives = 121/263 (46%), Gaps = 20/263 (7%)

Query: 67  DELMEKGTNALKESDYGEAAECFSRALEIRVSHYGELALECVNAYYQYGRALLYKAQEEA 126
           ++L+ +G  A  + +Y EA + + +AL    S +G  +LE  N  + YG++L   A E +
Sbjct: 33  EQLVTQGNMAYAQKNYEEAVDKYGQALMQSESIHGSESLENRNVLWLYGKSLFQIAIENS 92

Query: 127 DPLVSVPKKEGDSQQGSDKDDSVKNAVNGESSTASVSSSAEQHGSSNNQDEAADDVPGDN 186
             L       G++    +       +     +  S + S ++  +    +E    +    
Sbjct: 93  QVL-------GNALGAKESVSQATESFEEPEAIGSFTFSGQKIENKYTVNEENSSIAHPE 145

Query: 187 EEDEEGNDGENVAEADEDESDLDLAWKMLDVARAIAEK---HWGDSM-EKV---DILSAL 239
           +E EE    E    ++EDE D ++AW++LD+ R +  K    + DS  EK+   DI   L
Sbjct: 146 KESEEKETNEASPASEEDEDDFNVAWEVLDLTRVMQSKAVDAYPDSKDEKIRLADIYDLL 205

Query: 240 AEVALEREDIETSLSDYQKALTILERMVE-PDSRHIAELNFRICLCLEIG-----SKPQE 293
            E++LE E+   +  D + AL   E++    ++  ++E ++++ L LE       S    
Sbjct: 206 GELSLEIENFSQASQDLKTALEWKEKVYNVSNNTLLSEAHYKLALALEFTNPEDPSNKSR 265

Query: 294 AIPYCQKAISVCKSRVQRLLNEV 316
           A  + +KA  + K+ +    NEV
Sbjct: 266 ACEHVEKAAEILKNVLNERENEV 288
Histone H3 and H3-like CENP-A-specific chaperone. Promotes delivery and incorporation of CENP-A in centromeric chromatin, probably by escorting nascent CENP-A to CENP-A chromatin assembly factors. Required for central core silencing and normal chromosome segregation.
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (taxid: 284812)
>sp|P06180|HIBN_XENLA Histone-binding protein N1/N2 OS=Xenopus laevis PE=1 SV=3 Back     alignment and function description
>sp|Q66HD3|NASP_RAT Nuclear autoantigenic sperm protein OS=Rattus norvegicus GN=Nasp PE=2 SV=1 Back     alignment and function description
>sp|P49321|NASP_HUMAN Nuclear autoantigenic sperm protein OS=Homo sapiens GN=NASP PE=1 SV=2 Back     alignment and function description
>sp|Q2T9P4|NASP_BOVIN Nuclear autoantigenic sperm protein OS=Bos taurus GN=NASP PE=2 SV=2 Back     alignment and function description
>sp|P27123|NASP_RABIT Nuclear autoantigenic sperm protein (Fragment) OS=Oryctolagus cuniculus GN=NASP PE=2 SV=2 Back     alignment and function description
>sp|Q99MD9|NASP_MOUSE Nuclear autoantigenic sperm protein OS=Mus musculus GN=Nasp PE=1 SV=2 Back     alignment and function description
>sp|Q02508|HGV2_HALRO Protein HGV2 OS=Halocynthia roretzi GN=HGV2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query478
359495786 1123 PREDICTED: uncharacterized protein LOC10 0.974 0.414 0.681 1e-168
255562753459 conserved hypothetical protein [Ricinus 0.941 0.980 0.695 1e-163
224084225470 predicted protein [Populus trichocarpa] 0.956 0.972 0.665 1e-152
449460622480 PREDICTED: uncharacterized protein LOC10 0.970 0.966 0.583 1e-141
449510293480 PREDICTED: uncharacterized LOC101207851 0.970 0.966 0.581 1e-140
147791854440 hypothetical protein VITISV_027632 [Viti 0.866 0.940 0.590 1e-138
297798194498 tetratricopeptide repeat-containing prot 0.945 0.907 0.547 1e-131
388519625455 unknown [Medicago truncatula] 0.830 0.872 0.601 1e-129
18419996492 tetratricopeptide repeat domain-containi 0.945 0.918 0.551 1e-127
298205066340 unnamed protein product [Vitis vinifera] 0.700 0.985 0.711 1e-126
>gi|359495786|ref|XP_002272586.2| PREDICTED: uncharacterized protein LOC100248980 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  598 bits (1543), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 323/474 (68%), Positives = 382/474 (80%), Gaps = 8/474 (1%)

Query: 5    EGSQTVAEQTAQPTETVGTTQASVEATMESVTVSGTESTCNNNCETSGAIADGEREKTVE 64
            E + T  E+   PT  V   Q+S EAT+ES     TES+CNNN +TS   +D +REK++E
Sbjct: 649  ENAATKVEEALAPTGQVA--QSSNEATIESNAQGDTESSCNNNADTSARPSDADREKSLE 706

Query: 65   FADELMEKGTNALKESDYGEAAECFSRALEIRVSHYGELALECVNAYYQYGRALLYKAQE 124
            +A+ELMEKG+ A+KESD+ EA +CFSRALEIRV+H+GELA ECVN YY+YG ALLYKAQE
Sbjct: 707  YAEELMEKGSKAVKESDFSEATDCFSRALEIRVAHHGELAFECVNTYYKYGCALLYKAQE 766

Query: 125  EADPLVSVPKKEGDSQQGSDKDDSVKNAVNGESSTASVSSSAEQHGSSNNQDEAADDVPG 184
            EADPL ++P KE +S + S+KD S+KNAVN ESSTASV+  AEQ GSSN+Q  AADD   
Sbjct: 767  EADPLATMPNKEAESHENSNKDGSMKNAVNDESSTASVN--AEQDGSSNDQKVAADDDTN 824

Query: 185  --DNEEDEEGNDGENVAEADEDESDLDLAWKMLDVARAIAEKH-WGDSMEKVDILSALAE 241
              + EE++E +D E++AEADEDESDLDLAWKMLDVARAI EKH   D+MEKVDILSALAE
Sbjct: 825  GKEQEEEDEESDDEDLAEADEDESDLDLAWKMLDVARAIVEKHSAADTMEKVDILSALAE 884

Query: 242  VALEREDIETSLSDYQKALTILERMVEPDSRHIAELNFRICLCLEIGSKPQEAIPYCQKA 301
            VALEREDIETSLSDYQKAL+ILER+VEPDSRHIAELNFRICLCLEIGSK QEAIPYCQ+A
Sbjct: 885  VALEREDIETSLSDYQKALSILERLVEPDSRHIAELNFRICLCLEIGSKAQEAIPYCQRA 944

Query: 302  ISVCKSRVQRLLNEVKSLGESATSSAPAELDDGIQQSSSEFQNDKLLTDKEAEIETLSGL 361
            IS+CKSRVQRL NE+KSL ES   S   ELD   QQSS+  Q    ++DKE+EIETL+GL
Sbjct: 945  ISICKSRVQRLSNEIKSLSESPAISPTPELDQSAQQSSNVSQAGNSISDKESEIETLNGL 1004

Query: 362  CGDLEKKLEDLQQVALFPKSILSEILGMASAKAKGDEKSSTSAVLSSSRMGTANSDGDFD 421
              +LEKKLEDLQQ+   P SILSEILGM SAKA+G +K ++ +V+ SS++G+ANS G FD
Sbjct: 1005 ASELEKKLEDLQQLVSNPTSILSEILGMMSAKARGADKGASPSVMGSSQIGSANSHGGFD 1064

Query: 422  SPTVSTA-HTSGAAGVTHLGVVGRGVKRVSMSTGSAESRPSKKSTSDPSSDKGD 474
            SPTVSTA HT+GAAGVTHLGVVGRGVKRVSM++G+AES P KK   D S DKGD
Sbjct: 1065 SPTVSTASHTNGAAGVTHLGVVGRGVKRVSMNSGTAESSPMKKPPLDSSLDKGD 1118

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255562753|ref|XP_002522382.1| conserved hypothetical protein [Ricinus communis] gi|223538460|gb|EEF40066.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|224084225|ref|XP_002307236.1| predicted protein [Populus trichocarpa] gi|222856685|gb|EEE94232.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449460622|ref|XP_004148044.1| PREDICTED: uncharacterized protein LOC101207851 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449510293|ref|XP_004163624.1| PREDICTED: uncharacterized LOC101207851 [Cucumis sativus] Back     alignment and taxonomy information
>gi|147791854|emb|CAN61830.1| hypothetical protein VITISV_027632 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297798194|ref|XP_002866981.1| tetratricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297312817|gb|EFH43240.1| tetratricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|388519625|gb|AFK47874.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|18419996|ref|NP_568019.1| tetratricopeptide repeat domain-containing protein [Arabidopsis thaliana] gi|13877853|gb|AAK44004.1|AF370189_1 unknown protein [Arabidopsis thaliana] gi|17065596|gb|AAL33778.1| unknown protein [Arabidopsis thaliana] gi|332661368|gb|AEE86768.1| tetratricopeptide repeat domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|298205066|emb|CBI38362.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query478
TAIR|locus:2115045492 AT4G37210 [Arabidopsis thalian 0.922 0.896 0.531 5.2e-113
UNIPROTKB|G4N2R8533 MGG_04894 "Histone H1-binding 0.374 0.335 0.223 3.6e-10
UNIPROTKB|I3LRP1742 NASP "Uncharacterized protein" 0.422 0.272 0.251 7.5e-10
UNIPROTKB|Q2T9P4777 NASP "Nuclear autoantigenic sp 0.424 0.261 0.243 8.4e-10
FB|FBgn0037624492 CG8223 [Drosophila melanogaste 0.357 0.347 0.234 1.7e-09
UNIPROTKB|E2RN30789 NASP "Uncharacterized protein" 0.424 0.257 0.229 1.9e-09
RGD|1359609776 Nasp "nuclear autoantigenic sp 0.424 0.261 0.229 2.3e-09
UNIPROTKB|P49321788 NASP "Nuclear autoantigenic sp 0.422 0.256 0.242 2.4e-09
ZFIN|ZDB-GENE-030131-5511624 nasp "nuclear autoantigenic sp 0.435 0.333 0.243 9.5e-09
MGI|MGI:1355328773 Nasp "nuclear autoantigenic sp 0.424 0.262 0.224 1.3e-08
TAIR|locus:2115045 AT4G37210 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1115 (397.6 bits), Expect = 5.2e-113, P = 5.2e-113
 Identities = 248/467 (53%), Positives = 310/467 (66%)

Query:     8 QTVAEQTAQPTETVGTTQASVEATMESVTVSGTESTCNNNCETSGA-------IADGERE 60
             QT+ E   +  +T+    AS+EAT+ESV   GTESTCNN+   + A       + D ERE
Sbjct:    15 QTLTEPATEIAQTLEPNLASIEATVESVVQGGTESTCNNDANNNNAADSAATEVCDEERE 74

Query:    61 KTVEFADELMEKGTNALKESDYGEAAECFSRALEIRVSHYGELALECVNAYYQYGRALLY 120
             KT+EFA+EL EKG+  LKE+D+ EA +CFSRALEIRV+HYGEL  EC+NAYY+YG ALL 
Sbjct:    75 KTLEFAEELTEKGSVFLKENDFAEAVDCFSRALEIRVAHYGELDAECINAYYRYGLALLA 134

Query:   121 KAQEEADPLVSVPKKEXXXXXXXXXXXXVKNAVNGEXXXXXXXXXX-EQHGSSNNQD-EA 178
             KAQ EADPL ++PKKE             + + NGE           E+ GSS+ Q+   
Sbjct:   135 KAQAEADPLGNMPKKEGEVQ---------QESSNGESLAPSVVSGDPERQGSSSGQEGSG 185

Query:   179 ADDVPXXXXXXXXXXXXXXVXXXXXXXXXXXXXWKMLDVARAIAEKHWGDSMEKVDILSA 238
               D                              WKMLD+AR I +K   ++MEKVDIL +
Sbjct:   186 GKDQGEDGEDCQDDDLSDADGDADEDESDLDMAWKMLDIARVITDKQSTETMEKVDILCS 245

Query:   239 LAEVALEREDIETSLSDYQKALTILERMVEPDSRHIAELNFRICLCLEIGSKPQEAIPYC 298
             LAEV+LEREDIE+SLSDY+ AL+ILER+VEPDSR  AELNFRIC+CLE G +P+EAIPYC
Sbjct:   246 LAEVSLEREDIESSLSDYKNALSILERLVEPDSRRTAELNFRICICLETGCQPKEAIPYC 305

Query:   299 QKAISVCKSRVQRLLNEVKSLGESATSSAPAELDDGIQQSSSEFQNDKLLTDKEAEIETL 358
             QKA+ +CK+R++RL NE+K    SATSS  +E+D+GIQQSS+    DK  +DKE EI  L
Sbjct:   306 QKALLICKARMERLSNEIKGASGSATSSTVSEIDEGIQQSSNVPYIDKSASDKEVEIGDL 365

Query:   359 SGLCGDLEKKLEDLQQVALFPKSILSEILGMASAKAKGDEKSSTSAV-LSSSRMGTANSD 417
             +GL  DLEKKLEDL+Q A  PK +L+E++GM SAK    +K   +A  +SSSRMGT N++
Sbjct:   366 AGLAEDLEKKLEDLKQQAENPKQVLAELMGMVSAKPNASDKVVPAAAEMSSSRMGTVNTN 425

Query:   418 -G-DFDSPTVSTAHTS----GAA-GVTHLGVVGRGVKRVSMSTGSAE 457
              G D +SPTVSTAHT     GAA GVTHLGVVGRGVKRV M+T S E
Sbjct:   426 FGKDLESPTVSTAHTGAAGGGAASGVTHLGVVGRGVKRVLMNTTSIE 472
GO:0005634 "nucleus" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0006306 "DNA methylation" evidence=RCA
GO:0006342 "chromatin silencing" evidence=RCA
GO:0006346 "methylation-dependent chromatin silencing" evidence=RCA
GO:0009855 "determination of bilateral symmetry" evidence=RCA
GO:0009909 "regulation of flower development" evidence=RCA
GO:0010014 "meristem initiation" evidence=RCA
GO:0010073 "meristem maintenance" evidence=RCA
GO:0016246 "RNA interference" evidence=RCA
GO:0016570 "histone modification" evidence=RCA
GO:0031047 "gene silencing by RNA" evidence=RCA
GO:0031048 "chromatin silencing by small RNA" evidence=RCA
GO:0048449 "floral organ formation" evidence=RCA
GO:0051567 "histone H3-K9 methylation" evidence=RCA
UNIPROTKB|G4N2R8 MGG_04894 "Histone H1-binding protein" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
UNIPROTKB|I3LRP1 NASP "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q2T9P4 NASP "Nuclear autoantigenic sperm protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
FB|FBgn0037624 CG8223 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|E2RN30 NASP "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
RGD|1359609 Nasp "nuclear autoantigenic sperm protein (histone-binding)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P49321 NASP "Nuclear autoantigenic sperm protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-5511 nasp "nuclear autoantigenic sperm protein (histone-binding)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:1355328 Nasp "nuclear autoantigenic sperm protein (histone-binding)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query478
TIGR009271096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 2e-05
pfam1341469 pfam13414, TPR_11, TPR repeat 1e-04
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 2e-04
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 3e-04
COG0457291 COG0457, NrfG, FOG: TPR repeat [General function p 3e-04
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 0.002
pfam1341469 pfam13414, TPR_11, TPR repeat 0.003
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 0.004
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 0.004
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information 
 Score = 47.3 bits (112), Expect = 2e-05
 Identities = 45/233 (19%), Positives = 73/233 (31%), Gaps = 24/233 (10%)

Query: 2   AEEEGSQTVAEQTAQ---PTETVGTTQASVEATMESVTVSGTESTCNNNCETSGAIADGE 58
            +E  ++T  E  ++   P E  G  +   E   +     G         E        E
Sbjct: 668 EQEGETETKGENESEGEIPAERKGEQEGEGEIEAKEADHKGETEAEEVEHEGETEAEGTE 727

Query: 59  REKTVEFADELMEKGTNALKESDYGEAAECFSRALEIRVSHYGELALECVNAYY----QY 114
            E  +E  +E  E       E++     E  +        H GE   E          Q 
Sbjct: 728 DEGEIETGEEGEEVEDEGEGEAEGKHEVE--TEGDRKETEHEGETEAEGKEDEDEGEIQA 785

Query: 115 GRALLYKAQEEADPLVSVPKKEGDSQQGSDKDDSVKNAVN--GESSTASVSSSAEQHGSS 172
           G     K  E A+  V    +    ++   +  S   A +   +  T     +AE  G +
Sbjct: 786 GEDGEMKGDEGAEGKVEHEGETEAGEKDEHEGQSETQADDTEVKDETGEQELNAENQGEA 845

Query: 173 NNQDEAADDVPG-------------DNEEDEEGNDGENVAEADEDESDLDLAW 212
              ++  D   G             + EE+EE  + E   E +E+E  L L W
Sbjct: 846 KQDEKGVDGGGGSDGGDSEEEEEEEEEEEEEEEEEEEEEEEEEENEEPLSLEW 898

[Transport and binding proteins, Cations and iron carrying compounds]. Length = 1096
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 478
KOG4563400 consensus Cell cycle-regulated histone H1-binding 99.92
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.74
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.63
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 99.52
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.41
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.28
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.16
PRK11189296 lipoprotein NlpI; Provisional 99.16
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.14
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.11
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 99.07
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.05
KOG4563400 consensus Cell cycle-regulated histone H1-binding 99.02
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 99.0
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 99.0
PRK15359144 type III secretion system chaperone protein SscB; 98.99
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 98.92
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 98.92
KOG0553304 consensus TPR repeat-containing protein [General f 98.9
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.9
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 98.89
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 98.86
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.85
PRK12370553 invasion protein regulator; Provisional 98.85
KOG1126638 consensus DNA-binding cell division cycle control 98.84
PRK12370553 invasion protein regulator; Provisional 98.84
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 98.84
PRK15359144 type III secretion system chaperone protein SscB; 98.83
PRK10370198 formate-dependent nitrite reductase complex subuni 98.83
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.82
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 98.81
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 98.81
PRK11788389 tetratricopeptide repeat protein; Provisional 98.81
PRK11788389 tetratricopeptide repeat protein; Provisional 98.8
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.8
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.76
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 98.76
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 98.73
KOG1126638 consensus DNA-binding cell division cycle control 98.72
KOG1125579 consensus TPR repeat-containing protein [General f 98.72
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 98.72
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 98.71
PRK11189296 lipoprotein NlpI; Provisional 98.69
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 98.62
PRK09782987 bacteriophage N4 receptor, outer membrane subunit; 98.61
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 98.59
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.58
PRK10370198 formate-dependent nitrite reductase complex subuni 98.56
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 98.55
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 98.53
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 98.53
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 98.51
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.47
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.46
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.46
PRK04841 903 transcriptional regulator MalT; Provisional 98.45
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.42
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.4
PRK04841903 transcriptional regulator MalT; Provisional 98.4
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.37
KOG18391236 consensus Uncharacterized protein CLU1/cluA/TIF31 98.37
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.36
KOG0553304 consensus TPR repeat-containing protein [General f 98.36
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 98.35
KOG0547606 consensus Translocase of outer mitochondrial membr 98.35
KOG0547606 consensus Translocase of outer mitochondrial membr 98.34
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.33
KOG1125579 consensus TPR repeat-containing protein [General f 98.33
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 98.33
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 98.3
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 98.26
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.25
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 98.25
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.25
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.23
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 98.22
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 98.11
KOG4234271 consensus TPR repeat-containing protein [General f 98.11
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.1
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 98.08
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 98.06
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 98.05
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 98.02
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 98.02
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 98.02
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 98.02
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.01
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 97.99
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.99
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 97.98
PRK10803263 tol-pal system protein YbgF; Provisional 97.97
KOG18391236 consensus Uncharacterized protein CLU1/cluA/TIF31 97.96
KOG2003840 consensus TPR repeat-containing protein [General f 97.96
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 97.95
PRK10747398 putative protoheme IX biogenesis protein; Provisio 97.95
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 97.94
KOG1129478 consensus TPR repeat-containing protein [General f 97.93
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 97.91
PLN02789320 farnesyltranstransferase 97.91
KOG1129478 consensus TPR repeat-containing protein [General f 97.86
KOG2076 895 consensus RNA polymerase III transcription factor 97.86
cd05804355 StaR_like StaR_like; a well-conserved protein foun 97.85
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 97.84
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 97.83
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 97.82
KOG4162799 consensus Predicted calmodulin-binding protein [Si 97.76
PF06552186 TOM20_plant: Plant specific mitochondrial import r 97.74
KOG4648536 consensus Uncharacterized conserved protein, conta 97.72
PF1337173 TPR_9: Tetratricopeptide repeat 97.72
PRK10803263 tol-pal system protein YbgF; Provisional 97.71
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.71
KOG4340459 consensus Uncharacterized conserved protein [Funct 97.7
PRK14720 906 transcript cleavage factor/unknown domain fusion p 97.7
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 97.69
KOG2003 840 consensus TPR repeat-containing protein [General f 97.67
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 97.67
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 97.66
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 97.66
PRK14574 822 hmsH outer membrane protein; Provisional 97.66
PRK11906458 transcriptional regulator; Provisional 97.62
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 97.59
PF09986214 DUF2225: Uncharacterized protein conserved in bact 97.57
KOG1586288 consensus Protein required for fusion of vesicles 97.54
KOG2376 652 consensus Signal recognition particle, subunit Srp 97.54
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 97.47
COG1729262 Uncharacterized protein conserved in bacteria [Fun 97.47
PRK10747398 putative protoheme IX biogenesis protein; Provisio 97.46
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 97.46
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.45
PLN02789320 farnesyltranstransferase 97.44
PF12688120 TPR_5: Tetratrico peptide repeat 97.43
PF12688120 TPR_5: Tetratrico peptide repeat 97.42
COG1729262 Uncharacterized protein conserved in bacteria [Fun 97.39
KOG4555175 consensus TPR repeat-containing protein [Function 97.36
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 97.34
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.34
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 97.33
KOG0624 504 consensus dsRNA-activated protein kinase inhibitor 97.33
KOG3060289 consensus Uncharacterized conserved protein [Funct 97.32
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 97.29
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 97.27
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 97.27
COG4235287 Cytochrome c biogenesis factor [Posttranslational 97.25
PF06552186 TOM20_plant: Plant specific mitochondrial import r 97.24
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 97.23
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.22
KOG4555175 consensus TPR repeat-containing protein [Function 97.15
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 97.11
KOG1941 518 consensus Acetylcholine receptor-associated protei 97.1
KOG1128777 consensus Uncharacterized conserved protein, conta 97.07
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 97.04
KOG4234271 consensus TPR repeat-containing protein [General f 97.04
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 96.97
PRK14720 906 transcript cleavage factor/unknown domain fusion p 96.96
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 96.94
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 96.93
PRK15331165 chaperone protein SicA; Provisional 96.92
KOG1941518 consensus Acetylcholine receptor-associated protei 96.87
KOG2076 895 consensus RNA polymerase III transcription factor 96.86
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 96.82
PF1342844 TPR_14: Tetratricopeptide repeat 96.81
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 96.8
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 96.74
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 96.73
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.7
COG0457291 NrfG FOG: TPR repeat [General function prediction 96.63
PRK14574 822 hmsH outer membrane protein; Provisional 96.54
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 96.5
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 96.46
COG0457291 NrfG FOG: TPR repeat [General function prediction 96.43
KOG2376 652 consensus Signal recognition particle, subunit Srp 96.36
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 96.35
KOG1128777 consensus Uncharacterized conserved protein, conta 96.34
PRK15331165 chaperone protein SicA; Provisional 96.31
PF13512142 TPR_18: Tetratricopeptide repeat 96.31
PF1342844 TPR_14: Tetratricopeptide repeat 96.24
PF1286294 Apc5: Anaphase-promoting complex subunit 5 96.22
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 96.22
KOG0551390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 96.21
KOG1585308 consensus Protein required for fusion of vesicles 96.18
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 96.13
PF1337173 TPR_9: Tetratricopeptide repeat 96.1
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 96.09
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 95.93
KOG1586288 consensus Protein required for fusion of vesicles 95.85
COG4783484 Putative Zn-dependent protease, contains TPR repea 95.84
COG4783484 Putative Zn-dependent protease, contains TPR repea 95.76
PF1286294 Apc5: Anaphase-promoting complex subunit 5 95.76
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 95.7
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 95.7
COG4105254 ComL DNA uptake lipoprotein [General function pred 95.69
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 95.61
PF09986214 DUF2225: Uncharacterized protein conserved in bact 95.56
PF1343134 TPR_17: Tetratricopeptide repeat 95.52
PLN03218 1060 maturation of RBCL 1; Provisional 95.51
PF1343134 TPR_17: Tetratricopeptide repeat 95.5
KOG0495913 consensus HAT repeat protein [RNA processing and m 95.43
KOG1585308 consensus Protein required for fusion of vesicles 95.42
COG3118304 Thioredoxin domain-containing protein [Posttransla 95.37
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 95.36
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 95.32
KOG0551390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 95.3
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 95.28
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 95.25
COG4235287 Cytochrome c biogenesis factor [Posttranslational 95.24
PLN03218 1060 maturation of RBCL 1; Provisional 95.17
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 95.16
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 95.16
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 95.1
PF03704146 BTAD: Bacterial transcriptional activator domain; 95.07
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 95.04
KOG4162799 consensus Predicted calmodulin-binding protein [Si 94.99
PRK11906458 transcriptional regulator; Provisional 94.95
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 94.87
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 94.61
KOG2471 696 consensus TPR repeat-containing protein [General f 94.37
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 94.29
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 94.27
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 94.15
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 94.14
PF13512142 TPR_18: Tetratricopeptide repeat 94.06
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 93.78
KOG3785557 consensus Uncharacterized conserved protein [Funct 93.77
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 93.73
PLN03077857 Protein ECB2; Provisional 93.68
cd0268475 MIT_2 MIT: domain contained within Microtubule Int 93.67
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 93.61
cd09034345 BRO1_Alix_like Protein-interacting Bro1-like domai 93.58
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 93.54
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 93.52
KOG4648 536 consensus Uncharacterized conserved protein, conta 93.52
PF0421269 MIT: MIT (microtubule interacting and transport) d 93.37
cd0267875 MIT_VPS4 MIT: domain contained within Microtubule 93.32
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 93.13
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 92.99
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 92.96
COG4700251 Uncharacterized protein conserved in bacteria cont 92.69
cd09240346 BRO1_Alix Protein-interacting, N-terminal, Bro1-li 92.69
cd09242348 BRO1_ScBro1_like Protein-interacting, N-terminal, 92.46
PF10255404 Paf67: RNA polymerase I-associated factor PAF67; I 92.42
cd0268377 MIT_1 MIT: domain contained within Microtubule Int 92.22
KOG4340 459 consensus Uncharacterized conserved protein [Funct 92.21
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 92.1
cd0268176 MIT_calpain7_1 MIT: domain contained within Microt 92.0
KOG0495913 consensus HAT repeat protein [RNA processing and m 91.99
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 91.93
PF10952140 DUF2753: Protein of unknown function (DUF2753); In 91.91
cd09241355 BRO1_ScRim20-like Protein-interacting, N-terminal, 91.89
KOG1915677 consensus Cell cycle control protein (crooked neck 91.77
PRK10153517 DNA-binding transcriptional activator CadC; Provis 91.71
smart0074577 MIT Microtubule Interacting and Trafficking molecu 91.45
KOG2300 629 consensus Uncharacterized conserved protein [Funct 91.38
cd0265675 MIT MIT: domain contained within Microtubule Inter 91.38
PLN03077857 Protein ECB2; Provisional 91.26
PF00244236 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14 91.03
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 90.66
cd0268275 MIT_AAA_Arch MIT: domain contained within Microtub 90.52
smart00101244 14_3_3 14-3-3 homologues. 14-3-3 homologues mediat 90.44
PF11817247 Foie-gras_1: Foie gras liver health family 1; Inte 90.31
COG4105254 ComL DNA uptake lipoprotein [General function pred 90.22
KOG2471 696 consensus TPR repeat-containing protein [General f 90.1
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 89.98
KOG2561568 consensus Adaptor protein NUB1, contains UBA domai 89.69
KOG1550552 consensus Extracellular protein SEL-1 and related 89.69
PF10345 608 Cohesin_load: Cohesin loading factor; InterPro: IP 89.62
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 89.45
cd0268075 MIT_calpain7_2 MIT: domain contained within Microt 89.2
cd09239361 BRO1_HD-PTP_like Protein-interacting, N-terminal, 88.9
KOG2709 560 consensus Uncharacterized conserved protein [Funct 88.78
PF0421269 MIT: MIT (microtubule interacting and transport) d 88.59
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 88.45
KOG2047835 consensus mRNA splicing factor [RNA processing and 88.27
cd0267775 MIT_SNX15 MIT: domain contained within Microtubule 87.83
KOG1308377 consensus Hsp70-interacting protein Hip/Transient 87.38
PF08626 1185 TRAPPC9-Trs120: Transport protein Trs120 or TRAPPC 87.25
cd0268377 MIT_1 MIT: domain contained within Microtubule Int 86.95
KOG3616 1636 consensus Selective LIM binding factor [Transcript 86.91
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 86.81
PF04910360 Tcf25: Transcriptional repressor TCF25; InterPro: 86.74
cd09246353 BRO1_Alix_like_1 Protein-interacting, N-terminal, 86.7
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 86.4
COG4700251 Uncharacterized protein conserved in bacteria cont 86.36
COG1382119 GimC Prefoldin, chaperonin cofactor [Posttranslati 86.35
KOG1118366 consensus Lysophosphatidic acid acyltransferase en 86.27
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 86.06
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 85.99
KOG3785 557 consensus Uncharacterized conserved protein [Funct 85.83
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 85.25
PF03097377 BRO1: BRO1-like domain; InterPro: IPR004328 The BR 85.18
KOG2300629 consensus Uncharacterized conserved protein [Funct 84.88
PF12309371 KBP_C: KIF-1 binding protein C terminal; InterPro: 84.56
cd0268275 MIT_AAA_Arch MIT: domain contained within Microtub 84.52
KOG4814 872 consensus Uncharacterized conserved protein [Funct 84.07
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 84.0
KOG3616 1636 consensus Selective LIM binding factor [Transcript 83.89
PF09670379 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02 83.88
PHA02537230 M terminase endonuclease subunit; Provisional 83.74
COG2976207 Uncharacterized protein conserved in bacteria [Fun 83.73
PF10345 608 Cohesin_load: Cohesin loading factor; InterPro: IP 83.59
PF05278269 PEARLI-4: Arabidopsis phospholipase-like protein ( 83.55
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 83.41
KOG3364149 consensus Membrane protein involved in organellar 82.79
smart0074577 MIT Microtubule Interacting and Trafficking molecu 81.83
cd0267875 MIT_VPS4 MIT: domain contained within Microtubule 81.53
cd0267979 MIT_spastin MIT: domain contained within Microtubu 81.4
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 81.29
cd0265675 MIT MIT: domain contained within Microtubule Inter 80.81
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 80.74
KOG1308377 consensus Hsp70-interacting protein Hip/Transient 80.25
>KOG4563 consensus Cell cycle-regulated histone H1-binding protein [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information 
Probab=99.92  E-value=2e-24  Score=218.40  Aligned_cols=272  Identities=25%  Similarity=0.336  Sum_probs=188.2

Q ss_pred             hHHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHHHhhCCCChhHHHHHHHHHHHHHhhhhccCCccCCCCCCc--CCC
Q 011759           62 TVEFADELMEKGTNALKESDYGEAAECFSRALEIRVSHYGELALECVNAYYQYGRALLYKAQEEADPLVSVPKKE--GDS  139 (478)
Q Consensus        62 ~l~~A~~L~~~G~~~~~~gdy~eAve~ys~Alei~~~~~Ge~~pe~A~~y~~YG~ALl~~a~~esdvLg~~~~~~--~e~  139 (478)
                      .-.++..|+.+|+++|.+++|+.|++.|++|+++..++||+.|.+|+++||+||++||++++.++.||||.....  ++.
T Consensus        37 ~~~~~e~lv~~G~~~~~~~d~~~Avda~s~A~~l~~ei~Ge~~~e~~eal~~YGkslLela~~e~~VL~nale~~~~eE~  116 (400)
T KOG4563|consen   37 KEKTLEELVQAGRRALCNNDIDKAVDALSEATELSDEIYGEKHLETFEALFLYGKSLLELAKEESQVLGNALETESAEEE  116 (400)
T ss_pred             HHHHHHHHHHhhhHHHhcccHHHHHHHHHHHHHHHHHHhhhhHHHHHHHHHHHHHHHHHHHHHHHHhhccccccccccch
Confidence            446689999999999999999999999999999999999999999999999999999999999999999976321  110


Q ss_pred             CCCCCCccccccccCCCCCccCCCCcccccCCCCC-cCccc---CCCCCCCCCccCCCCCccccccccCcChHHHHHHHH
Q 011759          140 QQGSDKDDSVKNAVNGESSTASVSSSAEQHGSSNN-QDEAA---DDVPGDNEEDEEGNDGENVAEADEDESDLDLAWKML  215 (478)
Q Consensus       140 ~~~~~~de~~~~~~~~e~a~~~~s~~~~~~~~~~~-~d~~~---~dv~~e~~ed~e~~~~E~~~e~eEd~ddle~AwE~L  215 (478)
                      .-....+.+.                     ..|+ .+..+   ..+..-+.+..+.+..++....+++++++..+|+.|
T Consensus       117 e~~~s~e~s~---------------------e~nn~~e~vee~r~~~a~~~kekeEae~~ed~~~~e~e~dt~k~~wE~L  175 (400)
T KOG4563|consen  117 EVEKSGELSD---------------------EENNNKETVEEYRYGLALLEKEKEEAEKTEDKPAAEDEVDTMKLAWEEL  175 (400)
T ss_pred             hhccccccch---------------------hhhccHHHHHHHHhhhhhhhhhhhhcccccCCccccchhhhhhhhhhhh
Confidence            0000000000                     0000 00000   000000000001111122333445678999999999


Q ss_pred             HHHHHHHHHhcCC---------------CchHHHHHHHHHHHHHhcCCHHHHHHHHHHHHHHHHHhcCCCCh-HHHHHHH
Q 011759          216 DVARAIAEKHWGD---------------SMEKVDILSALAEVALEREDIETSLSDYQKALTILERMVEPDSR-HIAELNF  279 (478)
Q Consensus       216 e~Ar~I~ek~l~~---------------~~~~Ad~~~~LGev~le~g~feeAl~dy~kAL~I~~~llg~d~r-~iAea~~  279 (478)
                      +..|+|-.+....               .+.+++.+..+|.-.+..++|++|+.+..++|.|.+-++++.+| .++..+.
T Consensus       176 e~sr~~~~~~~~s~~~~qe~k~~l~~~wdle~~~~l~~~~a~gias~k~eqal~d~ee~~sIs~~~l~~esrk~~a~~~~  255 (400)
T KOG4563|consen  176 ETSRVIADKKSESLEAEQEGKGDLILGWDLELADVLKLLGAHGIASGKYEQALEDAEEALSISRVDLPEESRKEIAQTVD  255 (400)
T ss_pred             hhhccccchhhhccccccccccchhhhhccccchhhhccCCccccccchhhhhHHHHHHhhhhhccccHHHHHHHhhhhh
Confidence            9999997665331               13345666666666668899999999999999999999999999 6999999


Q ss_pred             HHHHHHHcCCCchHHHHHHHHHHHHHHHHHHHHHHHHHhhccCCCCCCCccccccccccccccccchhhhHHHHHHHHHH
Q 011759          280 RICLCLEIGSKPQEAIPYCQKAISVCKSRVQRLLNEVKSLGESATSSAPAELDDGIQQSSSEFQNDKLLTDKEAEIETLS  359 (478)
Q Consensus       280 ~LG~ay~~~~~~eeAl~~~ekAL~I~k~rl~~l~~~l~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~~~Ei~elk  359 (478)
                      .|+........+++...+|..    ++..|-.++++++.....+           +       ...-.+...+.++++|+
T Consensus       256 il~~~~~~s~~~Ee~~~~~~~----~KnvLi~~e~Ev~~~~~k~-----------~-------d~~~~es~~~~~~~ele  313 (400)
T KOG4563|consen  256 ILCSAAESSLEREEIESSFSD----TKNVLIEREREVKDDLEKG-----------V-------DDNFRESECLSELKELE  313 (400)
T ss_pred             hccccccchhHHHHHHHHHHH----hhhHHHHHHHhhccccccc-----------c-------cccccchhHHHhhhhHH
Confidence            999988877777766666554    4445555555555433211           0       00113467889999999


Q ss_pred             hhHHHHHHHHHHHHHhh
Q 011759          360 GLCGDLEKKLEDLQQVA  376 (478)
Q Consensus       360 ~ll~dl~~KieDlk~~~  376 (478)
                      ++||.|+++|-|++..+
T Consensus       314 e~ip~leq~i~d~k~~A  330 (400)
T KOG4563|consen  314 EMIPELEQAILDAKASA  330 (400)
T ss_pred             hHHHHHHHHHHHhccch
Confidence            99999999999998743

>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG4563 consensus Cell cycle-regulated histone H1-binding protein [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>cd02684 MIT_2 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>cd09034 BRO1_Alix_like Protein-interacting Bro1-like domain of mammalian Alix and related domains Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PF04212 MIT: MIT (microtubule interacting and transport) domain; InterPro: IPR007330 The MIT domain is found in vacuolar sorting proteins, spastin (probable ATPase involved in the assembly or function of nuclear protein complexes), and a sorting nexin, which may play a role in intracellular trafficking Back     alignment and domain information
>cd02678 MIT_VPS4 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>cd09240 BRO1_Alix Protein-interacting, N-terminal, Bro1-like domain of mammalian Alix and related domains Back     alignment and domain information
>cd09242 BRO1_ScBro1_like Protein-interacting, N-terminal, Bro1-like domain of Saccharomyces cerevisiae Bro1 and related proteins Back     alignment and domain information
>PF10255 Paf67: RNA polymerase I-associated factor PAF67; InterPro: IPR019382 RNA polymerase I is a multi-subunit enzyme and its transcription competence is dependent on the presence of PAF67 [] Back     alignment and domain information
>cd02683 MIT_1 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>cd02681 MIT_calpain7_1 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PF10952 DUF2753: Protein of unknown function (DUF2753); InterPro: IPR020206 This entry represents a group of uncharacterised proteins Back     alignment and domain information
>cd09241 BRO1_ScRim20-like Protein-interacting, N-terminal, Bro1-like domain of Saccharomyces cerevisiae Rim20 and related proteins Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>smart00745 MIT Microtubule Interacting and Trafficking molecule domain Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd02656 MIT MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PF00244 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14-3-3 proteins are a large family of approximately 30kDa acidic proteins which exist primarily as homo- and heterodimeric within all eukaryotic cells [, ] Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>cd02682 MIT_AAA_Arch MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>smart00101 14_3_3 14-3-3 homologues Back     alignment and domain information
>PF11817 Foie-gras_1: Foie gras liver health family 1; InterPro: IPR021773 Mutating the gene foie gras in zebrafish has been shown to affect development; the mutants develop large, lipid-filled hepatocytes in the liver, resembling those in individuals with fatty liver disease [] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>KOG2561 consensus Adaptor protein NUB1, contains UBA domain [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>cd02680 MIT_calpain7_2 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>cd09239 BRO1_HD-PTP_like Protein-interacting, N-terminal, Bro1-like domain of mammalian His-Domain type N23 protein tyrosine phosphatase and related domains Back     alignment and domain information
>KOG2709 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04212 MIT: MIT (microtubule interacting and transport) domain; InterPro: IPR007330 The MIT domain is found in vacuolar sorting proteins, spastin (probable ATPase involved in the assembly or function of nuclear protein complexes), and a sorting nexin, which may play a role in intracellular trafficking Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>cd02677 MIT_SNX15 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF08626 TRAPPC9-Trs120: Transport protein Trs120 or TRAPPC9, TRAPP II complex subunit; InterPro: IPR013935 The trafficking protein particle complex TRAPP is a multi-protein complex needed in the early stages of the secretory pathway Back     alignment and domain information
>cd02683 MIT_1 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>cd09246 BRO1_Alix_like_1 Protein-interacting, N-terminal, Bro1-like domain of an Uncharacterized family of the BRO1_Alix_like superfamily Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>COG1382 GimC Prefoldin, chaperonin cofactor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1118 consensus Lysophosphatidic acid acyltransferase endophilin/SH3GL, involved in synaptic vesicle formation [Lipid transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF03097 BRO1: BRO1-like domain; InterPro: IPR004328 The BRO1 domain has about 390 residues and occurs in a number of eukaryotic proteins such as yeast BRO1 and human PDCD6IP/Alix that are involved in protein targeting to the vacuole or lysosome Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12309 KBP_C: KIF-1 binding protein C terminal; InterPro: IPR022083 This family of proteins is found in bacteria and eukaryotes Back     alignment and domain information
>cd02682 MIT_AAA_Arch MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>KOG4814 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>PF09670 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02710) Back     alignment and domain information
>PHA02537 M terminase endonuclease subunit; Provisional Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>PF05278 PEARLI-4: Arabidopsis phospholipase-like protein (PEARLI 4); InterPro: IPR007942 This family contains several phospholipase-like proteins from Arabidopsis thaliana and other members of the Streptophyta which are homologous to PEARLI 4 Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>smart00745 MIT Microtubule Interacting and Trafficking molecule domain Back     alignment and domain information
>cd02678 MIT_VPS4 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>cd02679 MIT_spastin MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>cd02656 MIT MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query478
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-06
2gw1_A514 Mitochondrial precursor proteins import receptor; 5e-08
2gw1_A514 Mitochondrial precursor proteins import receptor; 5e-04
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 2e-07
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 5e-04
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-07
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 6e-07
3q15_A378 PSP28, response regulator aspartate phosphatase H; 1e-05
3q15_A378 PSP28, response regulator aspartate phosphatase H; 6e-05
3q15_A378 PSP28, response regulator aspartate phosphatase H; 6e-05
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 1e-05
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 2e-05
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 8e-04
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 2e-05
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 5e-05
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 6e-04
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 7e-04
3qww_A433 SET and MYND domain-containing protein 2; methyltr 7e-05
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 5e-04
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 8e-04
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 9e-04
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 9e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 60.3 bits (145), Expect = 9e-10
 Identities = 38/260 (14%), Positives = 84/260 (32%), Gaps = 57/260 (21%)

Query: 145 KDDSVKNAVNGESSTASVSSSAEQHGSSNNQDEAADDVPGDNEEDEEGNDGENVAEADED 204
            +   K+    +    S+ S  E            D +               +   D  
Sbjct: 31  DNFDCKDV---QDMPKSILSKEE-----------IDHI---------------IMSKDAV 61

Query: 205 ESDLDLAWKMLDVARAIAEKHWGDSMEKVD---ILSALAEVALEREDIETSLSDYQKALT 261
              L L W +L     + +K   + +   +   ++S +     +   +     + +  L 
Sbjct: 62  SGTLRLFWTLLSKQEEMVQKFVEEVLRI-NYKFLMSPIKTEQRQPSMMTRMYIEQRDRLY 120

Query: 262 ILERMVEPD--SRHIAELNFRICLCLEIGSKPQEAI-----PYCQK---AISVCKS-RVQ 310
              ++      SR    L  R  L LE+  +P + +         K   A+ VC S +VQ
Sbjct: 121 NDNQVFAKYNVSRLQPYLKLRQAL-LEL--RPAKNVLIDGVLGSGKTWVALDVCLSYKVQ 177

Query: 311 RLL-NEVK--SLGESATSSAPAELDDGIQQSSSEFQNDKLLTDKEAEIETLSGLCGDLEK 367
             +  ++   +L    +   P  + + +Q+    +Q D   T +      +      ++ 
Sbjct: 178 CKMDFKIFWLNLKNCNS---PETVLEMLQKLL--YQIDPNWTSRSDHSSNIKLRIHSIQA 232

Query: 368 KLEDLQQVALFPKSILSEIL 387
           +L  L +   +   +L  +L
Sbjct: 233 ELRRLLKSKPYENCLL--VL 250
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Length = 293 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Length = 433 Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Length = 429 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query478
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 99.81
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.76
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.7
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.69
3qww_A433 SET and MYND domain-containing protein 2; methyltr 99.68
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.68
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.65
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 99.64
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.63
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 99.63
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.62
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.61
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.6
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.58
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.58
3qww_A433 SET and MYND domain-containing protein 2; methyltr 99.57
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.57
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.55
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.55
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.54
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 99.53
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.52
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.5
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.5
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.5
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.49
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.49
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.47
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.47
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.46
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.46
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 99.45
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.45
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.45
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.45
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.44
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.44
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.44
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.43
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.43
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.42
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.41
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.39
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.39
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.39
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.39
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.39
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.38
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.38
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.37
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.37
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.36
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.36
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.35
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.34
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.34
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.33
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.33
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.33
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.32
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.32
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.32
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.32
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.3
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.3
3u4t_A272 TPR repeat-containing protein; structural genomics 99.29
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.29
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.29
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.29
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.29
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.28
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.28
3u4t_A272 TPR repeat-containing protein; structural genomics 99.28
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.28
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.26
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.26
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.25
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.25
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.25
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.25
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.24
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.24
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.24
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.23
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.23
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.21
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.21
4g1t_A 472 Interferon-induced protein with tetratricopeptide 99.19
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.18
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 99.18
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.18
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.18
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.18
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.18
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.17
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.17
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 99.17
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.16
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.16
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.16
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.16
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.15
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.14
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.14
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.13
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.13
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.13
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.13
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.13
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.12
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.12
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.09
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 99.09
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.09
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.08
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.08
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 99.08
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.07
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.07
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.07
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.07
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 99.06
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.05
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.05
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.03
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.02
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.01
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.0
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.0
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.99
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.98
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 98.98
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 98.97
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.97
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.97
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.97
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.96
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.96
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 98.94
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.94
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.9
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.89
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.88
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 98.87
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 98.87
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.86
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 98.82
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 98.81
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.81
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.81
3k9i_A117 BH0479 protein; putative protein binding protein, 98.81
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.79
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.78
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.76
2kat_A115 Uncharacterized protein; NESG, structure, structur 98.76
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.75
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.75
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.75
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.74
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 98.74
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.71
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.71
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.68
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.67
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.66
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.66
3k9i_A117 BH0479 protein; putative protein binding protein, 98.63
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 98.61
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.61
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.6
2l6j_A111 TPR repeat-containing protein associated with HSP; 98.59
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 98.57
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 98.55
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 98.55
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.53
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 98.52
2l6j_A111 TPR repeat-containing protein associated with HSP; 98.5
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.41
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.35
2kat_A115 Uncharacterized protein; NESG, structure, structur 98.32
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.28
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 98.28
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 98.25
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 98.22
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 98.18
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 98.18
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.17
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 98.17
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 98.16
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 98.15
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 98.09
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.05
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.97
1pc2_A152 Mitochondria fission protein; unknown function; NM 97.97
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 97.97
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 97.95
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 97.85
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 97.82
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 97.76
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 97.61
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 97.61
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 97.53
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 97.42
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 97.41
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 97.41
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 97.35
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.18
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 97.13
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 97.04
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 96.92
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 96.82
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 96.75
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 96.74
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 96.63
1pc2_A152 Mitochondria fission protein; unknown function; NM 96.44
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 96.09
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 95.88
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 95.44
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 95.4
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 95.15
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 95.13
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 95.08
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 95.02
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 94.19
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 94.14
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 93.93
1ya0_A 497 SMG-7 transcript variant 2; alpha-helical repeat, 93.14
4b4t_S523 RPN3, 26S proteasome regulatory subunit RPN3; hydr 91.82
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 91.57
2cpt_A117 SKD1 protein, vacuolar sorting protein 4B; MIT, he 91.3
4b4t_R429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 90.92
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 90.6
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 90.27
1o9d_A260 14-3-3-like protein C; protein-binding, fusicoccin 90.27
4b4t_R429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 90.13
2v6x_A85 Vacuolar protein sorting-associated protein 4; pro 89.54
2o8p_A227 14-3-3 domain containing protein; signaling protei 89.52
2w2u_A83 Hypothetical P60 katanin; hydrolase transport comp 89.25
3iqu_A236 14-3-3 protein sigma; signal transuction, nucleus, 89.17
1wfd_A93 Hypothetical protein 1500032H18; MIT domain, struc 89.16
2v6y_A83 AAA family ATPase, P60 katanin; MIT, VPS4, archaea 88.5
4a5x_A86 MITD1, MIT domain-containing protein 1; protein tr 88.17
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 88.12
2br9_A234 14-3-3E, 14-3-3 protein epsilon; cell regulator pr 87.98
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 87.23
3c3r_A380 Programmed cell death 6-interacting protein; ALIX 86.87
3uzd_A248 14-3-3 protein gamma; structural genomics, SGC, st 86.44
2crb_A97 Nuclear receptor binding factor 2; NRBF-2, MIT dom 86.03
2vkj_A106 TM1634; membrane protein, TPR motif joint center f 85.74
2crb_A97 Nuclear receptor binding factor 2; NRBF-2, MIT dom 85.5
2xs1_A 704 Programmed cell death 6-interacting protein; prote 85.05
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 84.82
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 84.58
2npm_A260 14-3-3 domain containing protein; cell regulator p 84.58
3r9m_A376 BRO1 domain-containing protein BROX; protein bindi 84.45
2v6x_A85 Vacuolar protein sorting-associated protein 4; pro 84.31
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 83.94
2cpt_A117 SKD1 protein, vacuolar sorting protein 4B; MIT, he 83.81
1zb1_A392 BRO1 protein; AIP1, BRO1 domain, SNF7, trafficking 83.68
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 83.4
3ubw_A261 14-3-3E, 14-3-3 protein epsilon; adapter protein, 82.95
4a5x_A86 MITD1, MIT domain-containing protein 1; protein tr 81.33
3rau_A363 Tyrosine-protein phosphatase non-receptor type 23; 80.8
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 80.71
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
Probab=99.81  E-value=7.1e-19  Score=187.67  Aligned_cols=157  Identities=15%  Similarity=0.026  Sum_probs=148.7

Q ss_pred             hHHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHHHhhCCCChhHHHHHHHHHHHHHhhhhccCCccCCCCCCcCCCCC
Q 011759           62 TVEFADELMEKGTNALKESDYGEAAECFSRALEIRVSHYGELALECVNAYYQYGRALLYKAQEEADPLVSVPKKEGDSQQ  141 (478)
Q Consensus        62 ~l~~A~~L~~~G~~~~~~gdy~eAve~ys~Alei~~~~~Ge~~pe~A~~y~~YG~ALl~~a~~esdvLg~~~~~~~e~~~  141 (478)
                      .+..+..+++....+..+|+|++|..+|.++|+++..++|+.||.++.+|+++|.+|..+                    
T Consensus       305 ~l~~a~~~le~a~~~~~qg~~~eA~~l~~~aL~~~~~~lg~~Hp~~a~~~~nLa~~y~~~--------------------  364 (490)
T 3n71_A          305 MIQFSKDTLEKIDKARSEGLYHEVVKLCRECLEKQEPVFADTNLYVLRLLSIASEVLSYL--------------------  364 (490)
T ss_dssp             HHHHHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHHTTTBCTTSHHHHHHHHHHHHHHHHT--------------------
T ss_pred             HHHHHHHHHHHHHHHHhCCCHHHHHHHHHHHHHHHHHhcCCCCHHHHHHHHHHHHHHHHh--------------------
Confidence            355688888999999999999999999999999999999999999999999999999865                    


Q ss_pred             CCCCccccccccCCCCCccCCCCcccccCCCCCcCcccCCCCCCCCCccCCCCCccccccccCcChHHHHHHHHHHHHHH
Q 011759          142 GSDKDDSVKNAVNGESSTASVSSSAEQHGSSNNQDEAADDVPGDNEEDEEGNDGENVAEADEDESDLDLAWKMLDVARAI  221 (478)
Q Consensus       142 ~~~~de~~~~~~~~e~a~~~~s~~~~~~~~~~~~d~~~~dv~~e~~ed~e~~~~E~~~e~eEd~ddle~AwE~Le~Ar~I  221 (478)
                                                                                      ++++.|..+++.++.|
T Consensus       365 ----------------------------------------------------------------g~~~eA~~~~~~aL~i  380 (490)
T 3n71_A          365 ----------------------------------------------------------------QAYEEASHYARRMVDG  380 (490)
T ss_dssp             ----------------------------------------------------------------TCHHHHHHHHHHHHHH
T ss_pred             ----------------------------------------------------------------cCHHHHHHHHHHHHHH
Confidence                                                                            4688899999999999


Q ss_pred             HHHhcC-CCchHHHHHHHHHHHHHhcCCHHHHHHHHHHHHHHHHHhcCCCChHHHHHHHHHHHHHHcCCCchHHHHHHHH
Q 011759          222 AEKHWG-DSMEKVDILSALAEVALEREDIETSLSDYQKALTILERMVEPDSRHIAELNFRICLCLEIGSKPQEAIPYCQK  300 (478)
Q Consensus       222 ~ek~l~-~~~~~Ad~~~~LGev~le~g~feeAl~dy~kAL~I~~~llg~d~r~iAea~~~LG~ay~~~~~~eeAl~~~ek  300 (478)
                      +++.++ +|+.++.+|++||.+|..+|+|++|+.+|++||+|++..+|++||.+++++.+|+.++..+++|++|...|++
T Consensus       381 ~~~~lG~~Hp~~a~~l~nLa~~~~~~G~~~eA~~~~~~Al~i~~~~lG~~Hp~~~~~~~~l~~~~~e~~~~~~ae~~~~~  460 (490)
T 3n71_A          381 YMKLYHHNNAQLGMAVMRAGLTNWHAGHIEVGHGMICKAYAILLVTHGPSHPITKDLEAMRMQTEMELRMFRQNEFMYHK  460 (490)
T ss_dssp             HHHHSCTTCHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHHTCTTSHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHcCCCCHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHhCCCChHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            999988 6899999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HH
Q 011759          301 AI  302 (478)
Q Consensus       301 AL  302 (478)
                      +.
T Consensus       461 ~~  462 (490)
T 3n71_A          461 MR  462 (490)
T ss_dssp             HH
T ss_pred             HH
Confidence            74
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>2cpt_A SKD1 protein, vacuolar sorting protein 4B; MIT, helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.7.14.1 Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>1o9d_A 14-3-3-like protein C; protein-binding, fusicoccin, 14-3-3 family, activating drug; HET: TPO; 2.3A {Nicotiana tabacum} SCOP: a.118.7.1 PDB: 1o9c_A* 1o9e_A* 1o9f_A* 3e6y_A* Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2v6x_A Vacuolar protein sorting-associated protein 4; protein transport, vacuole, endosome, transport, ESCRT-III, VPS2, VPS4, SKD1, VPS4B, VPS4A; 1.98A {Saccharomyces cerevisiae} Back     alignment and structure
>2o8p_A 14-3-3 domain containing protein; signaling protein, 14-3-3, cell regulator protein, cryptospo parvum, structural genomics; HET: MSE; 1.82A {Cryptosporidium parvum} SCOP: a.118.7.1 Back     alignment and structure
>2w2u_A Hypothetical P60 katanin; hydrolase transport complex, nucleotide-binding, ESCRT, AAA-ATPase, cytokinesis, ATP-binding; 2.20A {Sulfolobus acidocaldarius} Back     alignment and structure
>3iqu_A 14-3-3 protein sigma; signal transuction, nucleus, phosphoprotein, secreted, prote binding, signaling protein; HET: SEP; 1.05A {Homo sapiens} SCOP: a.118.7.1 PDB: 3iqj_A* 3iqv_A* 3mhr_A* 3lw1_A* 3o8i_A* 3p1n_A* 3p1o_A* 3t0l_A* 3t0m_A* 3u9x_A* 3ux0_A* 4dat_A* 4dau_A* 3p1s_A* 3p1r_A* 3smk_A* 3spr_A* 3p1q_A* 3p1p_A* 3sml_A* ... Back     alignment and structure
>1wfd_A Hypothetical protein 1500032H18; MIT domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: a.7.14.1 Back     alignment and structure
>2v6y_A AAA family ATPase, P60 katanin; MIT, VPS4, archaea, AAA-ATPase, ATP-binding, microtubule INT and trafficking domain, nucleotide-binding; HET: SRT; 2.40A {Sulfolobus solfataricus} PDB: 2v6y_B* Back     alignment and structure
>4a5x_A MITD1, MIT domain-containing protein 1; protein transport, ESCRT, cytokinesis, midbody; HET: P15; 1.91A {Homo sapiens} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2br9_A 14-3-3E, 14-3-3 protein epsilon; cell regulator protein, 14-3-3, phosphoserine, structural GE consortium, SGC, ywhae; HET: SEP; 1.75A {Homo sapiens} PDB: 3ual_A* 2o98_A* 3m50_A* 3m51_A* 3axy_C* Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>3c3r_A Programmed cell death 6-interacting protein; ALIX BRO1 CHMP4C amphipathic-helix, apoptosis, HOST-virus interaction, protein transport, transport; 2.02A {Homo sapiens} PDB: 2oew_A 3c3o_A 3c3q_A Back     alignment and structure
>3uzd_A 14-3-3 protein gamma; structural genomics, SGC, structural genomics consortium, MA alpha, phosphoserine, phosphothreonine; HET: SEP; 1.86A {Homo sapiens} PDB: 4e2e_A 2b05_A* 2c63_A* 2c74_A* 4dnk_A 4gnt_A 2bq0_A 2c23_A 2c1n_A* 2c1j_A* 2btp_A* Back     alignment and structure
>2crb_A Nuclear receptor binding factor 2; NRBF-2, MIT domain, helix bundle, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.7.16.1 Back     alignment and structure
>2vkj_A TM1634; membrane protein, TPR motif joint center for structural GENO JCSG, structural genomics; 1.65A {Thermotoga maritima} PDB: 2vko_A* Back     alignment and structure
>2crb_A Nuclear receptor binding factor 2; NRBF-2, MIT domain, helix bundle, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.7.16.1 Back     alignment and structure
>2xs1_A Programmed cell death 6-interacting protein; protein transport-viral protein complex, cell cycle; 2.30A {Homo sapiens} PDB: 2xs8_A 2oev_A 2r05_A 2r02_A 2r03_A 2oex_A 2ojq_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>2npm_A 14-3-3 domain containing protein; cell regulator protein 14-3-3, struc genomics, structural genomics consortium, SGC, protein BIND; HET: SEP; 2.52A {Cryptosporidium parvum} Back     alignment and structure
>3r9m_A BRO1 domain-containing protein BROX; protein binding; 1.95A {Homo sapiens} PDB: 3um3_A 3zxp_A 3um2_A 3um1_A 3uly_A 3um0_A Back     alignment and structure
>2v6x_A Vacuolar protein sorting-associated protein 4; protein transport, vacuole, endosome, transport, ESCRT-III, VPS2, VPS4, SKD1, VPS4B, VPS4A; 1.98A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>2cpt_A SKD1 protein, vacuolar sorting protein 4B; MIT, helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.7.14.1 Back     alignment and structure
>1zb1_A BRO1 protein; AIP1, BRO1 domain, SNF7, trafficking, protein transport; 1.95A {Saccharomyces cerevisiae} Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3ubw_A 14-3-3E, 14-3-3 protein epsilon; adapter protein, signaling protein, signaling protein-protei complex; HET: SEP; 1.90A {Homo sapiens} Back     alignment and structure
>4a5x_A MITD1, MIT domain-containing protein 1; protein transport, ESCRT, cytokinesis, midbody; HET: P15; 1.91A {Homo sapiens} Back     alignment and structure
>3rau_A Tyrosine-protein phosphatase non-receptor type 23; BRO1 domain, hydrolase; 1.95A {Homo sapiens} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 478
d1qqea_290 a.118.8.1 (A:) Vesicular transport protein sec17 { 1e-05
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 4e-05
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 0.001
d1w3ba_ 388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 0.002
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 0.002
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 290 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: Vesicular transport protein sec17
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

 Score = 45.0 bits (105), Expect = 1e-05
 Identities = 32/267 (11%), Positives = 71/267 (26%), Gaps = 10/267 (3%)

Query: 57  GEREKTVEFADELMEKGTNALKESDYGEAAECFSRALEIRVSHYGELALECVNAYYQYGR 116
            +  K  E AD  ++  T      +   A + F +A + +     E   E  N Y +  +
Sbjct: 28  SDSYKFEEAADLCVQAATIYRLRKELNLAGDSFLKAADYQKKAGNE--DEAGNTYVEAYK 85

Query: 117 ALLYKAQEEADPLVSVPKKEGDSQQGSDKDDSVKNAVNGESSTASVSSSAEQHGSSNNQD 176
                              +  + +G  +  +      GE     +   A+     +  +
Sbjct: 86  CFKSGGNSVNAVDSLENAIQIFTHRGQFRRGANFKFELGEILENDLHDYAKAI---DCYE 142

Query: 177 EAADDVPGDNEEDEEGNDGENVAEADEDESDLDLAWKMLDVARAIAEKHWGDSMEKVDIL 236
            A +    D             A+    +     A  +       +  +        D  
Sbjct: 143 LAGEWYAQDQSVALSNKCFIKCADLKALDGQYIEASDIYSKLIKSSMGNRLSQWSLKDYF 202

Query: 237 SALAEVALEREDIETSLSDYQKALTILERMVEPDSRHIAELNFRICLCLEIGS--KPQEA 294
                  L   D   +    Q+  +        DSR  +     +   +  G   +  E 
Sbjct: 203 LKKGLCQLAATDAVAAARTLQEGQSEDPNF--ADSRE-SNFLKSLIDAVNEGDSEQLSEH 259

Query: 295 IPYCQKAISVCKSRVQRLLNEVKSLGE 321
                  + + K ++  L    +S+ +
Sbjct: 260 CKEFDNFMRLDKWKITILNKIKESIQQ 286
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query478
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.5
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.48
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.47
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.46
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.4
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 99.39
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.36
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 99.35
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.32
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.32
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.26
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.25
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.24
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.21
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.2
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.2
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.18
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.17
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.17
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.13
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.11
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.1
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.07
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.07
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 98.98
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.95
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 98.95
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 98.94
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.94
d1hz4a_366 Transcription factor MalT domain III {Escherichia 98.92
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.92
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 98.92
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.9
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 98.87
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.83
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.8
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.78
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 98.75
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.74
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 98.63
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 98.58
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.42
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.36
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.21
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.18
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 98.12
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.98
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 97.56
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 97.49
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.04
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 97.01
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 96.87
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 96.35
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 96.2
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 96.11
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 95.29
d1wfda_93 Hypothetical protein 1500032H18Rik {Mouse (Mus mus 95.18
d1wr0a177 Vacuolar sorting protein 4b (VPS4B, SKD1 protein) 92.8
d2o8pa1220 14-3-3 domain containing protein cgd7_2470 {Crypto 91.8
d2crba183 Nuclear receptor binding factor 2, NRBF2, N-termin 90.87
d2o02a1230 zeta isoform {Cow (Bos taurus) [TaxId: 9913]} 89.28
d1wfda_93 Hypothetical protein 1500032H18Rik {Mouse (Mus mus 88.63
d1o9da_236 14-3-3-like protein C {Common tobacco (Nicotiana t 88.19
d2crba183 Nuclear receptor binding factor 2, NRBF2, N-termin 87.77
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: Neutrophil cytosolic factor 2 (NCF-2, p67-phox)
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.50  E-value=8.8e-14  Score=127.30  Aligned_cols=141  Identities=15%  Similarity=0.081  Sum_probs=116.8

Q ss_pred             hHHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHHHhhCCCChhHHHHHHHHHHHHHhhhhccCCccCCCCCCcCCCCC
Q 011759           62 TVEFADELMEKGTNALKESDYGEAAECFSRALEIRVSHYGELALECVNAYYQYGRALLYKAQEEADPLVSVPKKEGDSQQ  141 (478)
Q Consensus        62 ~l~~A~~L~~~G~~~~~~gdy~eAve~ys~Alei~~~~~Ge~~pe~A~~y~~YG~ALl~~a~~esdvLg~~~~~~~e~~~  141 (478)
                      ++..+..|.++|..++..|+|+.|+++|.++           .+..+.+||++|.+++.+                    
T Consensus         1 s~~~~~~l~~~g~~~~~~~d~~~Al~~~~~i-----------~~~~~~~~~nlG~~~~~~--------------------   49 (192)
T d1hh8a_           1 SLVEAISLWNEGVLAADKKDWKGALDAFSAV-----------QDPHSRICFNIGCMYTIL--------------------   49 (192)
T ss_dssp             CHHHHHHHHHHHHHHHHTTCHHHHHHHHHTS-----------SSCCHHHHHHHHHHHHHT--------------------
T ss_pred             CHHHHHHHHHHHHHHHHCCCHHHHHHHHHhc-----------CCCCHHHHHHHHHHHHHc--------------------
Confidence            3567889999999999999999999999753           233456899999999875                    


Q ss_pred             CCCCccccccccCCCCCccCCCCcccccCCCCCcCcccCCCCCCCCCccCCCCCccccccccCcChHHHHHHHHHHHHHH
Q 011759          142 GSDKDDSVKNAVNGESSTASVSSSAEQHGSSNNQDEAADDVPGDNEEDEEGNDGENVAEADEDESDLDLAWKMLDVARAI  221 (478)
Q Consensus       142 ~~~~de~~~~~~~~e~a~~~~s~~~~~~~~~~~~d~~~~dv~~e~~ed~e~~~~E~~~e~eEd~ddle~AwE~Le~Ar~I  221 (478)
                                                                                      ++|+.|.+.|+.|+.+
T Consensus        50 ----------------------------------------------------------------g~~~~A~~~~~kAl~l   65 (192)
T d1hh8a_          50 ----------------------------------------------------------------KNMTEAEKAFTRSINR   65 (192)
T ss_dssp             ----------------------------------------------------------------TCHHHHHHHHHHHHHH
T ss_pred             ----------------------------------------------------------------CCchhHHHHHHHHHHH
Confidence                                                                            4678888888888765


Q ss_pred             HHHhcCCCchHHHHHHHHHHHHHhcCCHHHHHHHHHHHHHHHHHh-------cCC-CChHHHHHHHHHHHHHHcCCCchH
Q 011759          222 AEKHWGDSMEKVDILSALAEVALEREDIETSLSDYQKALTILERM-------VEP-DSRHIAELNFRICLCLEIGSKPQE  293 (478)
Q Consensus       222 ~ek~l~~~~~~Ad~~~~LGev~le~g~feeAl~dy~kAL~I~~~l-------lg~-d~r~iAea~~~LG~ay~~~~~~ee  293 (478)
                             .+..+.+|.++|.++..+|+|++|+.+|++||.+.+..       ++. .....++++|++|.+|...+++++
T Consensus        66 -------dp~~~~a~~~~g~~~~~~g~~~~A~~~~~kAl~~~~~n~~~~~~~~~~~~~~~~~e~~~n~a~~~~~~~~~~~  138 (192)
T d1hh8a_          66 -------DKHLAVAYFQRGMLYYQTEKYDLAIKDLKEALIQLRGNQLIDYKILGLQFKLFACEVLYNIAFMYAKKEEWKK  138 (192)
T ss_dssp             -------CTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHTTTTCSEEECGGGTBCCEEEHHHHHHHHHHHHHHTTCHHH
T ss_pred             -------hhhhhhhHHHHHHHHHhhccHHHHHHHHHHHHHhCccCchHHHHHhhhhcccchHHHHHHHHHHHHHCCCHHH
Confidence                   35678999999999999999999999999999865431       111 123457999999999999999999


Q ss_pred             HHHHHHHHHHH
Q 011759          294 AIPYCQKAISV  304 (478)
Q Consensus       294 Al~~~ekAL~I  304 (478)
                      |+.+|++|+.+
T Consensus       139 A~~~l~~A~~~  149 (192)
T d1hh8a_         139 AEEQLALATSM  149 (192)
T ss_dssp             HHHHHHHHHTT
T ss_pred             HHHHHHHHHhc
Confidence            99999999875
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1wfda_ a.7.14.1 (A:) Hypothetical protein 1500032H18Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wr0a1 a.7.14.1 (A:5-81) Vacuolar sorting protein 4b (VPS4B, SKD1 protein) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2o8pa1 a.118.7.1 (A:8-227) 14-3-3 domain containing protein cgd7_2470 {Cryptosporidium parvum [TaxId: 5807]} Back     information, alignment and structure
>d2crba1 a.7.16.1 (A:8-90) Nuclear receptor binding factor 2, NRBF2, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2o02a1 a.118.7.1 (A:1-230) zeta isoform {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1wfda_ a.7.14.1 (A:) Hypothetical protein 1500032H18Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1o9da_ a.118.7.1 (A:) 14-3-3-like protein C {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2crba1 a.7.16.1 (A:8-90) Nuclear receptor binding factor 2, NRBF2, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure