Citrus Sinensis ID: 011856

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470------
MAATITGVGVGLGLSCSSKLTNRFSSSAGSSRCSVKMSVSVEEQRKNFTLKKSEEAFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIIKFEGCYHGHADPFLVKAGSGVATLGLPDSPGVPKGATYETLTAPFNDVSALENLFENNKGEIAAIILEPVVGNSGFIAPKPDFLNAIRRITKENGALLIFDEVMTGFRLAYGGAQEYFGVTPDLTTLGKIIGGGLPVGAYGGRRDIMEMVAPAGPMYQAGTLSGNPLAMTAGIHTLKRLKEPGTYEYLNKITGELTQGIIDAGKKAGHAICGGYISGMFGFFFTEGPVYNFEDAKKSETTKFARFYRGMLEEGVYFAPSQFEAGFTSLAHSSDDIQHTITAAEKVKMRFLF
ccccccccccccccccccccccccccccccccccccccccHHHHcccccHHHHHHHHHHHHccccccccccccccccccccccEEEEccccEEEEcccccEEEEEccHHHHccccccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHcccccEEEccccHHHHHHHHHHHHHcccccccEEEEcccccccccHHHHHcccccccccccccccccHHcccccEEEccccHHHHHHHHHHccccEEEEEEcccccccccccccHHHHHHHHHHHHHcccEEEEEcccccccccccccHHHcccccccccccccccccccccccccHHHHHHHccccccccccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHcccEEEcccccEEEEcccccccccHHHHHHHcHHHHHHHHHHHHHccccccccHHHHHHHcccccHHHHHHHHHHHHHHHHHHcc
ccEEEEcccccccccccccccccccccccccccEEEEEEEEcccccccccHHHHHHHHHHHcccHHHcccHHHHccccccccccEEEEEEcEEEEccccEEEEccHHHccccccEccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHcccccEEEEEccHHHHHHHHHHHHHHHHcccEEEEEcccccccccccccccccccccccccccccccccccccEEEEccccHHHHHHHHHHccccEEEEEEcccEcccccEcccccHHHHHHHHHHHcccEEEEEccccEcccEccHHHHHccccccEEEEcHHHHcccccEEEEEcHHHHccEcccccEcccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEccEEEEEccccccccHHHHHcccHHHHHHHHHHHHHccEEccccccccEEccccccHHHHHHHHHHHHHHHHHHcc
MAATITGVGVGLGLscsskltnrfsssagssrcsvkMSVSVEEQRKNFTLKKSEEAFNVAKelmpggvnspvrafksvggqpivfdsvkgshmwdidgneyidyvgswgpaiighADDQVLAALGETmkkgtsfgapclLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIIKfegcyhghadpflvkagsgvatlglpdspgvpkgatyetltapfndvSALENLFENNKGEIAAIilepvvgnsgfiapkpdFLNAIRRITKENGALLIFDEVMTGFRLAYggaqeyfgvtpdlttlgkiiggglpvgayggrrdimemvapagpmyqagtlsgnplamtAGIHTLkrlkepgtyeYLNKITGELTQGIIDAGKKAGHAICGgyisgmfgffftegpvynfedakkseTTKFARFYRGMleegvyfapsqfeagftslahssddIQHTITAAEKVKMRFLF
MAATITGVGVGLGLSCSSKLTnrfsssagssrcsvkmsVSVEEQRKNFTLKKSEEAFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIIKFEGCYHGHADPFLVKAGSGVATLGLPDSPGVPKGATYETLTAPFNDVSALENLFENNKGEIAAIILEPVVGNSGFIAPKPDFLNAIRRITKENGALLIFDEVMTGFRLAYGGAQEYFGVTPDLTTLGKIIGGGLPVGAYGGRRDIMEMVAPAGPMYQAGTLSGNPLAMTAGIHTLKRLKEPGTYEYLNKITGELTQGIIDAGKKAGHAICGGYISGMFGFFFTEGPVYNFEDAKKSETTKFARFYRGMLEEGVYFAPSQFEAGFTSLAHSSDDIQHTITAAEKVKMRFLF
MAATITgvgvglglSCSSKLTNRFsssagssrcsVKMSVSVEEQRKNFTLKKSEEAFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIIKFEGCYHGHADPFLVKAGSGVATLGLPDSPGVPKGATYETLTAPFNDVSALENLFENNKGEIAAIILEPVVGNSGFIAPKPDFLNAIRRITKENGALLIFDEVMTGFRLAYGGAQEYFGVTPDlttlgkiiggglPVGAYGGRRDIMEMVAPAGPMYQAGTLSGNPLAMTAGIHTLKRLKEPGTYEYLNKITGELTQGIIDAGKKAGHAICGGYISGMFGFFFTEGPVYNFEDAKKSETTKFARFYRGMLEEGVYFAPSQFEAGFTSLAHSSDDIQHTITAAEKVKMRFLF
*****TGVGVGLGLS********************************************************************************IDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIIKFEGCYHGHADPFLVKAGSGVATLGLPDSPGVPKGATYETLTAPFNDVSALENLFENNKGEIAAIILEPVVGNSGFIAPKPDFLNAIRRITKENGALLIFDEVMTGFRLAYGGAQEYFGVTPDLTTLGKIIGGGLPVGAYGGRRDIMEMVAPAGPMYQAGTLSGNPLAMTAGIHTLKRLKEPGTYEYLNKITGELTQGIIDAGKKAGHAICGGYISGMFGFFFTEGPVYNFEDAKKSETTKFARFYRGMLEEGVYFAPSQFEAGFTSLAH*********************
**********GLGLSC**************************************EAFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIIKFEGCYHGHADPFLVKAGSGVATLGLPDSPGVPKGATYETLTAPFNDVSALENLFENNKGEIAAIILEPVVGNSGFIAPKPDFLNAIRRITKENGALLIFDEVMTGFRLAYGGAQEYFGVTPDLTTLGKIIGGGLPVGAYGGRRDIMEMVAPAGPMYQAGTLSGNPLAMTAGIHTLKRLKEPGTYEYLNKITGELTQGIIDAGKKAGHAICGGYISGMFGFFFTEGPVYNFEDAKKSETTKFARFYRGMLEEGVYFAPSQFEAGFTSLAHSSDDIQHTITAAEKVKMRFLF
MAATITGVGVGLGLSCSSKLTN********************EQRKNFTLKKSEEAFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIIKFEGCYHGHADPFLVKAGSGVATLGLPDSPGVPKGATYETLTAPFNDVSALENLFENNKGEIAAIILEPVVGNSGFIAPKPDFLNAIRRITKENGALLIFDEVMTGFRLAYGGAQEYFGVTPDLTTLGKIIGGGLPVGAYGGRRDIMEMVAPAGPMYQAGTLSGNPLAMTAGIHTLKRLKEPGTYEYLNKITGELTQGIIDAGKKAGHAICGGYISGMFGFFFTEGPVYNFEDAKKSETTKFARFYRGMLEEGVYFAPSQFEAGFTSLAHSSDDIQHTITAAEKVKMRFLF
*********VGLGLSCS*************SRCSVKMSVSVEEQRKNFTLKKSEEAFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIIKFEGCYHGHADPFLVKAGSGVATLGLPDSPGVPKGATYETLTAPFNDVSALENLFENNKGEIAAIILEPVVGNSGFIAPKPDFLNAIRRITKENGALLIFDEVMTGFRLAYGGAQEYFGVTPDLTTLGKIIGGGLPVGAYGGRRDIMEMVAPAGPMYQAGTLSGNPLAMTAGIHTLKRLKEPGTYEYLNKITGELTQGIIDAGKKAGHAICGGYISGMFGFFFTEGPVYNFEDAKKSETTKFARFYRGMLEEGVYFAPSQFEAGFTSLAHSSDDIQHTITAAEKVKMRFLF
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAATITGVGVGLGLSCSSKLTNRFSSSAGSSRCSVKMSVSVEEQRKNFTLKKSEEAFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIIKFEGCYHGHADPFLVKAGSGVATLGLPDSPGVPKGATYETLTAPFNDVSALENLFENNKGEIAAIILEPVVGNSGFIAPKPDFLNAIRRITKENGALLIFDEVMTGFRLAYGGAQEYFGVTPDLTTLGKIIGGGLPVGAYGGRRDIMEMVAPAGPMYQAGTLSGNPLAMTAGIHTLKRLKEPGTYEYLNKITGELTQGIIDAGKKAGHAICGGYISGMFGFFFTEGPVYNFEDAKKSETTKFARFYRGMLEEGVYFAPSQFEAGFTSLAHSSDDIQHTITAAEKVKMRFLF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query476 2.2.26 [Sep-21-2011]
Q85WB7473 Glutamate-1-semialdehyde N/A no 0.991 0.997 0.832 0.0
Q42522472 Glutamate-1-semialdehyde yes no 0.991 1.0 0.839 0.0
P42799474 Glutamate-1-semialdehyde no no 0.993 0.997 0.822 0.0
P31593478 Glutamate-1-semialdehyde N/A no 0.966 0.962 0.829 0.0
Q40147481 Glutamate-1-semialdehyde N/A no 0.966 0.956 0.813 0.0
P45621466 Glutamate-1-semialdehyde yes no 0.951 0.972 0.825 0.0
Q6YZE2478 Glutamate-1-semialdehyde yes no 0.943 0.939 0.808 0.0
P18492469 Glutamate-1-semialdehyde N/A no 0.939 0.953 0.804 0.0
B2J7M9432 Glutamate-1-semialdehyde yes no 0.890 0.981 0.739 0.0
B1X023433 Glutamate-1-semialdehyde yes no 0.880 0.967 0.739 0.0
>sp|Q85WB7|GSA_BRANA Glutamate-1-semialdehyde 2,1-aminomutase, chloroplastic OS=Brassica napus GN=GSA PE=2 SV=1 Back     alignment and function desciption
 Score =  828 bits (2138), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/473 (83%), Positives = 437/473 (92%), Gaps = 1/473 (0%)

Query: 1   MAATITGVGVGLGLSCSSKLTNRFSSSAGSSRCSVKMSVSVEEQRKNFTLKKSEEAFNVA 60
           M+AT+TG G  LG SCSSK++ R SSS  S+RCS+KMSVSV+E++K+FTL+KSEEAFN A
Sbjct: 1   MSATLTGSGTALGFSCSSKISKRVSSSP-STRCSIKMSVSVDEKKKSFTLQKSEEAFNAA 59

Query: 61  KELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQV 120
           K LMPGGVNSPVRAFKSVGGQP++ DSVKGS MWDIDGNEYIDYVGSWGPAIIGHADD+V
Sbjct: 60  KNLMPGGVNSPVRAFKSVGGQPVLIDSVKGSKMWDIDGNEYIDYVGSWGPAIIGHADDEV 119

Query: 121 LAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTG 180
           LAAL ETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFT 
Sbjct: 120 LAALAETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTN 179

Query: 181 RERIIKFEGCYHGHADPFLVKAGSGVATLGLPDSPGVPKGATYETLTAPFNDVSALENLF 240
           +E+ IKFEGCYHGHA+ FLVKAGSGVATLGLPDSPGVPK AT +TLTAP+ND+ A+  LF
Sbjct: 180 KEKFIKFEGCYHGHANAFLVKAGSGVATLGLPDSPGVPKAATSDTLTAPYNDIEAVAKLF 239

Query: 241 ENNKGEIAAIILEPVVGNSGFIAPKPDFLNAIRRITKENGALLIFDEVMTGFRLAYGGAQ 300
           E +KGEI+A+ILEPVVGNSGFI P P+F+N +R++TK+NGALLIFDEVMTGFRLAYGGAQ
Sbjct: 240 EAHKGEISAVILEPVVGNSGFITPTPEFINGLRQLTKDNGALLIFDEVMTGFRLAYGGAQ 299

Query: 301 EYFGVTPDLTTLGKIIGGGLPVGAYGGRRDIMEMVAPAGPMYQAGTLSGNPLAMTAGIHT 360
           EYFG+TPDLTTLGKIIGGGLPVGAYGGRRDIMEMVAPAGPMYQAGTLSGNPLAMTAGIHT
Sbjct: 300 EYFGITPDLTTLGKIIGGGLPVGAYGGRRDIMEMVAPAGPMYQAGTLSGNPLAMTAGIHT 359

Query: 361 LKRLKEPGTYEYLNKITGELTQGIIDAGKKAGHAICGGYISGMFGFFFTEGPVYNFEDAK 420
           LKRLK+PGTYEYL+KIT ELT GI++AGKK GH +CGGYISGMFGFFF EGPVYNF DAK
Sbjct: 360 LKRLKQPGTYEYLDKITKELTNGILEAGKKTGHPMCGGYISGMFGFFFAEGPVYNFADAK 419

Query: 421 KSETTKFARFYRGMLEEGVYFAPSQFEAGFTSLAHSSDDIQHTITAAEKVKMR 473
           KS+T KF +F+RGMLEEGVYFAPSQFEAGFTSLAH+S+DIQ TI+AAE+V  R
Sbjct: 420 KSDTEKFGKFFRGMLEEGVYFAPSQFEAGFTSLAHTSEDIQFTISAAERVLGR 472

Brassica napus (taxid: 3708)
EC: 5EC: .EC: 4EC: .EC: 3EC: .EC: 8
>sp|Q42522|GSA2_ARATH Glutamate-1-semialdehyde 2,1-aminomutase 2, chloroplastic OS=Arabidopsis thaliana GN=GSA2 PE=2 SV=2 Back     alignment and function description
>sp|P42799|GSA1_ARATH Glutamate-1-semialdehyde 2,1-aminomutase 1, chloroplastic OS=Arabidopsis thaliana GN=GSA1 PE=1 SV=1 Back     alignment and function description
>sp|P31593|GSA_TOBAC Glutamate-1-semialdehyde 2,1-aminomutase, chloroplastic OS=Nicotiana tabacum GN=GSA PE=2 SV=1 Back     alignment and function description
>sp|Q40147|GSA_SOLLC Glutamate-1-semialdehyde 2,1-aminomutase, chloroplastic OS=Solanum lycopersicum PE=2 SV=1 Back     alignment and function description
>sp|P45621|GSA_SOYBN Glutamate-1-semialdehyde 2,1-aminomutase, chloroplastic OS=Glycine max GN=GSA1 PE=2 SV=1 Back     alignment and function description
>sp|Q6YZE2|GSA_ORYSJ Glutamate-1-semialdehyde 2,1-aminomutase, chloroplastic OS=Oryza sativa subsp. japonica GN=GSA PE=2 SV=1 Back     alignment and function description
>sp|P18492|GSA_HORVU Glutamate-1-semialdehyde 2,1-aminomutase, chloroplastic OS=Hordeum vulgare GN=GSA PE=1 SV=3 Back     alignment and function description
>sp|B2J7M9|GSA_NOSP7 Glutamate-1-semialdehyde 2,1-aminomutase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=hemL PE=3 SV=1 Back     alignment and function description
>sp|B1X023|GSA_CYAA5 Glutamate-1-semialdehyde 2,1-aminomutase OS=Cyanothece sp. (strain ATCC 51142) GN=hemL PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query476
224134068479 predicted protein [Populus trichocarpa] 0.987 0.981 0.861 0.0
255571784473 glutamate-1-semialdehyde 2,1-aminomutase 0.947 0.953 0.881 0.0
449438260471 PREDICTED: glutamate-1-semialdehyde 2,1- 0.978 0.989 0.859 0.0
307136451471 glutamate-1-semialdehyde 21-aminomutase 0.978 0.989 0.853 0.0
75149864473 RecName: Full=Glutamate-1-semialdehyde 2 0.991 0.997 0.832 0.0
15229018472 glutamate-1-semialdehyde 2,1-aminomutase 0.991 1.0 0.839 0.0
28972463473 glutamate 1-semialdehyde aminotransferas 0.991 0.997 0.826 0.0
15242822474 glutamate-1-semialdehyde-2,1-aminomutase 0.993 0.997 0.822 0.0
498914472 glutamate-1-semialdehyde aminotransferas 0.991 1.0 0.835 0.0
225456404473 PREDICTED: glutamate-1-semialdehyde 2,1- 0.915 0.921 0.885 0.0
>gi|224134068|ref|XP_002321728.1| predicted protein [Populus trichocarpa] gi|222868724|gb|EEF05855.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  842 bits (2174), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 409/475 (86%), Positives = 444/475 (93%), Gaps = 5/475 (1%)

Query: 1   MAATITGVGVGLGLSCSS--KLTN-RFSSSAGSSRCSVKMSVSVEEQRK--NFTLKKSEE 55
           MA+TITGV VGLGLSCS+  KLT  R  SS+  S CS+KM+VSVEE++K  +FTL+KSEE
Sbjct: 1   MASTITGVSVGLGLSCSTTRKLTQKRNPSSSRLSFCSIKMAVSVEEEKKKKSFTLEKSEE 60

Query: 56  AFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGH 115
           AF+ AKE+MPGGVNSPVRAFKSVGGQPIVFDSVKGSHM DIDGN+YIDYVGSWGPAIIGH
Sbjct: 61  AFSAAKEMMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMRDIDGNDYIDYVGSWGPAIIGH 120

Query: 116 ADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLA 175
           ADD+VLAAL ETMKKGTSFGAPCLLENVLAEMVI AVPSIEMVRFVNSGTEACMGVLRLA
Sbjct: 121 ADDEVLAALSETMKKGTSFGAPCLLENVLAEMVIKAVPSIEMVRFVNSGTEACMGVLRLA 180

Query: 176 RAFTGRERIIKFEGCYHGHADPFLVKAGSGVATLGLPDSPGVPKGATYETLTAPFNDVSA 235
           RA+TGRE+IIKFEGCYHGHADPFLVKAGSGVATLGLPDSPGVPK ATYETLTAP+ND++A
Sbjct: 181 RAYTGREKIIKFEGCYHGHADPFLVKAGSGVATLGLPDSPGVPKAATYETLTAPYNDIAA 240

Query: 236 LENLFENNKGEIAAIILEPVVGNSGFIAPKPDFLNAIRRITKENGALLIFDEVMTGFRLA 295
           +ENLFENNKGEI  IILEPVVGN+GFI PKP+F+NAIRRIT+EN ALLIFDEVMTGFRL+
Sbjct: 241 VENLFENNKGEICGIILEPVVGNAGFIPPKPEFINAIRRITEENNALLIFDEVMTGFRLS 300

Query: 296 YGGAQEYFGVTPDLTTLGKIIGGGLPVGAYGGRRDIMEMVAPAGPMYQAGTLSGNPLAMT 355
           YGGAQEYFG+TPDLTTLGKIIGGGLPVGAYGGRR+IMEMVAPAGPMYQAGTLSGNPLAMT
Sbjct: 301 YGGAQEYFGITPDLTTLGKIIGGGLPVGAYGGRREIMEMVAPAGPMYQAGTLSGNPLAMT 360

Query: 356 AGIHTLKRLKEPGTYEYLNKITGELTQGIIDAGKKAGHAICGGYISGMFGFFFTEGPVYN 415
           AGIHTLKRL++PG+YEYL+KIT EL QGIIDAGKK GHAICGGYI GMFGFFFTEGPVYN
Sbjct: 361 AGIHTLKRLQKPGSYEYLDKITSELVQGIIDAGKKTGHAICGGYIRGMFGFFFTEGPVYN 420

Query: 416 FEDAKKSETTKFARFYRGMLEEGVYFAPSQFEAGFTSLAHSSDDIQHTITAAEKV 470
           F DAKKS+T KFARFY+GML EGVYFAPSQFEAGFTSLAH+++DIQ TI AAE V
Sbjct: 421 FADAKKSDTAKFARFYQGMLREGVYFAPSQFEAGFTSLAHTAEDIQKTIAAAENV 475

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255571784|ref|XP_002526835.1| glutamate-1-semialdehyde 2,1-aminomutase, putative [Ricinus communis] gi|223533839|gb|EEF35570.1| glutamate-1-semialdehyde 2,1-aminomutase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449438260|ref|XP_004136907.1| PREDICTED: glutamate-1-semialdehyde 2,1-aminomutase, chloroplastic-like [Cucumis sativus] gi|449527822|ref|XP_004170908.1| PREDICTED: glutamate-1-semialdehyde 2,1-aminomutase, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|307136451|gb|ADN34256.1| glutamate-1-semialdehyde 21-aminomutase [Cucumis melo subsp. melo] Back     alignment and taxonomy information
>gi|75149864|sp|Q85WB7.1|GSA_BRANA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase, chloroplastic; Short=GSA; AltName: Full=Glutamate-1-semialdehyde aminotransferase; Short=GSA-AT; Flags: Precursor gi|28972461|gb|AAO63782.1|AF364595_1 glutamate 1-semialdehyde aminotransferase enzyme [Brassica napus] Back     alignment and taxonomy information
>gi|15229018|ref|NP_190442.1| glutamate-1-semialdehyde 2,1-aminomutase 2 [Arabidopsis thaliana] gi|14195661|sp|Q42522.2|GSA2_ARATH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase 2, chloroplastic; Short=GSA 2; AltName: Full=Glutamate-1-semialdehyde aminotransferase 2; Short=GSA-AT 2; Flags: Precursor gi|6523104|emb|CAB62362.1| glutamate-1-semialdehyde aminotransferase [Arabidopsis thaliana] gi|95147290|gb|ABF57280.1| At3g48730 [Arabidopsis thaliana] gi|110738531|dbj|BAF01191.1| glutamate-1-semialdehyde aminotransferase [Arabidopsis thaliana] gi|332644929|gb|AEE78450.1| glutamate-1-semialdehyde 2,1-aminomutase 2 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|28972463|gb|AAO63783.1|AF366293_1 glutamate 1-semialdehyde aminotransferase [Brassica napus] Back     alignment and taxonomy information
>gi|15242822|ref|NP_201162.1| glutamate-1-semialdehyde-2,1-aminomutase [Arabidopsis thaliana] gi|1170028|sp|P42799.1|GSA1_ARATH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase 1, chloroplastic; Short=GSA 1; AltName: Full=Glutamate-1-semialdehyde aminotransferase 1; Short=GSA-AT 1; Flags: Precursor gi|454357|gb|AAA19117.1| glutamate-1-semialdehyde-2,1-aminomutase [Arabidopsis thaliana] gi|10177038|dbj|BAB10450.1| glutamate-1-semialdehyde 2,1-aminomutase 1 precursor (GSA 1) (glutamate-1-semialdehyde aminotransferase 1) (GSA-AT 1) [Arabidopsis thaliana] gi|20856673|gb|AAM26679.1| AT5g63570/MBK5_3 [Arabidopsis thaliana] gi|22655038|gb|AAM98110.1| At5g63570/MBK5_3 [Arabidopsis thaliana] gi|332010387|gb|AED97770.1| glutamate-1-semialdehyde-2,1-aminomutase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|498914|gb|AAA79123.1| glutamate-1-semialdehyde aminotransferase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|225456404|ref|XP_002284200.1| PREDICTED: glutamate-1-semialdehyde 2,1-aminomutase, chloroplastic [Vitis vinifera] gi|147861754|emb|CAN83169.1| hypothetical protein VITISV_021914 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query476
TAIR|locus:2114520472 GSA2 "glutamate-1-semialdehyde 0.989 0.997 0.797 4.4e-203
TAIR|locus:2160554474 GSA1 ""glutamate-1-semialdehyd 0.993 0.997 0.775 9.4e-201
TIGR_CMR|CHY_1212432 CHY_1212 "glutamate-1-semialde 0.882 0.972 0.569 2.1e-125
TIGR_CMR|GSU_0337427 GSU_0337 "glutamate-1-semialde 0.873 0.974 0.552 2e-120
TIGR_CMR|BA_4693429 BA_4693 "glutamate-1-semialdeh 0.869 0.965 0.563 8.5e-120
UNIPROTKB|P23893426 hemL "glutamate-1-semialdehyde 0.884 0.988 0.518 1.3e-118
TIGR_CMR|SO_1300430 SO_1300 "glutamate-1-semialdeh 0.890 0.986 0.515 5e-115
UNIPROTKB|Q9KU97432 hemL "Glutamate-1-semialdehyde 0.882 0.972 0.515 7.6e-112
TIGR_CMR|VC_0626432 VC_0626 "glutamate-1-semialdeh 0.882 0.972 0.515 7.6e-112
TIGR_CMR|CPS_4629427 CPS_4629 "glutamate-1-semialde 0.882 0.983 0.481 2.6e-109
TAIR|locus:2114520 GSA2 "glutamate-1-semialdehyde 2,1-aminomutase 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1965 (696.8 bits), Expect = 4.4e-203, P = 4.4e-203
 Identities = 377/473 (79%), Positives = 410/473 (86%)

Query:     1 MAATITXXXXXXXXSCSSKLTNRFXXXXXXXXXXVKMSVSVEEQRKNFTLKKSEEAFNVA 60
             MAAT+T        SCS+K + R           +KMSVSVEE+ K FTL+KSEEAFN A
Sbjct:     1 MAATLTGSGIALGFSCSAKFSKR--ASSSSNRRCIKMSVSVEEKTKKFTLQKSEEAFNAA 58

Query:    61 KELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQV 120
             K LMPGGVNSPVRAFKSVGGQP+V DS KGS + DIDGNEYIDYVGSWGPAIIGHADD+V
Sbjct:    59 KNLMPGGVNSPVRAFKSVGGQPVVMDSAKGSRIRDIDGNEYIDYVGSWGPAIIGHADDEV 118

Query:   121 LAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTG 180
             LAAL ETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTG
Sbjct:   119 LAALAETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTG 178

Query:   181 RERIIKFEGCYHGHADPFLVKAGSGVATLGLPDSPGVPKGATYETLTAPFNDVSALENLF 240
             +++ IKFEGCYHGHA+ FLVKAGSGVATLGLPDSPGVPK AT +TLTAP+ND++A+E LF
Sbjct:   179 KQKFIKFEGCYHGHANSFLVKAGSGVATLGLPDSPGVPKAATSDTLTAPYNDIAAVEKLF 238

Query:   241 ENNKGEIAAIILEPVVGNSGFIAPKPDFLNAIRRITKENGALLIFDEVMTGFRLAYGGAQ 300
             E NKGEIAAIILEPVVGNSGFI PKP+F+  IRRITK+NGALLIFDEVMTGFRLAYGGAQ
Sbjct:   239 EANKGEIAAIILEPVVGNSGFITPKPEFIEGIRRITKDNGALLIFDEVMTGFRLAYGGAQ 298

Query:   301 EYFGVTPDXXXXXXXXXXXXPVGAYGGRRDIMEMVAPAGPMYQAGTLSGNPLAMTAGIHT 360
             EYFG+TPD            PVGAYGGRRDIMEMVAPAGPMYQAGTLSGNPLAMTAGIHT
Sbjct:   299 EYFGITPDLTTLGKIIGGGLPVGAYGGRRDIMEMVAPAGPMYQAGTLSGNPLAMTAGIHT 358

Query:   361 LKRLKEPGTYEYLNKITGELTQGIIDAGKKAGHAICGGYISGMFGFFFTEGPVYNFEDAK 420
             LKRL +PGTYEYL+KIT ELT GI++AGKK GHA+CGGYISGMFGFFFTEGPVY+F DAK
Sbjct:   359 LKRLSQPGTYEYLDKITKELTNGILEAGKKTGHAMCGGYISGMFGFFFTEGPVYDFSDAK 418

Query:   421 KSETTKFARFYRGMLEEGVYFAPSQFEAGFTSLAHSSDDIQHTITAAEKVKMR 473
             KS+T KF +F+RGMLEEGVY APSQFEAGFTSLAH+S+DIQ TI AAEKV  R
Sbjct:   419 KSDTEKFGKFFRGMLEEGVYLAPSQFEAGFTSLAHTSEDIQFTIAAAEKVLSR 471
GO:0003824 "catalytic activity" evidence=IEA
GO:0008483 "transaminase activity" evidence=IEA
GO:0009507 "chloroplast" evidence=ISS;IDA
GO:0030170 "pyridoxal phosphate binding" evidence=IEA
GO:0033014 "tetrapyrrole biosynthetic process" evidence=IEA
GO:0042286 "glutamate-1-semialdehyde 2,1-aminomutase activity" evidence=IEA;ISS
GO:0009941 "chloroplast envelope" evidence=IDA
GO:0009570 "chloroplast stroma" evidence=IDA
GO:0006098 "pentose-phosphate shunt" evidence=RCA
GO:0006364 "rRNA processing" evidence=RCA
GO:0009073 "aromatic amino acid family biosynthetic process" evidence=RCA
GO:0009965 "leaf morphogenesis" evidence=RCA
GO:0015995 "chlorophyll biosynthetic process" evidence=RCA
GO:0019344 "cysteine biosynthetic process" evidence=RCA
GO:0030154 "cell differentiation" evidence=RCA
GO:0045036 "protein targeting to chloroplast" evidence=RCA
GO:0045893 "positive regulation of transcription, DNA-dependent" evidence=RCA
GO:0006779 "porphyrin-containing compound biosynthetic process" evidence=TAS
TAIR|locus:2160554 GSA1 ""glutamate-1-semialdehyde-2,1-aminomutase"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TIGR_CMR|CHY_1212 CHY_1212 "glutamate-1-semialdehyde-2,1-aminomutase" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_0337 GSU_0337 "glutamate-1-semialdehyde-2,1-aminomutase" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TIGR_CMR|BA_4693 BA_4693 "glutamate-1-semialdehyde-2,1-aminomutase" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
UNIPROTKB|P23893 hemL "glutamate-1-semialdehyde aminotransferase" [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
TIGR_CMR|SO_1300 SO_1300 "glutamate-1-semialdehyde-2,1-aminomutase" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
UNIPROTKB|Q9KU97 hemL "Glutamate-1-semialdehyde 2,1-aminomutase" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms
TIGR_CMR|VC_0626 VC_0626 "glutamate-1-semialdehyde 2,1-aminomutase" [Vibrio cholerae O1 biovar El Tor (taxid:686)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_4629 CPS_4629 "glutamate-1-semialdehyde-2,1-aminomutase" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
B7KA18GSA_CYAP75, ., 4, ., 3, ., 80.72400.89070.9792yesno
B8HYK1GSA_CYAP45, ., 4, ., 3, ., 80.72870.89070.9814yesno
Q2JMP7GSA_SYNJB5, ., 4, ., 3, ., 80.70280.89070.9724yesno
A2C0U2GSA_PROM15, ., 4, ., 3, ., 80.70710.88230.9813yesno
A2BVE5GSA_PROM55, ., 4, ., 3, ., 80.68000.88650.9745yesno
Q55665GSA_SYNY35, ., 4, ., 3, ., 80.71630.88860.9769N/Ano
A5GUJ2GSA_SYNR35, ., 4, ., 3, ., 80.70360.87180.9562yesno
P18492GSA_HORVU5, ., 4, ., 3, ., 80.80440.93900.9530N/Ano
P45621GSA_SOYBN5, ., 4, ., 3, ., 80.82590.95160.9721yesno
A3PBK8GSA_PROM05, ., 4, ., 3, ., 80.68790.88440.9722yesno
A5GMT2GSA_SYNPW5, ., 4, ., 3, ., 80.70360.87180.9584yesno
Q46GT9GSA_PROMT5, ., 4, ., 3, ., 80.70950.88230.9722yesno
Q7VDA1GSA_PROMA5, ., 4, ., 3, ., 80.69680.88020.9676yesno
Q7V677GSA_PROMM5, ., 4, ., 3, ., 80.69390.87180.9696yesno
Q39566GSA_CHLRE5, ., 4, ., 3, ., 80.68690.89910.9244N/Ano
A9BEA5GSA_PROM45, ., 4, ., 3, ., 80.69350.88440.9745yesno
Q3AWP4GSA_SYNS95, ., 4, ., 3, ., 80.70840.87180.9696yesno
Q7U598GSA_SYNPX5, ., 4, ., 3, ., 80.70600.87180.9696yesno
B1XIT5GSA_SYNP25, ., 4, ., 3, ., 80.74460.88020.9699yesno
Q0I8G1GSA_SYNS35, ., 4, ., 3, ., 80.70710.88230.9589yesno
Q40147GSA_SOLLC5, ., 4, ., 3, ., 80.81350.96630.9563N/Ano
Q39QA6GSA_GEOMG5, ., 4, ., 3, ., 80.58550.87180.9718yesno
P31593GSA_TOBAC5, ., 4, ., 3, ., 80.82940.96630.9623N/Ano
B1X023GSA_CYAA55, ., 4, ., 3, ., 80.73980.88020.9676yesno
B7K2I1GSA_CYAP85, ., 4, ., 3, ., 80.73340.89070.9792yesno
A9B550GSA_HERA25, ., 4, ., 3, ., 80.61050.87390.9696yesno
Q3M3B9GSA_ANAVT5, ., 4, ., 3, ., 80.73000.89070.9814yesno
Q3ACS9GSA_CARHZ5, ., 4, ., 3, ., 80.59240.88650.9768yesno
C0ZAH4GSA2_BREBN5, ., 4, ., 3, ., 80.58030.87600.9720yesno
B2J7M9GSA_NOSP75, ., 4, ., 3, ., 80.73940.89070.9814yesno
A2BPW6GSA_PROMS5, ., 4, ., 3, ., 80.68320.88440.9722yesno
B0CC57GSA_ACAM15, ., 4, ., 3, ., 80.72790.88020.9699yesno
P24630GSA_SYNP65, ., 4, ., 3, ., 80.73280.88860.9769yesno
Q110Z9GSA_TRIEI5, ., 4, ., 3, ., 80.73030.88020.9699yesno
Q6YZE2GSA_ORYSJ5, ., 4, ., 3, ., 80.80840.94320.9393yesno
A8G3J9GSA_PROM25, ., 4, ., 3, ., 80.69450.88020.9676yesno
Q3ALU9GSA_SYNSC5, ., 4, ., 3, ., 80.71010.86970.9672yesno
Q8DLK8GSA_THEEB5, ., 4, ., 3, ., 80.73260.88020.9588yesno
Q7V2J3GSA_PROMP5, ., 4, ., 3, ., 80.69540.87600.9630yesno
A2C7I7GSA_PROM35, ., 4, ., 3, ., 80.69390.87180.9696yesno
Q31QJ2GSA_SYNE75, ., 4, ., 3, ., 80.73520.88860.9769yesno
Q42522GSA2_ARATH5, ., 4, ., 3, ., 80.83960.99151.0yesno
P42799GSA1_ARATH5, ., 4, ., 3, ., 80.82240.99360.9978nono
Q2RJ31GSA_MOOTA5, ., 4, ., 3, ., 80.58470.87810.9565yesno
Q31C50GSA_PROM95, ., 4, ., 3, ., 80.69970.86760.9516yesno
Q7NPI4GSA_GLOVI5, ., 4, ., 3, ., 80.64060.88860.9791yesno
Q85WB7GSA_BRANA5, ., 4, ., 3, ., 80.83290.99150.9978N/Ano
Q8YS26GSA_NOSS15, ., 4, ., 3, ., 80.73000.89070.9814yesno
Q2JS70GSA_SYNJA5, ., 4, ., 3, ., 80.70110.89280.9747yesno
B0JPW6GSA_MICAN5, ., 4, ., 3, ., 80.72400.89070.9792yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer5.4.30.691
3rd Layer5.4.3.80.994

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query476
PLN02482474 PLN02482, PLN02482, glutamate-1-semialdehyde 2,1-a 0.0
PRK00062426 PRK00062, PRK00062, glutamate-1-semialdehyde amino 0.0
COG0001432 COG0001, HemL, Glutamate-1-semialdehyde aminotrans 0.0
TIGR00713423 TIGR00713, hemL, glutamate-1-semialdehyde-2,1-amin 0.0
PRK12389428 PRK12389, PRK12389, glutamate-1-semialdehyde amino 0.0
cd00610413 cd00610, OAT_like, Acetyl ornithine aminotransfera 1e-125
PRK00615433 PRK00615, PRK00615, glutamate-1-semialdehyde amino 1e-108
PRK06209431 PRK06209, PRK06209, glutamate-1-semialdehyde 2,1-a 8e-71
pfam00202338 pfam00202, Aminotran_3, Aminotransferase class-III 7e-69
COG4992404 COG4992, ArgD, Ornithine/acetylornithine aminotran 1e-63
COG0160447 COG0160, GabT, 4-aminobutyrate aminotransferase an 7e-61
TIGR00707379 TIGR00707, argD, transaminase, acetylornithine/suc 1e-52
PRK02627396 PRK02627, PRK02627, acetylornithine aminotransfera 1e-49
PRK08117433 PRK08117, PRK08117, 4-aminobutyrate aminotransfera 1e-48
PRK07046453 PRK07046, PRK07046, aminotransferase; Validated 3e-48
PRK08360443 PRK08360, PRK08360, 4-aminobutyrate aminotransfera 5e-46
PRK05769441 PRK05769, PRK05769, 4-aminobutyrate aminotransfera 6e-46
PRK02936377 PRK02936, argD, acetylornithine aminotransferase; 1e-45
PTZ00125400 PTZ00125, PTZ00125, ornithine aminotransferase-lik 3e-43
PRK03244398 PRK03244, argD, acetylornithine aminotransferase; 4e-43
PRK07495425 PRK07495, PRK07495, 4-aminobutyrate aminotransfera 5e-41
COG0161449 COG0161, BioA, Adenosylmethionine-8-amino-7-oxonon 6e-41
PRK08088425 PRK08088, PRK08088, 4-aminobutyrate aminotransfera 8e-41
PRK03715395 PRK03715, argD, acetylornithine transaminase prote 1e-40
PRK08593445 PRK08593, PRK08593, 4-aminobutyrate aminotransfera 1e-39
PRK06777421 PRK06777, PRK06777, 4-aminobutyrate aminotransfera 3e-39
PRK01278389 PRK01278, argD, acetylornithine transaminase prote 6e-39
PLN02624474 PLN02624, PLN02624, ornithine-delta-aminotransfera 2e-37
TIGR00508417 TIGR00508, bioA, adenosylmethionine-8-amino-7-oxon 5e-37
PRK12381406 PRK12381, PRK12381, bifunctional succinylornithine 1e-36
TIGR00700420 TIGR00700, GABAtrnsam, 4-aminobutyrate aminotransf 2e-36
PRK11522459 PRK11522, PRK11522, putrescine--2-oxoglutarate ami 2e-36
PRK04013364 PRK04013, argD, acetylornithine/acetyl-lysine amin 2e-35
PRK05093403 PRK05093, argD, bifunctional N-succinyldiaminopime 5e-35
TIGR01885401 TIGR01885, Orn_aminotrans, ornithine aminotransfer 1e-34
TIGR03246397 TIGR03246, arg_catab_astC, succinylornithine trans 2e-34
PRK06918451 PRK06918, PRK06918, 4-aminobutyrate aminotransfera 5e-34
TIGR00709442 TIGR00709, dat, 2,4-diaminobutyrate 4-transaminase 2e-33
PRK09792421 PRK09792, PRK09792, 4-aminobutyrate transaminase; 4e-33
PLN00144382 PLN00144, PLN00144, acetylornithine transaminase 4e-32
PRK04260375 PRK04260, PRK04260, acetylornithine aminotransfera 7e-32
TIGR03372442 TIGR03372, putres_am_tran, putrescine aminotransfe 7e-32
PRK06062451 PRK06062, PRK06062, hypothetical protein; Provisio 1e-31
PRK09221445 PRK09221, PRK09221, beta alanine--pyruvate transam 8e-31
PRK06931459 PRK06931, PRK06931, diaminobutyrate--2-oxoglutarat 3e-30
PRK06058443 PRK06058, PRK06058, 4-aminobutyrate aminotransfera 8e-30
PRK06938464 PRK06938, PRK06938, diaminobutyrate--2-oxoglutarat 2e-28
PRK04612408 PRK04612, argD, acetylornithine transaminase prote 3e-28
PRK05964423 PRK05964, PRK05964, adenosylmethionine--8-amino-7- 3e-27
PRK13360442 PRK13360, PRK13360, omega amino acid--pyruvate tra 9e-26
PRK07483443 PRK07483, PRK07483, hypothetical protein; Provisio 1e-23
PRK04073396 PRK04073, rocD, ornithine--oxo-acid transaminase; 1e-23
PRK06917447 PRK06917, PRK06917, hypothetical protein; Provisio 4e-22
TIGR02407412 TIGR02407, ectoine_ectB, diaminobutyrate--2-oxoglu 1e-21
PRK05639457 PRK05639, PRK05639, 4-aminobutyrate aminotransfera 9e-21
PRK00854401 PRK00854, rocD, ornithine--oxo-acid transaminase; 1e-20
PLN02760504 PLN02760, PLN02760, 4-aminobutyrate:pyruvate trans 1e-20
PRK061481013 PRK06148, PRK06148, hypothetical protein; Provisio 3e-20
PRK06173429 PRK06173, PRK06173, adenosylmethionine--8-amino-7- 4e-20
PRK06916460 PRK06916, PRK06916, adenosylmethionine--8-amino-7- 4e-20
PRK08742472 PRK08742, PRK08742, adenosylmethionine--8-amino-7- 1e-19
PRK07678451 PRK07678, PRK07678, aminotransferase; Validated 4e-19
PRK06149972 PRK06149, PRK06149, hypothetical protein; Provisio 1e-18
PRK07481449 PRK07481, PRK07481, hypothetical protein; Provisio 2e-18
PRK07036466 PRK07036, PRK07036, hypothetical protein; Provisio 4e-18
PRK06082459 PRK06082, PRK06082, 4-aminobutyrate aminotransfera 6e-18
PRK12403460 PRK12403, PRK12403, putative aminotransferase; Pro 7e-18
PRK07986428 PRK07986, PRK07986, adenosylmethionine--8-amino-7- 1e-17
PRK07480456 PRK07480, PRK07480, putative aminotransferase; Val 3e-17
PRK06541460 PRK06541, PRK06541, hypothetical protein; Provisio 1e-15
PRK07030466 PRK07030, PRK07030, adenosylmethionine--8-amino-7- 1e-15
PRK06943453 PRK06943, PRK06943, adenosylmethionine--8-amino-7- 1e-14
PRK09264425 PRK09264, PRK09264, diaminobutyrate--2-oxoglutarat 3e-14
PRK05630422 PRK05630, PRK05630, adenosylmethionine--8-amino-7- 7e-14
PRK05965459 PRK05965, PRK05965, hypothetical protein; Provisio 8e-14
PRK06105460 PRK06105, PRK06105, aminotransferase; Provisional 2e-13
PRK08297443 PRK08297, PRK08297, L-lysine aminotransferase; Pro 1e-11
PRK07482461 PRK07482, PRK07482, hypothetical protein; Provisio 1e-11
TIGR03251431 TIGR03251, LAT_fam, L-lysine 6-transaminase 3e-11
PLN02974817 PLN02974, PLN02974, adenosylmethionine-8-amino-7-o 1e-09
cd06454349 cd06454, KBL_like, KBL_like; this family belongs t 9e-07
COG0156388 COG0156, BioF, 7-keto-8-aminopelargonate synthetas 1e-06
cd01494170 cd01494, AAT_I, Aspartate aminotransferase (AAT) s 4e-06
TIGR00699464 TIGR00699, GABAtrns_euk, 4-aminobutyrate aminotran 5e-06
PRK06939397 PRK06939, PRK06939, 2-amino-3-ketobutyrate coenzym 9e-06
TIGR01822393 TIGR01822, 2am3keto_CoA, 2-amino-3-ketobutyrate co 1e-05
TIGR00858360 TIGR00858, bioF, 8-amino-7-oxononanoate synthase 9e-05
pfam00155357 pfam00155, Aminotran_1_2, Aminotransferase class I 2e-04
PRK09264425 PRK09264, PRK09264, diaminobutyrate--2-oxoglutarat 3e-04
>gnl|CDD|178100 PLN02482, PLN02482, glutamate-1-semialdehyde 2,1-aminomutase Back     alignment and domain information 
 Score =  916 bits (2368), Expect = 0.0
 Identities = 384/473 (81%), Positives = 421/473 (89%), Gaps = 6/473 (1%)

Query: 1   MAATITGVGVGLGLSCSSKLTNRFSSS---AGSSRCSVKMSVSVEEQRKNFTLKKSEEAF 57
           MAA + G  +GL  SCS+K + R SSS          +KM+VSVEE+ K FT  KSEE F
Sbjct: 1   MAAALAGSALGL--SCSAKPSARRSSSQRRRAVRSSVIKMAVSVEEK-KKFTTTKSEEIF 57

Query: 58  NVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHAD 117
             AKELMPGGVNSPVRAFKSVGGQPIVFD VKGS+ WD+DGNEYIDYVGSWGPAIIGHAD
Sbjct: 58  KAAKELMPGGVNSPVRAFKSVGGQPIVFDRVKGSYAWDVDGNEYIDYVGSWGPAIIGHAD 117

Query: 118 DQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARA 177
           D+VLAAL ETMKKGTSFGAPCLLENVLAEMVI AVPS+EMVRFVNSGTEACMGVLRLARA
Sbjct: 118 DEVLAALAETMKKGTSFGAPCLLENVLAEMVIDAVPSVEMVRFVNSGTEACMGVLRLARA 177

Query: 178 FTGRERIIKFEGCYHGHADPFLVKAGSGVATLGLPDSPGVPKGATYETLTAPFNDVSALE 237
           +TGRE+IIKFEGCYHGHAD FLVKAGSGVATLGLPDSPGVPK AT  TLTAP+ND+ A++
Sbjct: 178 YTGREKIIKFEGCYHGHADSFLVKAGSGVATLGLPDSPGVPKAATSATLTAPYNDLEAVK 237

Query: 238 NLFENNKGEIAAIILEPVVGNSGFIAPKPDFLNAIRRITKENGALLIFDEVMTGFRLAYG 297
            LFE NKGEIAA+ILEPVVGNSGFI PK +FL  +R ITKENGALL+FDEVMTGFR+AYG
Sbjct: 238 KLFEANKGEIAAVILEPVVGNSGFIVPKKEFLEGLREITKENGALLVFDEVMTGFRIAYG 297

Query: 298 GAQEYFGVTPDLTTLGKIIGGGLPVGAYGGRRDIMEMVAPAGPMYQAGTLSGNPLAMTAG 357
           GAQEYFG+TPDLTTLGK+IGGGLPVGAYGGRR+IMEMVAPAGPMYQAGTLSGNPLAMTAG
Sbjct: 298 GAQEYFGITPDLTTLGKVIGGGLPVGAYGGRREIMEMVAPAGPMYQAGTLSGNPLAMTAG 357

Query: 358 IHTLKRLKEPGTYEYLNKITGELTQGIIDAGKKAGHAICGGYISGMFGFFFTEGPVYNFE 417
           IHTLKRL++PGTYEYL+KIT +L QGI++AGKKAGH +CGGYISGMFGFFFTEGPVYNF 
Sbjct: 358 IHTLKRLQQPGTYEYLDKITKKLIQGILEAGKKAGHEMCGGYISGMFGFFFTEGPVYNFA 417

Query: 418 DAKKSETTKFARFYRGMLEEGVYFAPSQFEAGFTSLAHSSDDIQHTITAAEKV 470
           DAKKS+T KFARF+RGMLEEGVY APSQFEAGFTSLAH+ +DI  TI AAE+V
Sbjct: 418 DAKKSDTAKFARFHRGMLEEGVYLAPSQFEAGFTSLAHTEEDIDFTIAAAERV 470

Length = 474
>gnl|CDD|234607 PRK00062, PRK00062, glutamate-1-semialdehyde aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|223080 COG0001, HemL, Glutamate-1-semialdehyde aminotransferase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|233100 TIGR00713, hemL, glutamate-1-semialdehyde-2,1-aminomutase Back     alignment and domain information
>gnl|CDD|183493 PRK12389, PRK12389, glutamate-1-semialdehyde aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|99735 cd00610, OAT_like, Acetyl ornithine aminotransferase family Back     alignment and domain information
>gnl|CDD|234803 PRK00615, PRK00615, glutamate-1-semialdehyde aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|180471 PRK06209, PRK06209, glutamate-1-semialdehyde 2,1-aminomutase; Provisional Back     alignment and domain information
>gnl|CDD|201078 pfam00202, Aminotran_3, Aminotransferase class-III Back     alignment and domain information
>gnl|CDD|227325 COG4992, ArgD, Ornithine/acetylornithine aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|223238 COG0160, GabT, 4-aminobutyrate aminotransferase and related aminotransferases [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|233098 TIGR00707, argD, transaminase, acetylornithine/succinylornithine family Back     alignment and domain information
>gnl|CDD|235056 PRK02627, PRK02627, acetylornithine aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|181234 PRK08117, PRK08117, 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|235917 PRK07046, PRK07046, aminotransferase; Validated Back     alignment and domain information
>gnl|CDD|181401 PRK08360, PRK08360, 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|235599 PRK05769, PRK05769, 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|179505 PRK02936, argD, acetylornithine aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|240281 PTZ00125, PTZ00125, ornithine aminotransferase-like protein; Provisional Back     alignment and domain information
>gnl|CDD|235112 PRK03244, argD, acetylornithine aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|236032 PRK07495, PRK07495, 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|223239 COG0161, BioA, Adenosylmethionine-8-amino-7-oxononanoate aminotransferase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|236149 PRK08088, PRK08088, 4-aminobutyrate aminotransferase; Validated Back     alignment and domain information
>gnl|CDD|179636 PRK03715, argD, acetylornithine transaminase protein; Provisional Back     alignment and domain information
>gnl|CDD|181493 PRK08593, PRK08593, 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|180690 PRK06777, PRK06777, 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|179270 PRK01278, argD, acetylornithine transaminase protein; Provisional Back     alignment and domain information
>gnl|CDD|215335 PLN02624, PLN02624, ornithine-delta-aminotransferase Back     alignment and domain information
>gnl|CDD|233000 TIGR00508, bioA, adenosylmethionine-8-amino-7-oxononanoate transaminase Back     alignment and domain information
>gnl|CDD|183486 PRK12381, PRK12381, bifunctional succinylornithine transaminase/acetylornithine transaminase; Provisional Back     alignment and domain information
>gnl|CDD|129783 TIGR00700, GABAtrnsam, 4-aminobutyrate aminotransferase, prokaryotic type Back     alignment and domain information
>gnl|CDD|183175 PRK11522, PRK11522, putrescine--2-oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|101376 PRK04013, argD, acetylornithine/acetyl-lysine aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|179933 PRK05093, argD, bifunctional N-succinyldiaminopimelate- aminotransferase/acetylornithine transaminase protein; Reviewed Back     alignment and domain information
>gnl|CDD|130940 TIGR01885, Orn_aminotrans, ornithine aminotransferase Back     alignment and domain information
>gnl|CDD|132290 TIGR03246, arg_catab_astC, succinylornithine transaminase family Back     alignment and domain information
>gnl|CDD|235885 PRK06918, PRK06918, 4-aminobutyrate aminotransferase; Reviewed Back     alignment and domain information
>gnl|CDD|129792 TIGR00709, dat, 2,4-diaminobutyrate 4-transaminases Back     alignment and domain information
>gnl|CDD|182078 PRK09792, PRK09792, 4-aminobutyrate transaminase; Provisional Back     alignment and domain information
>gnl|CDD|177748 PLN00144, PLN00144, acetylornithine transaminase Back     alignment and domain information
>gnl|CDD|179803 PRK04260, PRK04260, acetylornithine aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|132415 TIGR03372, putres_am_tran, putrescine aminotransferase Back     alignment and domain information
>gnl|CDD|235687 PRK06062, PRK06062, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|181707 PRK09221, PRK09221, beta alanine--pyruvate transaminase; Provisional Back     alignment and domain information
>gnl|CDD|235889 PRK06931, PRK06931, diaminobutyrate--2-oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|235685 PRK06058, PRK06058, 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|235892 PRK06938, PRK06938, diaminobutyrate--2-oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|179868 PRK04612, argD, acetylornithine transaminase protein; Provisional Back     alignment and domain information
>gnl|CDD|235656 PRK05964, PRK05964, adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>gnl|CDD|183999 PRK13360, PRK13360, omega amino acid--pyruvate transaminase; Provisional Back     alignment and domain information
>gnl|CDD|236027 PRK07483, PRK07483, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|179736 PRK04073, rocD, ornithine--oxo-acid transaminase; Provisional Back     alignment and domain information
>gnl|CDD|235884 PRK06917, PRK06917, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|233853 TIGR02407, ectoine_ectB, diaminobutyrate--2-oxoglutarate aminotransferase Back     alignment and domain information
>gnl|CDD|168145 PRK05639, PRK05639, 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|234848 PRK00854, rocD, ornithine--oxo-acid transaminase; Reviewed Back     alignment and domain information
>gnl|CDD|215405 PLN02760, PLN02760, 4-aminobutyrate:pyruvate transaminase Back     alignment and domain information
>gnl|CDD|180426 PRK06148, PRK06148, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|180441 PRK06173, PRK06173, adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>gnl|CDD|180746 PRK06916, PRK06916, adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>gnl|CDD|236336 PRK08742, PRK08742, adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>gnl|CDD|181078 PRK07678, PRK07678, aminotransferase; Validated Back     alignment and domain information
>gnl|CDD|235716 PRK06149, PRK06149, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|168967 PRK07481, PRK07481, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|235913 PRK07036, PRK07036, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|180390 PRK06082, PRK06082, 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|171472 PRK12403, PRK12403, putative aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|181189 PRK07986, PRK07986, adenosylmethionine--8-amino-7-oxononanoate transaminase; Validated Back     alignment and domain information
>gnl|CDD|180994 PRK07480, PRK07480, putative aminotransferase; Validated Back     alignment and domain information
>gnl|CDD|235823 PRK06541, PRK06541, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|180800 PRK07030, PRK07030, adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>gnl|CDD|235894 PRK06943, PRK06943, adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>gnl|CDD|236437 PRK09264, PRK09264, diaminobutyrate--2-oxoglutarate aminotransferase; Validated Back     alignment and domain information
>gnl|CDD|180174 PRK05630, PRK05630, adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>gnl|CDD|180330 PRK05965, PRK05965, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|180401 PRK06105, PRK06105, aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|236224 PRK08297, PRK08297, L-lysine aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|236026 PRK07482, PRK07482, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|132295 TIGR03251, LAT_fam, L-lysine 6-transaminase Back     alignment and domain information
>gnl|CDD|215526 PLN02974, PLN02974, adenosylmethionine-8-amino-7-oxononanoate transaminase Back     alignment and domain information
>gnl|CDD|99747 cd06454, KBL_like, KBL_like; this family belongs to the pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I) Back     alignment and domain information
>gnl|CDD|223234 COG0156, BioF, 7-keto-8-aminopelargonate synthetase and related enzymes [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|99742 cd01494, AAT_I, Aspartate aminotransferase (AAT) superfamily (fold type I) of pyridoxal phosphate (PLP)-dependent enzymes Back     alignment and domain information
>gnl|CDD|129782 TIGR00699, GABAtrns_euk, 4-aminobutyrate aminotransferase, eukaryotic type Back     alignment and domain information
>gnl|CDD|235893 PRK06939, PRK06939, 2-amino-3-ketobutyrate coenzyme A ligase; Provisional Back     alignment and domain information
>gnl|CDD|130881 TIGR01822, 2am3keto_CoA, 2-amino-3-ketobutyrate coenzyme A ligase Back     alignment and domain information
>gnl|CDD|129937 TIGR00858, bioF, 8-amino-7-oxononanoate synthase Back     alignment and domain information
>gnl|CDD|215756 pfam00155, Aminotran_1_2, Aminotransferase class I and II Back     alignment and domain information
>gnl|CDD|236437 PRK09264, PRK09264, diaminobutyrate--2-oxoglutarate aminotransferase; Validated Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 476
COG0001432 HemL Glutamate-1-semialdehyde aminotransferase [Co 100.0
PLN02482474 glutamate-1-semialdehyde 2,1-aminomutase 100.0
COG4992404 ArgD Ornithine/acetylornithine aminotransferase [A 100.0
COG0160447 GabT 4-aminobutyrate aminotransferase and related 100.0
PRK12389428 glutamate-1-semialdehyde aminotransferase; Provisi 100.0
PRK00615433 glutamate-1-semialdehyde aminotransferase; Provisi 100.0
PRK07046453 aminotransferase; Validated 100.0
TIGR00713423 hemL glutamate-1-semialdehyde-2,1-aminomutase. Thi 100.0
KOG1404442 consensus Alanine-glyoxylate aminotransferase AGT2 100.0
PRK00062426 glutamate-1-semialdehyde aminotransferase; Provisi 100.0
PRK07678451 aminotransferase; Validated 100.0
PRK07482461 hypothetical protein; Provisional 100.0
PRK06062451 hypothetical protein; Provisional 100.0
COG0161449 BioA Adenosylmethionine-8-amino-7-oxononanoate ami 100.0
KOG1401433 consensus Acetylornithine aminotransferase [Amino 100.0
PRK05965459 hypothetical protein; Provisional 100.0
PRK11522459 putrescine--2-oxoglutarate aminotransferase; Provi 100.0
PRK06058443 4-aminobutyrate aminotransferase; Provisional 100.0
PRK06938464 diaminobutyrate--2-oxoglutarate aminotransferase; 100.0
PRK07481449 hypothetical protein; Provisional 100.0
PRK06931459 diaminobutyrate--2-oxoglutarate aminotransferase; 100.0
PRK05639457 4-aminobutyrate aminotransferase; Provisional 100.0
TIGR03372442 putres_am_tran putrescine aminotransferase. Member 100.0
PRK06916460 adenosylmethionine--8-amino-7-oxononanoate transam 100.0
PRK06943453 adenosylmethionine--8-amino-7-oxononanoate transam 100.0
PRK08742472 adenosylmethionine--8-amino-7-oxononanoate transam 100.0
PRK07030466 adenosylmethionine--8-amino-7-oxononanoate transam 100.0
PRK07483443 hypothetical protein; Provisional 100.0
PRK08593445 4-aminobutyrate aminotransferase; Provisional 100.0
PRK05769441 4-aminobutyrate aminotransferase; Provisional 100.0
PLN02760504 4-aminobutyrate:pyruvate transaminase 100.0
TIGR00709442 dat 2,4-diaminobutyrate 4-transaminases. This fami 100.0
PRK06541460 hypothetical protein; Provisional 100.0
PRK07495425 4-aminobutyrate aminotransferase; Provisional 100.0
PRK06917447 hypothetical protein; Provisional 100.0
PRK07480456 putative aminotransferase; Validated 100.0
PRK07036466 hypothetical protein; Provisional 100.0
PRK06777421 4-aminobutyrate aminotransferase; Provisional 100.0
PRK06082459 4-aminobutyrate aminotransferase; Provisional 100.0
KOG1402427 consensus Ornithine aminotransferase [Amino acid t 100.0
PRK06105460 aminotransferase; Provisional 100.0
PRK06918451 4-aminobutyrate aminotransferase; Reviewed 100.0
PRK12403460 putative aminotransferase; Provisional 100.0
PRK08360443 4-aminobutyrate aminotransferase; Provisional 100.0
PRK04612408 argD acetylornithine transaminase protein; Provisi 100.0
PRK08117433 4-aminobutyrate aminotransferase; Provisional 100.0
TIGR03246397 arg_catab_astC succinylornithine transaminase fami 100.0
PRK061481013 hypothetical protein; Provisional 100.0
PRK07986428 adenosylmethionine--8-amino-7-oxononanoate transam 100.0
PRK09792421 4-aminobutyrate transaminase; Provisional 100.0
PRK13360442 omega amino acid--pyruvate transaminase; Provision 100.0
PRK06209431 glutamate-1-semialdehyde 2,1-aminomutase; Provisio 100.0
TIGR00700420 GABAtrnsam 4-aminobutyrate aminotransferase, proka 100.0
PRK06173429 adenosylmethionine--8-amino-7-oxononanoate transam 100.0
TIGR00699464 GABAtrns_euk 4-aminobutyrate aminotransferase, euk 100.0
PRK05964423 adenosylmethionine--8-amino-7-oxononanoate transam 100.0
PRK09221445 beta alanine--pyruvate transaminase; Provisional 100.0
PRK04013364 argD acetylornithine/acetyl-lysine aminotransferas 100.0
TIGR02407412 ectoine_ectB diaminobutyrate--2-oxoglutarate amino 100.0
PRK05630422 adenosylmethionine--8-amino-7-oxononanoate transam 100.0
PRK03715395 argD acetylornithine transaminase protein; Provisi 100.0
PRK12381406 bifunctional succinylornithine transaminase/acetyl 100.0
PLN00144382 acetylornithine transaminase 100.0
PRK06149972 hypothetical protein; Provisional 100.0
PRK09264425 diaminobutyrate--2-oxoglutarate aminotransferase; 100.0
PLN02624474 ornithine-delta-aminotransferase 100.0
PRK08297443 L-lysine aminotransferase; Provisional 100.0
PRK04073396 rocD ornithine--oxo-acid transaminase; Provisional 100.0
PRK01278389 argD acetylornithine transaminase protein; Provisi 100.0
PRK05093403 argD bifunctional N-succinyldiaminopimelate-aminot 100.0
TIGR03251431 LAT_fam L-lysine 6-transaminase. Characterized mem 100.0
PF00202339 Aminotran_3: Aminotransferase class-III; InterPro: 100.0
TIGR00508427 bioA adenosylmethionine-8-amino-7-oxononanoate tra 100.0
PRK08088425 4-aminobutyrate aminotransferase; Validated 100.0
PLN02974817 adenosylmethionine-8-amino-7-oxononanoate transami 100.0
PRK03244398 argD acetylornithine aminotransferase; Provisional 100.0
PRK02936377 argD acetylornithine aminotransferase; Provisional 100.0
cd00610413 OAT_like Acetyl ornithine aminotransferase family. 100.0
TIGR01885401 Orn_aminotrans ornithine aminotransferase. This mo 100.0
PRK00854401 rocD ornithine--oxo-acid transaminase; Reviewed 100.0
PRK02627396 acetylornithine aminotransferase; Provisional 100.0
KOG1403452 consensus Predicted alanine-glyoxylate aminotransf 100.0
PTZ00125400 ornithine aminotransferase-like protein; Provision 100.0
PRK04260375 acetylornithine aminotransferase; Provisional 100.0
TIGR00707379 argD acetylornithine and succinylornithine aminotr 100.0
KOG1405484 consensus 4-aminobutyrate aminotransferase [Amino 100.0
PLN02822481 serine palmitoyltransferase 100.0
PRK07505402 hypothetical protein; Provisional 100.0
COG0156388 BioF 7-keto-8-aminopelargonate synthetase and rela 100.0
PLN02955476 8-amino-7-oxononanoate synthase 100.0
TIGR01821402 5aminolev_synth 5-aminolevulinic acid synthase. Th 100.0
PRK13393406 5-aminolevulinate synthase; Provisional 100.0
PRK09064407 5-aminolevulinate synthase; Validated 100.0
PLN03227392 serine palmitoyltransferase-like protein; Provisio 100.0
PRK05958385 8-amino-7-oxononanoate synthase; Reviewed 100.0
PRK07179407 hypothetical protein; Provisional 100.0
TIGR01825385 gly_Cac_T_rel pyridoxal phosphate-dependent acyltr 100.0
TIGR01822393 2am3keto_CoA 2-amino-3-ketobutyrate coenzyme A lig 100.0
PRK06939397 2-amino-3-ketobutyrate coenzyme A ligase; Provisio 100.0
KOG1359417 consensus Glycine C-acetyltransferase/2-amino-3-ke 100.0
PRK13392410 5-aminolevulinate synthase; Provisional 100.0
TIGR00858360 bioF 8-amino-7-oxononanoate synthase. This model r 99.97
KOG1360570 consensus 5-aminolevulinate synthase [Coenzyme tra 99.97
PLN02483489 serine palmitoyltransferase 99.97
COG0436393 Aspartate/tyrosine/aromatic aminotransferase [Amin 99.97
PRK06225380 aspartate aminotransferase; Provisional 99.96
PRK05937370 8-amino-7-oxononanoate synthase; Provisional 99.96
PRK03317368 histidinol-phosphate aminotransferase; Provisional 99.96
PRK07682378 hypothetical protein; Validated 99.95
COG1168388 MalY Bifunctional PLP-dependent enzyme with beta-c 99.95
PRK07324373 transaminase; Validated 99.95
PLN00175413 aminotransferase family protein; Provisional 99.95
PRK01533366 histidinol-phosphate aminotransferase; Validated 99.95
PRK06207405 aspartate aminotransferase; Provisional 99.95
PRK07681399 aspartate aminotransferase; Provisional 99.95
PRK15481431 transcriptional regulatory protein PtsJ; Provision 99.95
COG0079356 HisC Histidinol-phosphate/aromatic aminotransferas 99.95
PRK03158359 histidinol-phosphate aminotransferase; Provisional 99.95
PRK08153369 histidinol-phosphate aminotransferase; Provisional 99.95
cd06454349 KBL_like KBL_like; this family belongs to the pyri 99.95
PRK07366388 succinyldiaminopimelate transaminase; Validated 99.95
PRK08960387 hypothetical protein; Provisional 99.95
PRK06108382 aspartate aminotransferase; Provisional 99.95
PRK06290410 aspartate aminotransferase; Provisional 99.95
PRK02731367 histidinol-phosphate aminotransferase; Validated 99.95
TIGR03576346 pyridox_MJ0158 pyridoxal phosphate enzyme, MJ0158 99.94
PRK09148405 aminotransferase; Validated 99.94
PRK09147396 succinyldiaminopimelate transaminase; Provisional 99.94
PRK07309391 aromatic amino acid aminotransferase; Validated 99.94
TIGR03537350 DapC succinyldiaminopimelate transaminase. Note: t 99.94
PRK14809357 histidinol-phosphate aminotransferase; Provisional 99.94
PRK08636403 aspartate aminotransferase; Provisional 99.94
PRK06348384 aspartate aminotransferase; Provisional 99.94
PRK08068389 transaminase; Reviewed 99.94
PRK08175395 aminotransferase; Validated 99.94
PRK09082386 methionine aminotransferase; Validated 99.94
PLN02187462 rooty/superroot1 99.94
PRK09276385 LL-diaminopimelate aminotransferase; Provisional 99.94
PRK00950361 histidinol-phosphate aminotransferase; Validated 99.94
PRK05764393 aspartate aminotransferase; Provisional 99.94
PRK08361391 aspartate aminotransferase; Provisional 99.94
PRK02610374 histidinol-phosphate aminotransferase; Provisional 99.94
TIGR03540383 DapC_direct LL-diaminopimelate aminotransferase. T 99.94
PRK12414384 putative aminotransferase; Provisional 99.94
PRK08363398 alanine aminotransferase; Validated 99.94
PRK08056356 threonine-phosphate decarboxylase; Provisional 99.94
PLN00143409 tyrosine/nicotianamine aminotransferase; Provision 99.94
PRK05942394 aspartate aminotransferase; Provisional 99.94
PRK13355517 bifunctional HTH-domain containing protein/aminotr 99.93
PRK05839374 hypothetical protein; Provisional 99.93
TIGR01264401 tyr_amTase_E tyrosine aminotransferase, eukaryotic 99.93
PRK06855433 aminotransferase; Validated 99.93
PRK05957389 aspartate aminotransferase; Provisional 99.93
PRK07683387 aminotransferase A; Validated 99.93
PRK14807351 histidinol-phosphate aminotransferase; Provisional 99.93
PLN02656409 tyrosine transaminase 99.93
PRK06358354 threonine-phosphate decarboxylase; Provisional 99.93
PRK08912387 hypothetical protein; Provisional 99.93
TIGR03538393 DapC_gpp succinyldiaminopimelate transaminase. Thi 99.93
PRK06107402 aspartate aminotransferase; Provisional 99.93
PLN03026380 histidinol-phosphate aminotransferase; Provisional 99.93
TIGR01141346 hisC histidinol-phosphate aminotransferase. Histid 99.93
PLN00145430 tyrosine/nicotianamine aminotransferase; Provision 99.93
PTZ00433412 tyrosine aminotransferase; Provisional 99.93
PRK09105370 putative aminotransferase; Provisional 99.93
PRK05664330 threonine-phosphate decarboxylase; Reviewed 99.93
PRK07777387 aminotransferase; Validated 99.93
PRK06959339 putative threonine-phosphate decarboxylase; Provis 99.93
PRK07550386 hypothetical protein; Provisional 99.93
PRK03321352 putative aminotransferase; Provisional 99.93
PRK05387353 histidinol-phosphate aminotransferase; Provisional 99.93
KOG0257420 consensus Kynurenine aminotransferase, glutamine t 99.93
PRK06425332 histidinol-phosphate aminotransferase; Validated 99.93
COG1167459 ARO8 Transcriptional regulators containing a DNA-b 99.93
PRK04870356 histidinol-phosphate aminotransferase; Provisional 99.92
PRK09257396 aromatic amino acid aminotransferase; Provisional 99.92
PRK07392360 threonine-phosphate decarboxylase; Validated 99.92
PRK14808335 histidinol-phosphate aminotransferase; Provisional 99.92
PRK07865364 N-succinyldiaminopimelate aminotransferase; Review 99.92
PTZ00377481 alanine aminotransferase; Provisional 99.92
PLN026721082 methionine S-methyltransferase 99.92
TIGR01140330 L_thr_O3P_dcar L-threonine-O-3-phosphate decarboxy 99.92
PF00155363 Aminotran_1_2: Aminotransferase class I and II 1-a 99.92
PRK07568397 aspartate aminotransferase; Provisional 99.92
PRK03967337 histidinol-phosphate aminotransferase; Provisional 99.92
TIGR03539357 DapC_actino succinyldiaminopimelate transaminase. 99.92
PRK09265404 aminotransferase AlaT; Validated 99.92
PTZ00376404 aspartate aminotransferase; Provisional 99.92
TIGR01265403 tyr_nico_aTase tyrosine/nicotianamine aminotransfe 99.92
PRK07337388 aminotransferase; Validated 99.92
PRK05166371 histidinol-phosphate aminotransferase; Provisional 99.92
PRK07590409 L,L-diaminopimelate aminotransferase; Validated 99.91
PLN02450468 1-aminocyclopropane-1-carboxylate synthase 99.91
PRK09440416 avtA valine--pyruvate transaminase; Provisional 99.91
PRK01688351 histidinol-phosphate aminotransferase; Provisional 99.91
PRK08354311 putative aminotransferase; Provisional 99.91
TIGR02539370 SepCysS Sep-tRNA:Cys-tRNA synthase. Aminoacylation 99.91
PRK06836394 aspartate aminotransferase; Provisional 99.91
PLN02721353 threonine aldolase 99.91
cd00613398 GDC-P Glycine cleavage system P-protein, alpha- an 99.91
PLN02376496 1-aminocyclopropane-1-carboxylate synthase 99.91
PRK07908349 hypothetical protein; Provisional 99.9
PLN02607447 1-aminocyclopropane-1-carboxylate synthase 99.9
TIGR03542402 DAPAT_plant LL-diaminopimelate aminotransferase. T 99.9
cd06502338 TA_like Low-specificity threonine aldolase (TA). T 99.9
cd00609350 AAT_like Aspartate aminotransferase family. This f 99.9
PRK04781364 histidinol-phosphate aminotransferase; Provisional 99.9
PRK10534333 L-threonine aldolase; Provisional 99.89
PLN02231534 alanine transaminase 99.89
PLN02397423 aspartate transaminase 99.89
KOG1358467 consensus Serine palmitoyltransferase [Posttransla 99.89
PRK13520371 L-tyrosine decarboxylase; Provisional 99.88
PRK09331387 Sep-tRNA:Cys-tRNA synthetase; Provisional 99.88
TIGR03392398 FeS_syn_CsdA cysteine desulfurase, catalytic subun 99.88
PRK04635354 histidinol-phosphate aminotransferase; Provisional 99.88
KOG1357519 consensus Serine palmitoyltransferase [Posttransla 99.88
KOG0259447 consensus Tyrosine aminotransferase [Amino acid tr 99.88
PRK09275527 aspartate aminotransferase; Provisional 99.88
PRK10874401 cysteine sulfinate desulfinase; Provisional 99.88
PRK08637388 hypothetical protein; Provisional 99.87
TIGR03301355 PhnW-AepZ 2-aminoethylphosphonate aminotransferase 99.87
PRK13238460 tnaA tryptophanase/L-cysteine desulfhydrase, PLP-d 99.87
TIGR03801521 asp_4_decarbox aspartate 4-decarboxylase. This enz 99.87
cd06451356 AGAT_like Alanine-glyoxylate aminotransferase (AGA 99.86
PLN02368407 alanine transaminase 99.85
PRK02948381 cysteine desulfurase; Provisional 99.85
TIGR03402379 FeS_nifS cysteine desulfurase NifS. Members of thi 99.85
TIGR01976397 am_tr_V_VC1184 cysteine desulfurase family protein 99.85
cd06453373 SufS_like Cysteine desulfurase (SufS)-like. This f 99.85
COG1104386 NifS Cysteine sulfinate desulfinase/cysteine desul 99.84
TIGR01979403 sufS cysteine desulfurases, SufS subfamily. This m 99.84
TIGR03812373 tyr_de_CO2_Arch tyrosine decarboxylase MnfA. Membe 99.84
cd06452361 SepCysS Sep-tRNA:Cys-tRNA synthase. This family be 99.84
TIGR02326363 transamin_PhnW 2-aminoethylphosphonate--pyruvate t 99.84
COG2008342 GLY1 Threonine aldolase [Amino acid transport and 99.83
PRK09295406 bifunctional cysteine desulfurase/selenocysteine l 99.83
PRK13479368 2-aminoethylphosphonate--pyruvate transaminase; Pr 99.82
TIGR01437363 selA_rel uncharacterized pyridoxal phosphate-depen 99.82
TIGR01814406 kynureninase kynureninase. This model describes ky 99.82
COG0520405 csdA Selenocysteine lyase/Cysteine desulfurase [Po 99.82
PLN02409401 serine--glyoxylate aminotransaminase 99.81
PLN02855424 Bifunctional selenocysteine lyase/cysteine desulfu 99.81
cd00617431 Tnase_like Tryptophanase family (Tnase). This fami 99.81
cd00378402 SHMT Serine-glycine hydroxymethyltransferase (SHMT 99.8
cd00614369 CGS_like CGS_like: Cystathionine gamma-synthase is 99.8
KOG1368384 consensus Threonine aldolase [Amino acid transport 99.8
PRK00011416 glyA serine hydroxymethyltransferase; Reviewed 99.8
KOG0256471 consensus 1-aminocyclopropane-1-carboxylate syntha 99.8
PRK13034416 serine hydroxymethyltransferase; Reviewed 99.79
TIGR02006402 IscS cysteine desulfurase IscS. This model represe 99.79
PLN02242418 methionine gamma-lyase 99.79
cd06450345 DOPA_deC_like DOPA decarboxylase family. This fami 99.78
TIGR03403382 nifS_epsilon cysteine desulfurase, NifS family, ep 99.77
PRK06767386 methionine gamma-lyase; Provisional 99.76
PLN02651364 cysteine desulfurase 99.76
TIGR02379376 ECA_wecE TDP-4-keto-6-deoxy-D-glucose transaminase 99.76
TIGR01977376 am_tr_V_EF2568 cysteine desulfurase family protein 99.76
PRK14012404 cysteine desulfurase; Provisional 99.75
cd00616352 AHBA_syn 3-amino-5-hydroxybenzoic acid synthase fa 99.75
PRK13580493 serine hydroxymethyltransferase; Provisional 99.75
PF00266371 Aminotran_5: Aminotransferase class-V; InterPro: I 99.74
TIGR01325380 O_suc_HS_sulf O-succinylhomoserine sulfhydrylase. 99.74
PRK06234400 methionine gamma-lyase; Provisional 99.74
PRK08249398 cystathionine gamma-synthase; Provisional 99.73
PRK11706375 TDP-4-oxo-6-deoxy-D-glucose transaminase; Provisio 99.73
PRK06460376 hypothetical protein; Provisional 99.73
PRK07049427 methionine gamma-lyase; Validated 99.73
TIGR02080382 O_succ_thio_ly O-succinylhomoserine (thiol)-lyase. 99.73
PRK08045386 cystathionine gamma-synthase; Provisional 99.73
PRK07810403 O-succinylhomoserine sulfhydrylase; Provisional 99.72
KOG0634472 consensus Aromatic amino acid aminotransferase and 99.72
PRK07504398 O-succinylhomoserine sulfhydrylase; Reviewed 99.72
KOG0633375 consensus Histidinol phosphate aminotransferase [A 99.72
TIGR01328391 met_gam_lyase methionine gamma-lyase. This model d 99.72
COG3977417 Alanine-alpha-ketoisovalerate (or valine-pyruvate) 99.71
PRK08247366 cystathionine gamma-synthase; Reviewed 99.71
PRK08133390 O-succinylhomoserine sulfhydrylase; Validated 99.71
TIGR03235353 DNA_S_dndA cysteine desulfurase DndA. This model d 99.71
PLN03226475 serine hydroxymethyltransferase; Provisional 99.7
PRK07050394 cystathionine beta-lyase; Provisional 99.7
TIGR01324377 cysta_beta_ly_B cystathionine beta-lyase, bacteria 99.69
COG0399374 WecE Predicted pyridoxal phosphate-dependent enzym 99.69
PRK08776405 cystathionine gamma-synthase; Provisional 99.69
COG0075383 Serine-pyruvate aminotransferase/archaeal aspartat 99.68
PRK07503403 methionine gamma-lyase; Provisional 99.68
PRK00451447 glycine dehydrogenase subunit 1; Validated 99.68
PRK08861388 cystathionine gamma-synthase; Provisional 99.67
PRK05968389 hypothetical protein; Provisional 99.67
PRK07582366 cystathionine gamma-lyase; Validated 99.67
PLN03032374 serine decarboxylase; Provisional 99.67
PRK09028394 cystathionine beta-lyase; Provisional 99.67
PTZ00094452 serine hydroxymethyltransferase; Provisional 99.67
PRK06084425 O-acetylhomoserine aminocarboxypropyltransferase; 99.67
PRK08574385 cystathionine gamma-synthase; Provisional 99.66
PRK07811388 cystathionine gamma-synthase; Provisional 99.66
PRK07269364 cystathionine gamma-synthase; Reviewed 99.66
TIGR01326418 OAH_OAS_sulfhy OAH/OAS sulfhydrylase. This model d 99.66
PRK02769380 histidine decarboxylase; Provisional 99.66
PRK11658379 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate amin 99.65
PRK15407438 lipopolysaccharide biosynthesis protein RfbH; Prov 99.65
TIGR03531444 selenium_SpcS O-phosphoseryl-tRNA(Sec) selenium tr 99.63
PF01041363 DegT_DnrJ_EryC1: DegT/DnrJ/EryC1/StrS aminotransfe 99.63
PRK05994427 O-acetylhomoserine aminocarboxypropyltransferase; 99.63
PLN02509464 cystathionine beta-lyase 99.63
TIGR01329378 cysta_beta_ly_E cystathionine beta-lyase, eukaryot 99.63
cd00615294 Orn_deC_like Ornithine decarboxylase family. This 99.62
PRK04366481 glycine dehydrogenase subunit 2; Validated 99.62
PRK08248431 O-acetylhomoserine aminocarboxypropyltransferase; 99.6
PRK05967395 cystathionine beta-lyase; Provisional 99.6
KOG1549428 consensus Cysteine desulfurase NFS1 [Amino acid tr 99.6
TIGR01788431 Glu-decarb-GAD glutamate decarboxylase. This model 99.6
PRK04311464 selenocysteine synthase; Provisional 99.6
TIGR03588380 PseC UDP-4-keto-6-deoxy-N-acetylglucosamine 4-amin 99.6
PRK06702432 O-acetylhomoserine aminocarboxypropyltransferase; 99.59
PRK08064390 cystathionine beta-lyase; Provisional 99.57
PLN02414993 glycine dehydrogenase (decarboxylating) 99.57
PRK07671377 cystathionine beta-lyase; Provisional 99.57
PRK06176380 cystathionine gamma-synthase/cystathionine beta-ly 99.56
PRK05939397 hypothetical protein; Provisional 99.56
PRK08114395 cystathionine beta-lyase; Provisional 99.55
TIGR00474454 selA seryl-tRNA(sec) selenium transferase. In bact 99.54
PF01053386 Cys_Met_Meta_PP: Cys/Met metabolism PLP-dependent 99.54
PRK07812436 O-acetylhomoserine aminocarboxypropyltransferase; 99.54
PRK03080378 phosphoserine aminotransferase; Provisional 99.53
TIGR02618450 tyr_phenol_ly tyrosine phenol-lyase. This model de 99.52
PRK08134433 O-acetylhomoserine aminocarboxypropyltransferase; 99.52
cd01494170 AAT_I Aspartate aminotransferase (AAT) superfamily 99.52
PLN02263470 serine decarboxylase 99.51
PRK05367954 glycine dehydrogenase; Provisional 99.5
PLN02880490 tyrosine decarboxylase 99.49
TIGR00461939 gcvP glycine dehydrogenase (decarboxylating). This 99.48
PLN02590539 probable tyrosine decarboxylase 99.47
KOG2862385 consensus Alanine-glyoxylate aminotransferase AGT1 99.46
PRK13237460 tyrosine phenol-lyase; Provisional 99.46
TIGR03799522 NOD_PanD_pyr putative pyridoxal-dependent aspartat 99.46
PRK05355360 3-phosphoserine/phosphohydroxythreonine aminotrans 99.46
PRK12566954 glycine dehydrogenase; Provisional 99.45
COG1103382 Archaea-specific pyridoxal phosphate-dependent enz 99.45
TIGR01364349 serC_1 phosphoserine aminotransferase. This model 99.42
COG1448396 TyrB Aspartate/tyrosine/aromatic aminotransferase 99.42
PLN02724 805 Molybdenum cofactor sulfurase 99.41
PRK05613437 O-acetylhomoserine aminocarboxypropyltransferase; 99.4
COG0626396 MetC Cystathionine beta-lyases/cystathionine gamma 99.39
PF01212290 Beta_elim_lyase: Beta-eliminating lyase; InterPro: 99.39
TIGR01366361 serC_3 phosphoserine aminotransferase, putative. T 99.38
cd00611355 PSAT_like Phosphoserine aminotransferase (PSAT) fa 99.38
COG3844407 Kynureninase [Amino acid transport and metabolism] 99.36
COG2873426 MET17 O-acetylhomoserine sulfhydrylase [Amino acid 99.36
PRK15029 755 arginine decarboxylase; Provisional 99.34
PRK06434384 cystathionine gamma-lyase; Validated 99.34
COG0076460 GadB Glutamate decarboxylase and related PLP-depen 99.26
TIGR02617467 tnaA_trp_ase tryptophanase, leader peptide-associa 99.24
KOG0053409 consensus Cystathionine beta-lyases/cystathionine 99.23
PLN02271586 serine hydroxymethyltransferase 99.23
PF01276417 OKR_DC_1: Orn/Lys/Arg decarboxylase, major domain; 99.21
KOG0258475 consensus Alanine aminotransferase [Amino acid tra 99.17
PRK13578 720 ornithine decarboxylase; Provisional 99.17
PRK15399 713 lysine decarboxylase LdcC; Provisional 99.16
COG0112413 GlyA Glycine/serine hydroxymethyltransferase [Amin 99.13
PRK15400 714 lysine decarboxylase CadA; Provisional 99.1
PLN02452365 phosphoserine transaminase 99.09
PF00464399 SHMT: Serine hydroxymethyltransferase; InterPro: I 99.07
PLN02414 993 glycine dehydrogenase (decarboxylating) 99.07
TIGR01365374 serC_2 phosphoserine aminotransferase, Methanosarc 99.04
PF12897425 Aminotran_MocR: Alanine-glyoxylate amino-transfera 99.01
COG1003496 GcvP Glycine cleavage system protein P (pyridoxal- 99.01
PF00282373 Pyridoxal_deC: Pyridoxal-dependent decarboxylase c 98.98
COG1921395 SelA Selenocysteine synthase [seryl-tRNASer seleni 98.93
COG0403450 GcvP Glycine cleavage system protein P (pyridoxal- 98.88
COG1982 557 LdcC Arginine/lysine/ornithine decarboxylases [Ami 98.85
TIGR03811608 tyr_de_CO2_Ent tyrosine decarboxylase, Enterococcu 98.8
PRK12462364 phosphoserine aminotransferase; Provisional 98.76
PRK05367 954 glycine dehydrogenase; Provisional 98.76
PF06838403 Met_gamma_lyase: Methionine gamma-lyase ; InterPro 98.6
PF02347429 GDC-P: Glycine cleavage system P-protein; InterPro 98.56
PF03841367 SelA: L-seryl-tRNA selenium transferase; InterPro: 98.53
KOG20401001 consensus Glycine dehydrogenase (decarboxylating) 98.44
KOG0629510 consensus Glutamate decarboxylase and related prot 98.43
TIGR00461 939 gcvP glycine dehydrogenase (decarboxylating). This 98.42
KOG1412410 consensus Aspartate aminotransferase/Glutamic oxal 98.4
COG3033471 TnaA Tryptophanase [Amino acid transport and metab 98.38
KOG3846465 consensus L-kynurenine hydrolase [Amino acid trans 98.32
PF05889389 SLA_LP_auto_ag: Soluble liver antigen/liver pancre 98.25
KOG1383491 consensus Glutamate decarboxylase/sphingosine phos 98.05
PF04864363 Alliinase_C: Allinase; InterPro: IPR006948 Allicin 97.93
PRK12566 954 glycine dehydrogenase; Provisional 97.77
KOG2467477 consensus Glycine/serine hydroxymethyltransferase 97.74
KOG1411427 consensus Aspartate aminotransferase/Glutamic oxal 97.67
COG4100416 Cystathionine beta-lyase family protein involved i 97.6
COG1932365 SerC Phosphoserine aminotransferase [Coenzyme meta 97.03
KOG0628511 consensus Aromatic-L-amino-acid/L-histidine decarb 96.89
PLN02994153 1-aminocyclopropane-1-carboxylate synthase 96.24
KOG3843432 consensus Predicted serine hydroxymethyltransferas 95.25
KOG2040 1001 consensus Glycine dehydrogenase (decarboxylating) 86.21
>COG0001 HemL Glutamate-1-semialdehyde aminotransferase [Coenzyme metabolism] Back     alignment and domain information 
Probab=100.00  E-value=7.8e-90  Score=655.94  Aligned_cols=427  Identities=58%  Similarity=0.994  Sum_probs=411.8

Q ss_pred             CChhHHHHHHHHhhhCCCCCCCccccccccCCCCeEEEeecCCEEEEcCCCEEEecccChhhccCCCCcHHHHHHHHHHH
Q 011856           49 TLKKSEEAFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETM  128 (476)
Q Consensus        49 ~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~p~~~~~~~G~~~~d~dG~~~iD~~~~~~~~~lG~~~p~v~~a~~~~l  128 (476)
                      ..++|+++++++++++|+|+++++|.|.+++++|+++++++|+|+||+|||+||||+++|+++.+||+||.|.+|+.+++
T Consensus         3 ~~~~S~~l~~~A~~~~pGGvnspvra~~~v~~~P~fi~~g~Ga~l~DvDGn~YIDy~~~~Gp~ilGH~~p~V~~Av~~~l   82 (432)
T COG0001           3 QFPKSEALFERAKKVIPGGVNSPVRAFKSVGGYPIFIERGKGAYLTDVDGNEYIDYVLGWGPLILGHAHPAVVEAVQEQL   82 (432)
T ss_pred             CccchHHHHHHHhhhCCCCCCccccccCCCCCCCeeEEeccCCeEEeCCCCEeeehhccCcccccCCCCHHHHHHHHHHH
Confidence            46789999999999999999999999999988999999999999999999999999999999999999999999999999


Q ss_pred             HhcCCCCCCCHHHHHHHHHHHhhCCCCCeEEEeCCHHHHHHHHHHHHHhccCCceEEEEeCCCCCCchhHHhhcCCCCcc
Q 011856          129 KKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIIKFEGCYHGHADPFLVKAGSGVAT  208 (476)
Q Consensus       129 ~~~~~~~~~~~~~~~la~~l~~~~~~~e~v~~~~sGseA~~~al~~ar~~~~~~~ii~~~~~yhg~~~~~~~~~g~~~~~  208 (476)
                      ++|.+|+.|++.+.+++|.+++++|..|+|.|+||||||++.|||+||++|+|++||+|+++|||+++.++...|++...
T Consensus        83 ~~G~~fg~Pte~Ei~~Aell~~~~p~~e~vrfvnSGTEAtmsAiRlARa~TgR~kIikF~G~YHG~~D~~lv~agsg~~t  162 (432)
T COG0001          83 ERGLSFGAPTELEVELAELLIERVPSIEKVRFVNSGTEATMSAIRLARAYTGRDKIIKFEGCYHGHSDSLLVKAGSGAAT  162 (432)
T ss_pred             HhcCCCCCCCHHHHHHHHHHHHhcCcccEEEEecchhHHHHHHHHHHHHhhCCCeEEEEcCCCCCCccHHHhhcCcCccc
Confidence            99999999999999999999999998999999999999999999999999999999999999999999999999888877


Q ss_pred             CCCCCCCCCCCCCCCceeeccCCCHHHHHHHHhcCCCCeEEEEEcccCCCCCcccCCHHHHHHHHHHHHHhCCEEEEecc
Q 011856          209 LGLPDSPGVPKGATYETLTAPFNDVSALENLFENNKGEIAAIILEPVVGNSGFIAPKPDFLNAIRRITKENGALLIFDEV  288 (476)
Q Consensus       209 ~~~~~~~~~~~~~~~~~~~~~~~d~~~le~~l~~~~~~~a~vi~ep~~~~~G~i~~~~~~l~~l~~l~~~~g~llI~DEv  288 (476)
                      ...|.+.|+|.....+++.+||||+++++++++++++++|+||+||+.+|.|.++|.++||++|++||++||++||+|||
T Consensus       163 ~g~p~s~Gvp~~~a~~ti~~~yND~~al~~~~~~~g~~IAaVIvEPv~gn~g~i~p~~~Fl~~Lr~lt~e~G~lLI~DEV  242 (432)
T COG0001         163 LGSPSSPGVPADVAKHTLVLPYNDLEALEEAFEEYGDDIAAVIVEPVAGNMGVVPPEPGFLEGLRELTEEHGALLIFDEV  242 (432)
T ss_pred             CCCCCCCCCChhhhccEEEecCCCHHHHHHHHHHcCCcEEEEEeccccCCCCCCCCCHHHHHHHHHHHHHcCcEEEEecc
Confidence            77799999999999999999999999999999999899999999999999999999999999999999999999999999


Q ss_pred             ccCccccccchhhccCCCCchhhhhhhcCCCCcEEEEEecHHHHHhhcCCCCccccCCCCCcHHHHHHHHHHHHHhcC-C
Q 011856          289 MTGFRLAYGGAQEYFGVTPDLTTLGKIIGGGLPVGAYGGRRDIMEMVAPAGPMYQAGTLSGNPLAMTAGIHTLKRLKE-P  367 (476)
Q Consensus       289 ~~g~r~g~~~~~~~~g~~pDi~t~sK~lg~G~~iG~~~~~~~i~~~l~~~~~~~~~~t~~~~~~~~aaa~aal~~~~~-~  367 (476)
                      +||||....+++++||++||++||+|.+|||+|+|++.+++++|+.+.+.++.++.+|+++||++++|++++|+.+.+ +
T Consensus       243 iTGFR~~~gGaq~~~gi~PDlttlGKiIGGGlP~ga~gGr~eiM~~~~p~g~vyqaGT~sgnplamaAG~atl~~l~~~~  322 (432)
T COG0001         243 ITGFRVALGGAQGYYGVEPDLTTLGKIIGGGLPIGAFGGRAEIMEQLAPLGPVYQAGTLSGNPLAMAAGLATLEELMTEE  322 (432)
T ss_pred             hhhcccCCcccccccCcCcchhhhhhhhcCCcceeeeccHHHHHhhhCCCCCccccCCCCCcHHHHHHHHHHHHHHHhcc
Confidence            999998888999999999999999999999999999999999999999988999999999999999999999999987 5


Q ss_pred             CHHHHHHHHHHHHHHHHHHHhhhcCCceEeeeeceeEEEEEecCCCcCchhhcccchHHHHHHHHHHHHCCeEeccCCCc
Q 011856          368 GTYEYLNKITGELTQGIIDAGKKAGHAICGGYISGMFGFFFTEGPVYNFEDAKKSETTKFARFYRGMLEEGVYFAPSQFE  447 (476)
Q Consensus       368 ~~~~~~~~~~~~l~~~L~~~~~~~~~~~~v~~~g~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~Gv~~~~~~~~  447 (476)
                      ..++++.+++++|+++|++...+++++..+.+.|.|+.+.|.+..+.++.++...+.+...++.+.|+++||++.|+.+.
T Consensus       323 ~~y~~l~~~~~~L~~gl~~~~~~~g~~~~v~~~gsm~~i~F~~~~~~n~~da~~sd~~~~~~~~~~~l~~GV~l~ps~~e  402 (432)
T COG0001         323 GVYERLDALGERLAEGLRAAAERHGIPLTVNRVGSMFGIFFTEEGVRNYADAKRSDVERFAKFFHHLLNRGVYLAPSQFE  402 (432)
T ss_pred             cHHHHHHHHHHHHHHHHHHHHHHhCCCeEEeeecceEEEEecCCCCCCHHHHHhhchHHHHHHHHHHHhCCcccCCcccc
Confidence            68999999999999999999999999999999999999999988899999998888888888989999999999999888


Q ss_pred             ceEEeCCCcHHHHHHHHHHHHHHHHHhh
Q 011856          448 AGFTSLAHSSDDIQHTITAAEKVKMRFL  475 (476)
Q Consensus       448 ~~~~~~~~t~e~i~~~~~~l~~~~~~~~  475 (476)
                      ..+++..||+++||+++++++++++++.
T Consensus       403 a~flS~ahte~di~~~~~a~~~~~~~~~  430 (432)
T COG0001         403 AGFLSTAHTEEDIDRTLEAADEAFKELA  430 (432)
T ss_pred             ceeeecccCHHHHHHHHHHHHHHHHHhh
Confidence            8999999999999999999999998764

>PLN02482 glutamate-1-semialdehyde 2,1-aminomutase Back     alignment and domain information
>COG4992 ArgD Ornithine/acetylornithine aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>COG0160 GabT 4-aminobutyrate aminotransferase and related aminotransferases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12389 glutamate-1-semialdehyde aminotransferase; Provisional Back     alignment and domain information
>PRK00615 glutamate-1-semialdehyde aminotransferase; Provisional Back     alignment and domain information
>PRK07046 aminotransferase; Validated Back     alignment and domain information
>TIGR00713 hemL glutamate-1-semialdehyde-2,1-aminomutase Back     alignment and domain information
>KOG1404 consensus Alanine-glyoxylate aminotransferase AGT2 [Amino acid transport and metabolism] Back     alignment and domain information
>PRK00062 glutamate-1-semialdehyde aminotransferase; Provisional Back     alignment and domain information
>PRK07678 aminotransferase; Validated Back     alignment and domain information
>PRK07482 hypothetical protein; Provisional Back     alignment and domain information
>PRK06062 hypothetical protein; Provisional Back     alignment and domain information
>COG0161 BioA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase [Coenzyme metabolism] Back     alignment and domain information
>KOG1401 consensus Acetylornithine aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05965 hypothetical protein; Provisional Back     alignment and domain information
>PRK11522 putrescine--2-oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>PRK06058 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK06938 diaminobutyrate--2-oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>PRK07481 hypothetical protein; Provisional Back     alignment and domain information
>PRK06931 diaminobutyrate--2-oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>PRK05639 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>TIGR03372 putres_am_tran putrescine aminotransferase Back     alignment and domain information
>PRK06916 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK06943 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK08742 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK07030 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK07483 hypothetical protein; Provisional Back     alignment and domain information
>PRK08593 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK05769 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PLN02760 4-aminobutyrate:pyruvate transaminase Back     alignment and domain information
>TIGR00709 dat 2,4-diaminobutyrate 4-transaminases Back     alignment and domain information
>PRK06541 hypothetical protein; Provisional Back     alignment and domain information
>PRK07495 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK06917 hypothetical protein; Provisional Back     alignment and domain information
>PRK07480 putative aminotransferase; Validated Back     alignment and domain information
>PRK07036 hypothetical protein; Provisional Back     alignment and domain information
>PRK06777 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK06082 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>KOG1402 consensus Ornithine aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06105 aminotransferase; Provisional Back     alignment and domain information
>PRK06918 4-aminobutyrate aminotransferase; Reviewed Back     alignment and domain information
>PRK12403 putative aminotransferase; Provisional Back     alignment and domain information
>PRK08360 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK04612 argD acetylornithine transaminase protein; Provisional Back     alignment and domain information
>PRK08117 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>TIGR03246 arg_catab_astC succinylornithine transaminase family Back     alignment and domain information
>PRK06148 hypothetical protein; Provisional Back     alignment and domain information
>PRK07986 adenosylmethionine--8-amino-7-oxononanoate transaminase; Validated Back     alignment and domain information
>PRK09792 4-aminobutyrate transaminase; Provisional Back     alignment and domain information
>PRK13360 omega amino acid--pyruvate transaminase; Provisional Back     alignment and domain information
>PRK06209 glutamate-1-semialdehyde 2,1-aminomutase; Provisional Back     alignment and domain information
>TIGR00700 GABAtrnsam 4-aminobutyrate aminotransferase, prokaryotic type Back     alignment and domain information
>PRK06173 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>TIGR00699 GABAtrns_euk 4-aminobutyrate aminotransferase, eukaryotic type Back     alignment and domain information
>PRK05964 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK09221 beta alanine--pyruvate transaminase; Provisional Back     alignment and domain information
>PRK04013 argD acetylornithine/acetyl-lysine aminotransferase; Provisional Back     alignment and domain information
>TIGR02407 ectoine_ectB diaminobutyrate--2-oxoglutarate aminotransferase Back     alignment and domain information
>PRK05630 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK03715 argD acetylornithine transaminase protein; Provisional Back     alignment and domain information
>PRK12381 bifunctional succinylornithine transaminase/acetylornithine transaminase; Provisional Back     alignment and domain information
>PLN00144 acetylornithine transaminase Back     alignment and domain information
>PRK06149 hypothetical protein; Provisional Back     alignment and domain information
>PRK09264 diaminobutyrate--2-oxoglutarate aminotransferase; Validated Back     alignment and domain information
>PLN02624 ornithine-delta-aminotransferase Back     alignment and domain information
>PRK08297 L-lysine aminotransferase; Provisional Back     alignment and domain information
>PRK04073 rocD ornithine--oxo-acid transaminase; Provisional Back     alignment and domain information
>PRK01278 argD acetylornithine transaminase protein; Provisional Back     alignment and domain information
>PRK05093 argD bifunctional N-succinyldiaminopimelate-aminotransferase/acetylornithine transaminase protein; Reviewed Back     alignment and domain information
>TIGR03251 LAT_fam L-lysine 6-transaminase Back     alignment and domain information
>PF00202 Aminotran_3: Aminotransferase class-III; InterPro: IPR005814 Aminotransferases share certain mechanistic features with other pyridoxalphosphate-dependent enzymes, such as the covalent binding of the pyridoxalphosphate group to a lysine residue Back     alignment and domain information
>TIGR00508 bioA adenosylmethionine-8-amino-7-oxononanoate transaminase Back     alignment and domain information
>PRK08088 4-aminobutyrate aminotransferase; Validated Back     alignment and domain information
>PLN02974 adenosylmethionine-8-amino-7-oxononanoate transaminase Back     alignment and domain information
>PRK03244 argD acetylornithine aminotransferase; Provisional Back     alignment and domain information
>PRK02936 argD acetylornithine aminotransferase; Provisional Back     alignment and domain information
>cd00610 OAT_like Acetyl ornithine aminotransferase family Back     alignment and domain information
>TIGR01885 Orn_aminotrans ornithine aminotransferase Back     alignment and domain information
>PRK00854 rocD ornithine--oxo-acid transaminase; Reviewed Back     alignment and domain information
>PRK02627 acetylornithine aminotransferase; Provisional Back     alignment and domain information
>KOG1403 consensus Predicted alanine-glyoxylate aminotransferase [General function prediction only] Back     alignment and domain information
>PTZ00125 ornithine aminotransferase-like protein; Provisional Back     alignment and domain information
>PRK04260 acetylornithine aminotransferase; Provisional Back     alignment and domain information
>TIGR00707 argD acetylornithine and succinylornithine aminotransferases Back     alignment and domain information
>KOG1405 consensus 4-aminobutyrate aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02822 serine palmitoyltransferase Back     alignment and domain information
>PRK07505 hypothetical protein; Provisional Back     alignment and domain information
>COG0156 BioF 7-keto-8-aminopelargonate synthetase and related enzymes [Coenzyme metabolism] Back     alignment and domain information
>PLN02955 8-amino-7-oxononanoate synthase Back     alignment and domain information
>TIGR01821 5aminolev_synth 5-aminolevulinic acid synthase Back     alignment and domain information
>PRK13393 5-aminolevulinate synthase; Provisional Back     alignment and domain information
>PRK09064 5-aminolevulinate synthase; Validated Back     alignment and domain information
>PLN03227 serine palmitoyltransferase-like protein; Provisional Back     alignment and domain information
>PRK05958 8-amino-7-oxononanoate synthase; Reviewed Back     alignment and domain information
>PRK07179 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01825 gly_Cac_T_rel pyridoxal phosphate-dependent acyltransferase, putative Back     alignment and domain information
>TIGR01822 2am3keto_CoA 2-amino-3-ketobutyrate coenzyme A ligase Back     alignment and domain information
>PRK06939 2-amino-3-ketobutyrate coenzyme A ligase; Provisional Back     alignment and domain information
>KOG1359 consensus Glycine C-acetyltransferase/2-amino-3-ketobutyrate-CoA ligase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13392 5-aminolevulinate synthase; Provisional Back     alignment and domain information
>TIGR00858 bioF 8-amino-7-oxononanoate synthase Back     alignment and domain information
>KOG1360 consensus 5-aminolevulinate synthase [Coenzyme transport and metabolism] Back     alignment and domain information
>PLN02483 serine palmitoyltransferase Back     alignment and domain information
>COG0436 Aspartate/tyrosine/aromatic aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06225 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK05937 8-amino-7-oxononanoate synthase; Provisional Back     alignment and domain information
>PRK03317 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK07682 hypothetical protein; Validated Back     alignment and domain information
>COG1168 MalY Bifunctional PLP-dependent enzyme with beta-cystathionase and maltose regulon repressor activities [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07324 transaminase; Validated Back     alignment and domain information
>PLN00175 aminotransferase family protein; Provisional Back     alignment and domain information
>PRK01533 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PRK06207 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK07681 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK15481 transcriptional regulatory protein PtsJ; Provisional Back     alignment and domain information
>COG0079 HisC Histidinol-phosphate/aromatic aminotransferase and cobyric acid decarboxylase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK03158 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK08153 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>cd06454 KBL_like KBL_like; this family belongs to the pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I) Back     alignment and domain information
>PRK07366 succinyldiaminopimelate transaminase; Validated Back     alignment and domain information
>PRK08960 hypothetical protein; Provisional Back     alignment and domain information
>PRK06108 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK06290 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK02731 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>TIGR03576 pyridox_MJ0158 pyridoxal phosphate enzyme, MJ0158 family Back     alignment and domain information
>PRK09148 aminotransferase; Validated Back     alignment and domain information
>PRK09147 succinyldiaminopimelate transaminase; Provisional Back     alignment and domain information
>PRK07309 aromatic amino acid aminotransferase; Validated Back     alignment and domain information
>TIGR03537 DapC succinyldiaminopimelate transaminase Back     alignment and domain information
>PRK14809 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK08636 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK06348 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK08068 transaminase; Reviewed Back     alignment and domain information
>PRK08175 aminotransferase; Validated Back     alignment and domain information
>PRK09082 methionine aminotransferase; Validated Back     alignment and domain information
>PLN02187 rooty/superroot1 Back     alignment and domain information
>PRK09276 LL-diaminopimelate aminotransferase; Provisional Back     alignment and domain information
>PRK00950 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PRK05764 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK08361 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK02610 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>TIGR03540 DapC_direct LL-diaminopimelate aminotransferase Back     alignment and domain information
>PRK12414 putative aminotransferase; Provisional Back     alignment and domain information
>PRK08363 alanine aminotransferase; Validated Back     alignment and domain information
>PRK08056 threonine-phosphate decarboxylase; Provisional Back     alignment and domain information
>PLN00143 tyrosine/nicotianamine aminotransferase; Provisional Back     alignment and domain information
>PRK05942 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK13355 bifunctional HTH-domain containing protein/aminotransferase; Provisional Back     alignment and domain information
>PRK05839 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01264 tyr_amTase_E tyrosine aminotransferase, eukaryotic Back     alignment and domain information
>PRK06855 aminotransferase; Validated Back     alignment and domain information
>PRK05957 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK07683 aminotransferase A; Validated Back     alignment and domain information
>PRK14807 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PLN02656 tyrosine transaminase Back     alignment and domain information
>PRK06358 threonine-phosphate decarboxylase; Provisional Back     alignment and domain information
>PRK08912 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03538 DapC_gpp succinyldiaminopimelate transaminase Back     alignment and domain information
>PRK06107 aspartate aminotransferase; Provisional Back     alignment and domain information
>PLN03026 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>TIGR01141 hisC histidinol-phosphate aminotransferase Back     alignment and domain information
>PLN00145 tyrosine/nicotianamine aminotransferase; Provisional Back     alignment and domain information
>PTZ00433 tyrosine aminotransferase; Provisional Back     alignment and domain information
>PRK09105 putative aminotransferase; Provisional Back     alignment and domain information
>PRK05664 threonine-phosphate decarboxylase; Reviewed Back     alignment and domain information
>PRK07777 aminotransferase; Validated Back     alignment and domain information
>PRK06959 putative threonine-phosphate decarboxylase; Provisional Back     alignment and domain information
>PRK07550 hypothetical protein; Provisional Back     alignment and domain information
>PRK03321 putative aminotransferase; Provisional Back     alignment and domain information
>PRK05387 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>KOG0257 consensus Kynurenine aminotransferase, glutamine transaminase K [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06425 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>COG1167 ARO8 Transcriptional regulators containing a DNA-binding HTH domain and an aminotransferase domain (MocR family) and their eukaryotic orthologs [Transcription / Amino acid transport and metabolism] Back     alignment and domain information
>PRK04870 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK09257 aromatic amino acid aminotransferase; Provisional Back     alignment and domain information
>PRK07392 threonine-phosphate decarboxylase; Validated Back     alignment and domain information
>PRK14808 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK07865 N-succinyldiaminopimelate aminotransferase; Reviewed Back     alignment and domain information
>PTZ00377 alanine aminotransferase; Provisional Back     alignment and domain information
>PLN02672 methionine S-methyltransferase Back     alignment and domain information
>TIGR01140 L_thr_O3P_dcar L-threonine-O-3-phosphate decarboxylase Back     alignment and domain information
>PF00155 Aminotran_1_2: Aminotransferase class I and II 1-aminocyclopropane-1-carboxylate synthase signature aspartate aminotransferase signature; InterPro: IPR004839 Aminotransferases share certain mechanistic features with other pyridoxal-phosphate dependent enzymes, such as the covalent binding of the pyridoxal-phosphate group to a lysine residue Back     alignment and domain information
>PRK07568 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK03967 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>TIGR03539 DapC_actino succinyldiaminopimelate transaminase Back     alignment and domain information
>PRK09265 aminotransferase AlaT; Validated Back     alignment and domain information
>PTZ00376 aspartate aminotransferase; Provisional Back     alignment and domain information
>TIGR01265 tyr_nico_aTase tyrosine/nicotianamine aminotransferases Back     alignment and domain information
>PRK07337 aminotransferase; Validated Back     alignment and domain information
>PRK05166 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK07590 L,L-diaminopimelate aminotransferase; Validated Back     alignment and domain information
>PLN02450 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>PRK09440 avtA valine--pyruvate transaminase; Provisional Back     alignment and domain information
>PRK01688 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK08354 putative aminotransferase; Provisional Back     alignment and domain information
>TIGR02539 SepCysS Sep-tRNA:Cys-tRNA synthase Back     alignment and domain information
>PRK06836 aspartate aminotransferase; Provisional Back     alignment and domain information
>PLN02721 threonine aldolase Back     alignment and domain information
>cd00613 GDC-P Glycine cleavage system P-protein, alpha- and beta-subunits Back     alignment and domain information
>PLN02376 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>PRK07908 hypothetical protein; Provisional Back     alignment and domain information
>PLN02607 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>TIGR03542 DAPAT_plant LL-diaminopimelate aminotransferase Back     alignment and domain information
>cd06502 TA_like Low-specificity threonine aldolase (TA) Back     alignment and domain information
>cd00609 AAT_like Aspartate aminotransferase family Back     alignment and domain information
>PRK04781 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK10534 L-threonine aldolase; Provisional Back     alignment and domain information
>PLN02231 alanine transaminase Back     alignment and domain information
>PLN02397 aspartate transaminase Back     alignment and domain information
>KOG1358 consensus Serine palmitoyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13520 L-tyrosine decarboxylase; Provisional Back     alignment and domain information
>PRK09331 Sep-tRNA:Cys-tRNA synthetase; Provisional Back     alignment and domain information
>TIGR03392 FeS_syn_CsdA cysteine desulfurase, catalytic subunit CsdA Back     alignment and domain information
>PRK04635 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>KOG1357 consensus Serine palmitoyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0259 consensus Tyrosine aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09275 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK10874 cysteine sulfinate desulfinase; Provisional Back     alignment and domain information
>PRK08637 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03301 PhnW-AepZ 2-aminoethylphosphonate aminotransferase Back     alignment and domain information
>PRK13238 tnaA tryptophanase/L-cysteine desulfhydrase, PLP-dependent; Provisional Back     alignment and domain information
>TIGR03801 asp_4_decarbox aspartate 4-decarboxylase Back     alignment and domain information
>cd06451 AGAT_like Alanine-glyoxylate aminotransferase (AGAT) family Back     alignment and domain information
>PLN02368 alanine transaminase Back     alignment and domain information
>PRK02948 cysteine desulfurase; Provisional Back     alignment and domain information
>TIGR03402 FeS_nifS cysteine desulfurase NifS Back     alignment and domain information
>TIGR01976 am_tr_V_VC1184 cysteine desulfurase family protein, VC1184 subfamily Back     alignment and domain information
>cd06453 SufS_like Cysteine desulfurase (SufS)-like Back     alignment and domain information
>COG1104 NifS Cysteine sulfinate desulfinase/cysteine desulfurase and related enzymes [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01979 sufS cysteine desulfurases, SufS subfamily Back     alignment and domain information
>TIGR03812 tyr_de_CO2_Arch tyrosine decarboxylase MnfA Back     alignment and domain information
>cd06452 SepCysS Sep-tRNA:Cys-tRNA synthase Back     alignment and domain information
>TIGR02326 transamin_PhnW 2-aminoethylphosphonate--pyruvate transaminase Back     alignment and domain information
>COG2008 GLY1 Threonine aldolase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09295 bifunctional cysteine desulfurase/selenocysteine lyase; Validated Back     alignment and domain information
>PRK13479 2-aminoethylphosphonate--pyruvate transaminase; Provisional Back     alignment and domain information
>TIGR01437 selA_rel uncharacterized pyridoxal phosphate-dependent enzyme Back     alignment and domain information
>TIGR01814 kynureninase kynureninase Back     alignment and domain information
>COG0520 csdA Selenocysteine lyase/Cysteine desulfurase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02409 serine--glyoxylate aminotransaminase Back     alignment and domain information
>PLN02855 Bifunctional selenocysteine lyase/cysteine desulfurase Back     alignment and domain information
>cd00617 Tnase_like Tryptophanase family (Tnase) Back     alignment and domain information
>cd00378 SHMT Serine-glycine hydroxymethyltransferase (SHMT) Back     alignment and domain information
>cd00614 CGS_like CGS_like: Cystathionine gamma-synthase is a PLP dependent enzyme and catalyzes the committed step of methionine biosynthesis Back     alignment and domain information
>KOG1368 consensus Threonine aldolase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK00011 glyA serine hydroxymethyltransferase; Reviewed Back     alignment and domain information
>KOG0256 consensus 1-aminocyclopropane-1-carboxylate synthase, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PRK13034 serine hydroxymethyltransferase; Reviewed Back     alignment and domain information
>TIGR02006 IscS cysteine desulfurase IscS Back     alignment and domain information
>PLN02242 methionine gamma-lyase Back     alignment and domain information
>cd06450 DOPA_deC_like DOPA decarboxylase family Back     alignment and domain information
>TIGR03403 nifS_epsilon cysteine desulfurase, NifS family, epsilon proteobacteria type Back     alignment and domain information
>PRK06767 methionine gamma-lyase; Provisional Back     alignment and domain information
>PLN02651 cysteine desulfurase Back     alignment and domain information
>TIGR02379 ECA_wecE TDP-4-keto-6-deoxy-D-glucose transaminase Back     alignment and domain information
>TIGR01977 am_tr_V_EF2568 cysteine desulfurase family protein Back     alignment and domain information
>PRK14012 cysteine desulfurase; Provisional Back     alignment and domain information
>cd00616 AHBA_syn 3-amino-5-hydroxybenzoic acid synthase family (AHBA_syn) Back     alignment and domain information
>PRK13580 serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>PF00266 Aminotran_5: Aminotransferase class-V; InterPro: IPR000192 Aminotransferases share certain mechanistic features with other pyridoxal- phosphate dependent enzymes, such as the covalent binding of the pyridoxal- phosphate group to a lysine residue Back     alignment and domain information
>TIGR01325 O_suc_HS_sulf O-succinylhomoserine sulfhydrylase Back     alignment and domain information
>PRK06234 methionine gamma-lyase; Provisional Back     alignment and domain information
>PRK08249 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK11706 TDP-4-oxo-6-deoxy-D-glucose transaminase; Provisional Back     alignment and domain information
>PRK06460 hypothetical protein; Provisional Back     alignment and domain information
>PRK07049 methionine gamma-lyase; Validated Back     alignment and domain information
>TIGR02080 O_succ_thio_ly O-succinylhomoserine (thiol)-lyase Back     alignment and domain information
>PRK08045 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK07810 O-succinylhomoserine sulfhydrylase; Provisional Back     alignment and domain information
>KOG0634 consensus Aromatic amino acid aminotransferase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07504 O-succinylhomoserine sulfhydrylase; Reviewed Back     alignment and domain information
>KOG0633 consensus Histidinol phosphate aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01328 met_gam_lyase methionine gamma-lyase Back     alignment and domain information
>COG3977 Alanine-alpha-ketoisovalerate (or valine-pyruvate) aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08247 cystathionine gamma-synthase; Reviewed Back     alignment and domain information
>PRK08133 O-succinylhomoserine sulfhydrylase; Validated Back     alignment and domain information
>TIGR03235 DNA_S_dndA cysteine desulfurase DndA Back     alignment and domain information
>PLN03226 serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>PRK07050 cystathionine beta-lyase; Provisional Back     alignment and domain information
>TIGR01324 cysta_beta_ly_B cystathionine beta-lyase, bacterial Back     alignment and domain information
>COG0399 WecE Predicted pyridoxal phosphate-dependent enzyme apparently involved in regulation of cell wall biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK08776 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>COG0075 Serine-pyruvate aminotransferase/archaeal aspartate aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07503 methionine gamma-lyase; Provisional Back     alignment and domain information
>PRK00451 glycine dehydrogenase subunit 1; Validated Back     alignment and domain information
>PRK08861 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK05968 hypothetical protein; Provisional Back     alignment and domain information
>PRK07582 cystathionine gamma-lyase; Validated Back     alignment and domain information
>PLN03032 serine decarboxylase; Provisional Back     alignment and domain information
>PRK09028 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PTZ00094 serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>PRK06084 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK08574 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK07811 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK07269 cystathionine gamma-synthase; Reviewed Back     alignment and domain information
>TIGR01326 OAH_OAS_sulfhy OAH/OAS sulfhydrylase Back     alignment and domain information
>PRK02769 histidine decarboxylase; Provisional Back     alignment and domain information
>PRK11658 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>PRK15407 lipopolysaccharide biosynthesis protein RfbH; Provisional Back     alignment and domain information
>TIGR03531 selenium_SpcS O-phosphoseryl-tRNA(Sec) selenium transferase Back     alignment and domain information
>PF01041 DegT_DnrJ_EryC1: DegT/DnrJ/EryC1/StrS aminotransferase family; InterPro: IPR000653 This entry represents a family that are probably all pyridoxal-phosphate-dependent aminotransferase enzymes with a variety of molecular functions Back     alignment and domain information
>PRK05994 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PLN02509 cystathionine beta-lyase Back     alignment and domain information
>TIGR01329 cysta_beta_ly_E cystathionine beta-lyase, eukaryotic Back     alignment and domain information
>cd00615 Orn_deC_like Ornithine decarboxylase family Back     alignment and domain information
>PRK04366 glycine dehydrogenase subunit 2; Validated Back     alignment and domain information
>PRK08248 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK05967 cystathionine beta-lyase; Provisional Back     alignment and domain information
>KOG1549 consensus Cysteine desulfurase NFS1 [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01788 Glu-decarb-GAD glutamate decarboxylase Back     alignment and domain information
>PRK04311 selenocysteine synthase; Provisional Back     alignment and domain information
>TIGR03588 PseC UDP-4-keto-6-deoxy-N-acetylglucosamine 4-aminotransferase Back     alignment and domain information
>PRK06702 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK08064 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PLN02414 glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK07671 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK06176 cystathionine gamma-synthase/cystathionine beta-lyase; Validated Back     alignment and domain information
>PRK05939 hypothetical protein; Provisional Back     alignment and domain information
>PRK08114 cystathionine beta-lyase; Provisional Back     alignment and domain information
>TIGR00474 selA seryl-tRNA(sec) selenium transferase Back     alignment and domain information
>PF01053 Cys_Met_Meta_PP: Cys/Met metabolism PLP-dependent enzyme; InterPro: IPR000277 Pyridoxal phosphate is the active form of vitamin B6 (pyridoxine or pyridoxal) Back     alignment and domain information
>PRK07812 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK03080 phosphoserine aminotransferase; Provisional Back     alignment and domain information
>TIGR02618 tyr_phenol_ly tyrosine phenol-lyase Back     alignment and domain information
>PRK08134 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>cd01494 AAT_I Aspartate aminotransferase (AAT) superfamily (fold type I) of pyridoxal phosphate (PLP)-dependent enzymes Back     alignment and domain information
>PLN02263 serine decarboxylase Back     alignment and domain information
>PRK05367 glycine dehydrogenase; Provisional Back     alignment and domain information
>PLN02880 tyrosine decarboxylase Back     alignment and domain information
>TIGR00461 gcvP glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>PLN02590 probable tyrosine decarboxylase Back     alignment and domain information
>KOG2862 consensus Alanine-glyoxylate aminotransferase AGT1 [General function prediction only] Back     alignment and domain information
>PRK13237 tyrosine phenol-lyase; Provisional Back     alignment and domain information
>TIGR03799 NOD_PanD_pyr putative pyridoxal-dependent aspartate 1-decarboxylase Back     alignment and domain information
>PRK05355 3-phosphoserine/phosphohydroxythreonine aminotransferase; Provisional Back     alignment and domain information
>PRK12566 glycine dehydrogenase; Provisional Back     alignment and domain information
>COG1103 Archaea-specific pyridoxal phosphate-dependent enzymes [General function prediction only] Back     alignment and domain information
>TIGR01364 serC_1 phosphoserine aminotransferase Back     alignment and domain information
>COG1448 TyrB Aspartate/tyrosine/aromatic aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02724 Molybdenum cofactor sulfurase Back     alignment and domain information
>PRK05613 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>COG0626 MetC Cystathionine beta-lyases/cystathionine gamma-synthases [Amino acid transport and metabolism] Back     alignment and domain information
>PF01212 Beta_elim_lyase: Beta-eliminating lyase; InterPro: IPR001597 This domain is found in many tryptophanases (tryptophan indole-lyase, TNase), tyrosine phenol-lyases (TPL) and threonine aldolases Back     alignment and domain information
>TIGR01366 serC_3 phosphoserine aminotransferase, putative Back     alignment and domain information
>cd00611 PSAT_like Phosphoserine aminotransferase (PSAT) family Back     alignment and domain information
>COG3844 Kynureninase [Amino acid transport and metabolism] Back     alignment and domain information
>COG2873 MET17 O-acetylhomoserine sulfhydrylase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK15029 arginine decarboxylase; Provisional Back     alignment and domain information
>PRK06434 cystathionine gamma-lyase; Validated Back     alignment and domain information
>COG0076 GadB Glutamate decarboxylase and related PLP-dependent proteins [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02617 tnaA_trp_ase tryptophanase, leader peptide-associated Back     alignment and domain information
>KOG0053 consensus Cystathionine beta-lyases/cystathionine gamma-synthases [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02271 serine hydroxymethyltransferase Back     alignment and domain information
>PF01276 OKR_DC_1: Orn/Lys/Arg decarboxylase, major domain; InterPro: IPR000310 Pyridoxal-dependent decarboxylases are bacterial proteins acting on ornithine, lysine, arginine and related substrates [] Back     alignment and domain information
>KOG0258 consensus Alanine aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13578 ornithine decarboxylase; Provisional Back     alignment and domain information
>PRK15399 lysine decarboxylase LdcC; Provisional Back     alignment and domain information
>COG0112 GlyA Glycine/serine hydroxymethyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK15400 lysine decarboxylase CadA; Provisional Back     alignment and domain information
>PLN02452 phosphoserine transaminase Back     alignment and domain information
>PF00464 SHMT: Serine hydroxymethyltransferase; InterPro: IPR001085 Synonym(s): Serine hydroxymethyltransferase, Serine aldolase, Threonine aldolase Serine hydroxymethyltransferase (SHMT) is a pyridoxal phosphate (PLP) dependent enzyme and belongs to the aspartate aminotransferase superfamily (fold type I) [] Back     alignment and domain information
>PLN02414 glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>TIGR01365 serC_2 phosphoserine aminotransferase, Methanosarcina type Back     alignment and domain information
>PF12897 Aminotran_MocR: Alanine-glyoxylate amino-transferase; InterPro: IPR024551 This entry represents a family of putative aminotransferases Back     alignment and domain information
>COG1003 GcvP Glycine cleavage system protein P (pyridoxal-binding), C-terminal domain [Amino acid transport and metabolism] Back     alignment and domain information
>PF00282 Pyridoxal_deC: Pyridoxal-dependent decarboxylase conserved domain; InterPro: IPR002129 Pyridoxal phosphate is the active form of vitamin B6 (pyridoxine or pyridoxal) Back     alignment and domain information
>COG1921 SelA Selenocysteine synthase [seryl-tRNASer selenium transferase] [Amino acid transport and metabolism] Back     alignment and domain information
>COG0403 GcvP Glycine cleavage system protein P (pyridoxal-binding), N-terminal domain [Amino acid transport and metabolism] Back     alignment and domain information
>COG1982 LdcC Arginine/lysine/ornithine decarboxylases [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03811 tyr_de_CO2_Ent tyrosine decarboxylase, Enterococcus type Back     alignment and domain information
>PRK12462 phosphoserine aminotransferase; Provisional Back     alignment and domain information
>PRK05367 glycine dehydrogenase; Provisional Back     alignment and domain information
>PF06838 Met_gamma_lyase: Methionine gamma-lyase ; InterPro: IPR009651 This family represents the aluminium resistance protein, which confers resistance to aluminium in bacteria [] Back     alignment and domain information
>PF02347 GDC-P: Glycine cleavage system P-protein; InterPro: IPR020580 This family consists of glycine cleavage system P-proteins (1 Back     alignment and domain information
>PF03841 SelA: L-seryl-tRNA selenium transferase; InterPro: IPR018319 In prokaryotes, the incorporation of selenocysteine as the 21st amino acid, encoded by TGA, requires several elements: SelC is the tRNA itself, SelD acts as a donor of reduced selenium, SelA modifies a serine residue on SelC into selenocysteine, and SelB is a selenocysteine-specific translation elongation factor Back     alignment and domain information
>KOG2040 consensus Glycine dehydrogenase (decarboxylating) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0629 consensus Glutamate decarboxylase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00461 gcvP glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>KOG1412 consensus Aspartate aminotransferase/Glutamic oxaloacetic transaminase AAT2/GOT1 [Amino acid transport and metabolism] Back     alignment and domain information
>COG3033 TnaA Tryptophanase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG3846 consensus L-kynurenine hydrolase [Amino acid transport and metabolism] Back     alignment and domain information
>PF05889 SLA_LP_auto_ag: Soluble liver antigen/liver pancreas antigen (SLA/LP autoantigen); InterPro: IPR008829 This family consists of several eukaryotic and archaeal proteins which are related to the Homo sapiens soluble liver antigen/liver pancreas antigen (SLA/LP autoantigen) Back     alignment and domain information
>KOG1383 consensus Glutamate decarboxylase/sphingosine phosphate lyase [Amino acid transport and metabolism] Back     alignment and domain information
>PF04864 Alliinase_C: Allinase; InterPro: IPR006948 Allicin is a thiosulphinate that gives rise to dithiines, allyl sulphides and ajoenes, the three groups of active compounds in Allium species Back     alignment and domain information
>PRK12566 glycine dehydrogenase; Provisional Back     alignment and domain information
>KOG2467 consensus Glycine/serine hydroxymethyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1411 consensus Aspartate aminotransferase/Glutamic oxaloacetic transaminase AAT1/GOT2 [Amino acid transport and metabolism] Back     alignment and domain information
>COG4100 Cystathionine beta-lyase family protein involved in aluminum resistance [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1932 SerC Phosphoserine aminotransferase [Coenzyme metabolism / Amino acid transport and metabolism] Back     alignment and domain information
>KOG0628 consensus Aromatic-L-amino-acid/L-histidine decarboxylase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02994 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>KOG3843 consensus Predicted serine hydroxymethyltransferase SLA/LP (autoimmune hepatitis marker in humans) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2040 consensus Glycine dehydrogenase (decarboxylating) [Amino acid transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query476
2gsa_A432 Crystal Structure Of Glutamate-1-Semialdehyde Amino 1e-179
2hoy_A432 Inter-Subunit Signaling In Gsam Length = 432 1e-179
3fq7_A427 Gabaculine Complex Of Gsam Length = 427 1e-178
3fqa_A427 Gabaculien Complex Of Gabaculine Resistant Gsam Ver 1e-178
3fq8_A427 M248i Mutant Of Gsam Length = 427 1e-178
2cfb_A411 Glutamate-1-Semialdehyde 2,1-Aminomutase From Therm 1e-174
3bs8_A438 Crystal Structure Of Glutamate 1-Semialdehyde Amino 1e-134
3k28_A429 Crystal Structure Of A Glutamate-1-Semialdehyde Ami 1e-121
2e7u_A424 Crystal Structure Of Glutamate-1-Semialdehyde 2,1-A 1e-119
4e77_A429 2.0a Crystal Structure Of A Glutamate-1-Semialdehyd 1e-119
3l44_A434 Crystal Structure Of Bacillus Anthracis Heml-1, Glu 1e-106
2epj_A434 Crystal Structure Of Glutamate-1-Semialdehyde 2,1-A 2e-85
4ao9_A454 Biochemical Properties And Crystal Structure Of A N 3e-46
2yku_A465 Structural Determinants Of The Beta-Selectivity Of 5e-45
2cy8_A453 Crystal Structure Of D-Phenylglycine Aminotransfera 1e-42
1szk_A426 The Structure Of Gamma-Aminobutyrate Aminotransfera 3e-32
1szs_A426 The Structure Of Gamma-aminobutyrate Aminotransfera 4e-32
1sf2_A426 Structure Of E. Coli Gamma-Aminobutyrate Aminotrans 4e-32
1szu_A426 The Structure Of Gamma-Aminobutyrate Aminotransfera 2e-31
1vef_A395 Acetylornithine Aminotransferase From Thermus Therm 2e-30
2eh6_A375 Crystal Structure Of Acetylornithine Aminotransfera 2e-24
2pb0_A420 Structure Of Biosynthetic N-Acetylornithine Aminotr 7e-23
4adb_A406 Structural And Functional Study Of Succinyl-ornithi 2e-22
2e54_A385 Crystal Structure Of Acetylornithine Aminotransfera 2e-20
2ord_A397 Crystal Structure Of Acetylornithine Aminotransfera 2e-20
1oat_A439 Ornithine Aminotransferase Length = 439 6e-20
2can_A402 Human Ornithine Aminotransferase Complexed With L-C 1e-19
2byj_A439 Ornithine Aminotransferase Mutant Y85i Length = 439 3e-19
3r4t_A467 Crystal Structure Of 4-Aminobutyrate Aminotransfera 3e-19
1m0n_A433 Structure Of Dialkylglycine Decarboxylase Complexed 3e-19
2byl_A439 Structure Of Ornithine Aminotransferase Triple Muta 4e-19
1z3z_A431 The Crystal Structure Of A Dgd Mutant: Q52a Length 4e-19
1d7r_A433 Crystal Structure Of The Complex Of 2,2-Dialkylglyc 1e-18
1dgd_A432 An Alkali Metal Ion Size-Dependent Switch In The Ac 1e-18
3q8n_A453 Crystal Structure Of 4-Aminobutyrate Transaminase F 4e-18
4atp_A456 Structure Of Gaba-Transaminase A1r958 From Arthroba 3e-17
4ffc_A453 Crystal Structure Of A 4-Aminobutyrate Aminotransfe 5e-17
2eo5_A419 Crystal Structure Of 4-Aminobutyrate Aminotransfera 2e-16
3oks_A451 Crystal Structure Of 4-Aminobutyrate Transaminase F 1e-15
3nx3_A395 Crystal Structure Of Acetylornithine Aminotransfera 3e-15
1mgv_A429 Crystal Structure Of The R391a Mutant Of 7,8-Diamin 4e-15
3lg0_A422 Structure Of Plasmodium Falciparum Ornithine Delta- 4e-15
3ruy_A392 Crystal Structure Of The Ornithine-Oxo Acid Transam 5e-15
1z7d_A433 Ornithine Aminotransferase Py00104 From Plasmodium 9e-15
1qj3_A429 Crystal Structure Of 7,8-Diaminopelargonic Acid Syn 1e-14
1s0a_A429 Crystal Structure Of The Y17f Mutant Of 7,8- Diamin 2e-14
1dty_A429 Crystal Structure Of Adenosylmethionine-8-Amino-7-O 2e-14
1s08_A429 Crystal Structure Of The D147n Mutant Of 7,8- Diami 4e-14
3lv2_A462 Crystal Structure Of Mycobacterium Tuberculosis 7,8 4e-14
1s06_A429 Crystal Structure Of The R253k Mutant Of 7,8- Diami 5e-14
1s09_A429 Crystal Structure Of The Y144f Mutant Of 7,8- Diami 5e-14
3bv0_A437 Crystal Structure Of Plp Bound 7,8-Diaminopelargoni 5e-14
3tft_A457 Crystal Structure Of 7,8-Diaminopelargonic Acid Syn 5e-14
1s07_A429 Crystal Structure Of The R253a Mutant Of 7,8-Diamin 7e-14
2zuk_A439 The Crystal Structure Of Alpha-Amino-Epsilon-Caprol 4e-12
3dxw_A452 The Crystal Structure Of Alpha-Amino-Epsilon-Caprol 5e-12
3a8u_X449 Crystal Structure Of Omega-Amino Acid:pyruvate Amin 7e-11
4a6r_A459 Crystal Structure Of The Omega Transaminase From Ch 4e-10
3du4_A448 Crystal Structure Of 7-Keto-8-Aminopelargonic Acid 1e-09
3dod_A448 Crystal Structure Of Plp Bound 7,8-diaminopelargoni 1e-09
3i4j_A430 Crystal Structure Of Aminotransferase, Class Iii Fr 2e-09
3n5m_A452 Crystals Structure Of A Bacillus Anthracis Aminotra 9e-09
3fcr_A459 Crystal Structure Of Putative Aminotransferase (Yp_ 2e-08
3gju_A459 Crystal Structure Of A Putative Aminotransferase (M 2e-07
2jjf_A449 N328a Mutant Of M. Tuberculosis Rv3290c Length = 44 8e-07
2cin_A449 Lysine Aminotransferase From M. Tuberculosis In The 4e-06
2jjh_A449 E243 Mutant Of M. Tuberculosis Rv3290c Length = 449 6e-06
2jje_A449 Crystal Structure Of T330s Mutant Of Rv3290c From M 8e-06
3hmu_A472 Crystal Structure Of A Class Iii Aminotransferase F 1e-05
3i5t_A476 Crystal Structure Of Aminotransferase Prk07036 From 2e-05
1ohv_A472 4-aminobutyrate-aminotransferase From Pig Length = 1e-04
>pdb|2GSA|A Chain A, Crystal Structure Of Glutamate-1-Semialdehyde Aminomutase (Aminotransferase, Wild-Type Form) Length = 432 Back     alignment and structure 
Iteration: 1

 Score =  624 bits (1609), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 296/423 (69%), Positives = 345/423 (81%)
Query: 48  FTLKKSEEAFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGS 107
           F   KS+E F  A++LMPGGV+SPVRAFKSVGGQPIVFD VK ++ WD+DGN YIDYVG+
Sbjct: 6   FKTIKSDEIFAAAQKLMPGGVSSPVRAFKSVGGQPIVFDRVKDAYAWDVDGNRYIDYVGT 65
Query: 108 WGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEA 167
           WGPAI GHA  +V+ AL   M+KGTSFGAPC LENVLAEMV  AVPSIEMVRFVNSGTEA
Sbjct: 66  WGPAICGHAHPEVIEALKVAMEKGTSFGAPCALENVLAEMVNDAVPSIEMVRFVNSGTEA 125
Query: 168 CMGVLRLARAFTGRERIIKFEGCYHGHADPFLVKAGSGVATLGLPDSPGVPKGATYETLT 227
           CM VLRL RA+TGR++IIKFEGCYHGHAD FLVKAGSGVATLGLP SPGVPK  T  TLT
Sbjct: 126 CMAVLRLMRAYTGRDKIIKFEGCYHGHADMFLVKAGSGVATLGLPSSPGVPKKTTANTLT 185
Query: 228 APFNDVSALENLFENNKGEIAAIILEPVVGNSGFIAPKPDFLNAIRRITKENGALLIFDE 287
            P+ND+ A++ LF  N GEIA +ILEP+VGNSGFI P   FL  +R IT E+ ALL+FDE
Sbjct: 186 TPYNDLEAVKALFAENPGEIAGVILEPIVGNSGFIVPDAGFLEGLREITLEHDALLVFDE 245
Query: 288 VMTGFRLAYGGAQEYFGVTPDXXXXXXXXXXXXPVGAYGGRRDIMEMVAPAGPMYQAGTL 347
           VMTGFR+AYGG QE FGVTPD            PVGAYGG+R+IM++VAPAGPMYQAGTL
Sbjct: 246 VMTGFRIAYGGVQEKFGVTPDLTTLGKIIGGGLPVGAYGGKREIMQLVAPAGPMYQAGTL 305
Query: 348 SGNPLAMTAGIHTLKRLKEPGTYEYLNKITGELTQGIIDAGKKAGHAICGGYISGMFGFF 407
           SGNPLAMTAGI TL+ L++PGTYEYL++IT  L+ G++   ++ GHA CGG +SGMFGFF
Sbjct: 306 SGNPLAMTAGIKTLELLRQPGTYEYLDQITKRLSDGLLAIAQETGHAACGGQVSGMFGFF 365
Query: 408 FTEGPVYNFEDAKKSETTKFARFYRGMLEEGVYFAPSQFEAGFTSLAHSSDDIQHTITAA 467
           FTEGPV+N+EDAKKS+  KF+RF+RGMLE+G+Y APSQFEAGFTSLAH+ +DI  T+ AA
Sbjct: 366 FTEGPVHNYEDAKKSDLQKFSRFHRGMLEQGIYLAPSQFEAGFTSLAHTEEDIDATLAAA 425
Query: 468 EKV 470
             V
Sbjct: 426 RTV 428
>pdb|2HOY|A Chain A, Inter-Subunit Signaling In Gsam Length = 432 Back     alignment and structure
>pdb|3FQ7|A Chain A, Gabaculine Complex Of Gsam Length = 427 Back     alignment and structure
>pdb|3FQA|A Chain A, Gabaculien Complex Of Gabaculine Resistant Gsam Version Length = 427 Back     alignment and structure
>pdb|3FQ8|A Chain A, M248i Mutant Of Gsam Length = 427 Back     alignment and structure
>pdb|2CFB|A Chain A, Glutamate-1-Semialdehyde 2,1-Aminomutase From Thermosynechococcus Elongatus Length = 411 Back     alignment and structure
>pdb|3BS8|A Chain A, Crystal Structure Of Glutamate 1-Semialdehyde Aminotransferase Complexed With Pyridoxamine-5'-Phosphate From Bacillus Subtilis Length = 438 Back     alignment and structure
>pdb|3K28|A Chain A, Crystal Structure Of A Glutamate-1-Semialdehyde Aminotransferase From Bacillus Anthracis With Bound Pyridoxal 5'phosphate Length = 429 Back     alignment and structure
>pdb|2E7U|A Chain A, Crystal Structure Of Glutamate-1-Semialdehyde 2,1-Aminomutase From Thermus Thermophilus Hb8 Length = 424 Back     alignment and structure
>pdb|4E77|A Chain A, 2.0a Crystal Structure Of A Glutamate-1-Semialdehyde Aminotransferase From Yersinia Pestis Co92 Length = 429 Back     alignment and structure
>pdb|3L44|A Chain A, Crystal Structure Of Bacillus Anthracis Heml-1, Glutamate Semialdehyde Aminotransferase Length = 434 Back     alignment and structure
>pdb|2EPJ|A Chain A, Crystal Structure Of Glutamate-1-Semialdehyde 2,1-Aminomutase From Aeropyrum Pernix Length = 434 Back     alignment and structure
>pdb|4AO9|A Chain A, Biochemical Properties And Crystal Structure Of A Novel Beta-phenylalanine Aminotransferase From Variovorax Paradoxus Length = 454 Back     alignment and structure
>pdb|2YKU|A Chain A, Structural Determinants Of The Beta-Selectivity Of A Bacterial Aminotransferase Length = 465 Back     alignment and structure
>pdb|2CY8|A Chain A, Crystal Structure Of D-Phenylglycine Aminotransferase (D-Phgat) From Pseudomonas Strutzeri St-201 Length = 453 Back     alignment and structure
>pdb|1SZK|A Chain A, The Structure Of Gamma-Aminobutyrate Aminotransferase Mutant: E211s Length = 426 Back     alignment and structure
>pdb|1SZS|A Chain A, The Structure Of Gamma-aminobutyrate Aminotransferase Mutant: I50q Length = 426 Back     alignment and structure
>pdb|1SF2|A Chain A, Structure Of E. Coli Gamma-Aminobutyrate Aminotransferase Length = 426 Back     alignment and structure
>pdb|1SZU|A Chain A, The Structure Of Gamma-Aminobutyrate Aminotransferase Mutant: V241a Length = 426 Back     alignment and structure
>pdb|1VEF|A Chain A, Acetylornithine Aminotransferase From Thermus Thermophilus Hb8 Length = 395 Back     alignment and structure
>pdb|2EH6|A Chain A, Crystal Structure Of Acetylornithine Aminotransferase From Aquifex Aeolicus Vf5 Length = 375 Back     alignment and structure
>pdb|2PB0|A Chain A, Structure Of Biosynthetic N-Acetylornithine Aminotransferase From Salmonella Typhimurium: Studies On Substrate Specificity And Inhibitor Binding Length = 420 Back     alignment and structure
>pdb|4ADB|A Chain A, Structural And Functional Study Of Succinyl-ornithine Transaminase From E. Coli Length = 406 Back     alignment and structure
>pdb|2E54|A Chain A, Crystal Structure Of Acetylornithine Aminotransferase From Thermotoga Maritima Length = 385 Back     alignment and structure
>pdb|2ORD|A Chain A, Crystal Structure Of Acetylornithine Aminotransferase (Ec 2.6.1.11) (Acoat) (Tm1785) From Thermotoga Maritima At 1.40 A Resolution Length = 397 Back     alignment and structure
>pdb|1OAT|A Chain A, Ornithine Aminotransferase Length = 439 Back     alignment and structure
>pdb|2CAN|A Chain A, Human Ornithine Aminotransferase Complexed With L-Canaline Length = 402 Back     alignment and structure
>pdb|2BYJ|A Chain A, Ornithine Aminotransferase Mutant Y85i Length = 439 Back     alignment and structure
>pdb|3R4T|A Chain A, Crystal Structure Of 4-Aminobutyrate Aminotransferase Gabt From Mycobacterium Marinum Covalently Bound To Pyridoxal Phosphate Length = 467 Back     alignment and structure
>pdb|1M0N|A Chain A, Structure Of Dialkylglycine Decarboxylase Complexed With 1- Aminocyclopentanephosphonate Length = 433 Back     alignment and structure
>pdb|2BYL|A Chain A, Structure Of Ornithine Aminotransferase Triple Mutant Y85i Y55a G320f Length = 439 Back     alignment and structure
>pdb|1Z3Z|A Chain A, The Crystal Structure Of A Dgd Mutant: Q52a Length = 431 Back     alignment and structure
>pdb|1D7R|A Chain A, Crystal Structure Of The Complex Of 2,2-Dialkylglycine Decarboxylase With 5pa Length = 433 Back     alignment and structure
>pdb|1DGD|A Chain A, An Alkali Metal Ion Size-Dependent Switch In The Active Site Structure Of Dialkylglycine Decarboxylase Length = 432 Back     alignment and structure
>pdb|3Q8N|A Chain A, Crystal Structure Of 4-Aminobutyrate Transaminase From Mycobacterium Smegmatis Length = 453 Back     alignment and structure
>pdb|4ATP|A Chain A, Structure Of Gaba-Transaminase A1r958 From Arthrobacter Aurescens In Complex With Plp Length = 456 Back     alignment and structure
>pdb|4FFC|A Chain A, Crystal Structure Of A 4-Aminobutyrate Aminotransferase (Gabt) From Mycobacterium Abscessus Length = 453 Back     alignment and structure
>pdb|2EO5|A Chain A, Crystal Structure Of 4-Aminobutyrate Aminotransferase From Sulfolobus Tokodaii Strain7 Length = 419 Back     alignment and structure
>pdb|3OKS|A Chain A, Crystal Structure Of 4-Aminobutyrate Transaminase From Mycobacterium Smegmatis Length = 451 Back     alignment and structure
>pdb|3NX3|A Chain A, Crystal Structure Of Acetylornithine Aminotransferase (Argd) From Campylobacter Jejuni Length = 395 Back     alignment and structure
>pdb|1MGV|A Chain A, Crystal Structure Of The R391a Mutant Of 7,8-Diaminopelargonic Acid Synthase Length = 429 Back     alignment and structure
>pdb|3LG0|A Chain A, Structure Of Plasmodium Falciparum Ornithine Delta-Aminotransferase Length = 422 Back     alignment and structure
>pdb|3RUY|A Chain A, Crystal Structure Of The Ornithine-Oxo Acid Transaminase Rocd From Bacillus Anthracis Length = 392 Back     alignment and structure
>pdb|1Z7D|A Chain A, Ornithine Aminotransferase Py00104 From Plasmodium Yoelii Length = 433 Back     alignment and structure
>pdb|1QJ3|A Chain A, Crystal Structure Of 7,8-Diaminopelargonic Acid Synthase In Complex With 7-Keto-8-Aminopelargonic Acid Length = 429 Back     alignment and structure
>pdb|1S0A|A Chain A, Crystal Structure Of The Y17f Mutant Of 7,8- Diaminopelargonic Acid Synthase Length = 429 Back     alignment and structure
>pdb|1DTY|A Chain A, Crystal Structure Of Adenosylmethionine-8-Amino-7-Oxonanoate Aminotransferase With Pyridoxal Phosphate Cofactor. Length = 429 Back     alignment and structure
>pdb|1S08|A Chain A, Crystal Structure Of The D147n Mutant Of 7,8- Diaminopelargonic Acid Synthase Length = 429 Back     alignment and structure
>pdb|3LV2|A Chain A, Crystal Structure Of Mycobacterium Tuberculosis 7,8-Diaminopelargonic Acid Synthase In Complex With Substrate Analog Sinefungin Length = 462 Back     alignment and structure
>pdb|1S06|A Chain A, Crystal Structure Of The R253k Mutant Of 7,8- Diaminopelargonic Acid Synthase Length = 429 Back     alignment and structure
>pdb|1S09|A Chain A, Crystal Structure Of The Y144f Mutant Of 7,8- Diaminopelargonic Acid Synthase Length = 429 Back     alignment and structure
>pdb|3BV0|A Chain A, Crystal Structure Of Plp Bound 7,8-Diaminopelargonic Acid Synthase In Mycobacterium Tuberculosis Length = 437 Back     alignment and structure
>pdb|3TFT|A Chain A, Crystal Structure Of 7,8-Diaminopelargonic Acid Synthase (Bioa) From Mycobacterium Tuberculosis, Pre-Reaction Complex With A 3,6- Dihydropyrid-2-One Heterocycle Inhibitor Length = 457 Back     alignment and structure
>pdb|1S07|A Chain A, Crystal Structure Of The R253a Mutant Of 7,8-Diaminopelargonic Acid Synthase Length = 429 Back     alignment and structure
>pdb|2ZUK|A Chain A, The Crystal Structure Of Alpha-Amino-Epsilon-Caprolactam Racemase From Achromobacter Obae Complexed With Epsilon Caprolactam (Different Binding Mode) Length = 439 Back     alignment and structure
>pdb|3DXW|A Chain A, The Crystal Structure Of Alpha-Amino-Epsilon-Caprolactam Racemase From Achromobacter Obae Complexed With Epsilon Caprolactam Length = 452 Back     alignment and structure
>pdb|3A8U|X Chain X, Crystal Structure Of Omega-Amino Acid:pyruvate Aminotransferase Length = 449 Back     alignment and structure
>pdb|4A6R|A Chain A, Crystal Structure Of The Omega Transaminase From Chromobacterium Violaceum In The Apo Form, Crystallised From Polyacrylic Acid Length = 459 Back     alignment and structure
>pdb|3DU4|A Chain A, Crystal Structure Of 7-Keto-8-Aminopelargonic Acid Bound 7,8- Diaminopelargonic Acid Synthase In Bacillus Subtilis Length = 448 Back     alignment and structure
>pdb|3DOD|A Chain A, Crystal Structure Of Plp Bound 7,8-diaminopelargonic Acid Synthase In Bacillus Subtilis Length = 448 Back     alignment and structure
>pdb|3I4J|A Chain A, Crystal Structure Of Aminotransferase, Class Iii From Deinococcus Radiodurans Length = 430 Back     alignment and structure
>pdb|3N5M|A Chain A, Crystals Structure Of A Bacillus Anthracis Aminotransferase Length = 452 Back     alignment and structure
>pdb|2JJF|A Chain A, N328a Mutant Of M. Tuberculosis Rv3290c Length = 449 Back     alignment and structure
>pdb|2CIN|A Chain A, Lysine Aminotransferase From M. Tuberculosis In The Internal Aldimine Form Length = 449 Back     alignment and structure
>pdb|2JJH|A Chain A, E243 Mutant Of M. Tuberculosis Rv3290c Length = 449 Back     alignment and structure
>pdb|2JJE|A Chain A, Crystal Structure Of T330s Mutant Of Rv3290c From M. Tuberculosis Length = 449 Back     alignment and structure
>pdb|3HMU|A Chain A, Crystal Structure Of A Class Iii Aminotransferase From Silicibacter Pomeroyi Length = 472 Back     alignment and structure
>pdb|3I5T|A Chain A, Crystal Structure Of Aminotransferase Prk07036 From Rhodobacter Sphaeroides Kd131 Length = 476 Back     alignment and structure
>pdb|1OHV|A Chain A, 4-aminobutyrate-aminotransferase From Pig Length = 472 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query476
3fq8_A427 Glutamate-1-semialdehyde 2,1-aminomutase; drug res 0.0
4e77_A429 Glutamate-1-semialdehyde 2,1-aminomutase; structur 0.0
3l44_A434 Glutamate-1-semialdehyde 2,1-aminomutase 1; alpha 0.0
3k28_A429 Glutamate-1-semialdehyde 2,1-aminomutase 2; biosyn 0.0
2e7u_A424 Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzy 0.0
2epj_A434 Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzy 0.0
2cy8_A453 D-phgat, D-phenylglycine aminotransferase; structu 0.0
2yky_A465 Beta-transaminase; transferase; HET: PLP SFE; 1.69 0.0
1sff_A426 4-aminobutyrate aminotransferase; enzyme complexes 2e-67
3oks_A451 4-aminobutyrate transaminase; ssgcid, transferase, 1e-66
1zod_A433 DGD, 2,2-dialkylglycine decarboxylase; pyridoxal, 2e-66
4ffc_A453 4-aminobutyrate aminotransferase (GABT); structura 3e-66
3dxv_A439 Alpha-amino-epsilon-caprolactam racemase; fold-TYP 4e-64
1vef_A395 Acetylornithine/acetyl-lysine aminotransferase; PL 6e-59
2eo5_A419 419AA long hypothetical aminotransferase; PLP enzy 7e-57
3ruy_A392 Ornithine aminotransferase; structural genomics, c 7e-54
2oat_A439 Ornithine aminotransferase; 5-fluoromethylornithin 4e-53
1z7d_A433 Ornithine aminotransferase; structural genomics co 8e-53
2eh6_A375 Acoat, acetylornithine aminotransferase; ARGD, str 6e-52
2ord_A397 Acoat, acetylornithine aminotransferase; TM1785, a 2e-51
3nx3_A395 Acoat, acetylornithine aminotransferase; csgid, st 3e-51
2pb2_A420 Acetylornithine/succinyldiaminopimelate aminotran; 3e-51
2cjg_A449 L-lysine-epsilon aminotransferase; internal aldimi 6e-48
1ohv_A472 4-aminobutyrate aminotransferase; PLP-dependent en 4e-47
3n5m_A452 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 3e-44
3dod_A448 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 2e-41
3i4j_A430 Aminotransferase, class III; structural GENOMICS,N 3e-41
3gju_A460 Putative aminotransferase; pyridoxal phosphate, PL 3e-39
4a6r_A459 Omega transaminase; transferase, PLP-binding enzym 8e-39
3a8u_X449 Omega-amino acid--pyruvate aminotransferase; large 9e-39
3nui_A478 Pyruvate transaminase; amino transferase, transfer 5e-38
1s0a_A429 Adenosylmethionine-8-amino-7-oxononanoate aminotra 1e-37
3tfu_A457 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 3e-37
3hmu_A472 Aminotransferase, class III; structural genomics, 2e-36
3i5t_A476 Aminotransferase; pyridoxal 5'-phosphate, PSI-2, N 3e-34
4a0g_A831 Adenosylmethionine-8-amino-7-oxononanoate aminotra 1e-33
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-05
1bs0_A384 Protein (8-amino-7-oxonanoate synthase); PLP-depen 1e-06
3kki_A409 CAI-1 autoinducer synthase; quorum sensing, CQSA, 1e-06
2bwn_A401 5-aminolevulinate synthase; tetrapyrrole biosynthe 1e-06
2w8t_A427 SPT, serine palmitoyltransferase; HET: LLP; 1.25A 2e-06
3a2b_A398 Serine palmitoyltransferase; vitamin B6-dependent 3e-06
3tqx_A399 2-amino-3-ketobutyrate coenzyme A ligase; energy m 3e-05
1ax4_A467 Tryptophanase; tryptophan biosynthesis, tryptophan 4e-05
>3fq8_A Glutamate-1-semialdehyde 2,1-aminomutase; drug resistance, microev0lution, integrated approach, chlorophyll biosynthesis; HET: PMP; 2.00A {Synechococcus elongatus pcc 6301} PDB: 2hp1_A* 2hoz_A* 2hoy_A* 2hp2_A* 3fq7_A* 2gsa_A* 3gsb_A* 4gsa_A* 3fqa_A* 2cfb_A* Length = 427 Back     alignment and structure
 Score =  807 bits (2086), Expect = 0.0
 Identities = 306/423 (72%), Positives = 357/423 (84%)

Query: 48  FTLKKSEEAFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGS 107
           F   KS+E F  A++LMPGGV+SPVRAFKSVGGQPIVFD VK ++ WD+DGN YIDYVG+
Sbjct: 1   FKTIKSDEIFAAAQKLMPGGVSSPVRAFKSVGGQPIVFDRVKDAYAWDVDGNRYIDYVGT 60

Query: 108 WGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEA 167
           WGPAI GHA  +V+ AL   M+KGTSFGAPC LENVLAEMV  AVPSIEMVRFVNSGTEA
Sbjct: 61  WGPAICGHAHPEVIEALKVAMEKGTSFGAPCALENVLAEMVNDAVPSIEMVRFVNSGTEA 120

Query: 168 CMGVLRLARAFTGRERIIKFEGCYHGHADPFLVKAGSGVATLGLPDSPGVPKGATYETLT 227
           CM VLR+ RA+TGR++IIKFEGCYHGHAD FLVKAGSGVATLGLP SPGVPK  T  TLT
Sbjct: 121 CMAVLRIMRAYTGRDKIIKFEGCYHGHADMFLVKAGSGVATLGLPSSPGVPKKTTANTLT 180

Query: 228 APFNDVSALENLFENNKGEIAAIILEPVVGNSGFIAPKPDFLNAIRRITKENGALLIFDE 287
            P+ND+ A++ LF  N GEIA +ILEP+VGNSGFI P   FL  +R IT E+ ALL+FDE
Sbjct: 181 TPYNDLEAVKALFAENPGEIAGVILEPIVGNSGFIVPDAGFLEGLREITLEHDALLVFDE 240

Query: 288 VMTGFRLAYGGAQEYFGVTPDLTTLGKIIGGGLPVGAYGGRRDIMEMVAPAGPMYQAGTL 347
           V+TGFR+AYGG QE FGVTPDLTTLGKIIGGGLPVGAYGG+R+IM++VAPAGPMYQAGTL
Sbjct: 241 VITGFRIAYGGVQEKFGVTPDLTTLGKIIGGGLPVGAYGGKREIMQLVAPAGPMYQAGTL 300

Query: 348 SGNPLAMTAGIHTLKRLKEPGTYEYLNKITGELTQGIIDAGKKAGHAICGGYISGMFGFF 407
           SGNPLAMTAGI TL+ L++PGTYEYL++IT  L+ G++   ++ GHA CGG +SGMFGFF
Sbjct: 301 SGNPLAMTAGIKTLELLRQPGTYEYLDQITKRLSDGLLAIAQETGHAACGGQVSGMFGFF 360

Query: 408 FTEGPVYNFEDAKKSETTKFARFYRGMLEEGVYFAPSQFEAGFTSLAHSSDDIQHTITAA 467
           FTEGPV+N+EDAKKS+  KF+RF+RGMLE+G+Y APSQFEAGFTSLAH+ +DI  T+ AA
Sbjct: 361 FTEGPVHNYEDAKKSDLQKFSRFHRGMLEQGIYLAPSQFEAGFTSLAHTEEDIDATLAAA 420

Query: 468 EKV 470
             V
Sbjct: 421 RTV 423
>4e77_A Glutamate-1-semialdehyde 2,1-aminomutase; structural genomics, center for structural genomics of infec diseases, csgid, porphyrin biosynthesis; 2.00A {Yersinia pestis} Length = 429 Back     alignment and structure
>3l44_A Glutamate-1-semialdehyde 2,1-aminomutase 1; alpha beta class, PLP-dependent transferase-like, bacillus A csgid, porphyrin biosynthesis; HET: LLP; 2.05A {Bacillus anthracis} Length = 434 Back     alignment and structure
>3k28_A Glutamate-1-semialdehyde 2,1-aminomutase 2; biosynthesis of cofactors, prosthetic groups, and carriers, csgid, cytoplasm, isomerase; HET: MSE PLP; 1.95A {Bacillus anthracis str} PDB: 3bs8_A* Length = 429 Back     alignment and structure
>2e7u_A Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzyme, GSA, structural genomics, NPPSFA; HET: PMP; 1.90A {Thermus thermophilus} Length = 424 Back     alignment and structure
>2epj_A Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzyme, GSA, structural genomics, NPPSFA; HET: PMP; 1.70A {Aeropyrum pernix} PDB: 2zsl_A* 2zsm_A* Length = 434 Back     alignment and structure
>2cy8_A D-phgat, D-phenylglycine aminotransferase; structural genomics, NPPSFA, national PROJ protein structural and functional analyses; 2.30A {Pseudomonas stutzeri} Length = 453 Back     alignment and structure
>2yky_A Beta-transaminase; transferase; HET: PLP SFE; 1.69A {Mesorhizobium SP} PDB: 2ykv_A* 2yku_A* 2ykx_A* Length = 465 Back     alignment and structure
>1sff_A 4-aminobutyrate aminotransferase; enzyme complexes; HET: IK2; 1.90A {Escherichia coli} SCOP: c.67.1.4 PDB: 1sf2_A* 1szk_A* 1szu_A* 1szs_A* Length = 426 Back     alignment and structure
>3oks_A 4-aminobutyrate transaminase; ssgcid, transferase, seattle structural genomics center for infectious disease; HET: LLP; 1.80A {Mycobacterium smegmatis} PDB: 3r4t_A* 3q8n_A Length = 451 Back     alignment and structure
>1zod_A DGD, 2,2-dialkylglycine decarboxylase; pyridoxal, cesium, lyase; HET: MES PLP; 1.80A {Burkholderia cepacia} SCOP: c.67.1.4 PDB: 1dka_A* 1m0o_A* 1m0p_A* 1m0n_A* 1zc9_A* 1zob_A* 1m0q_A* 2dkb_A* 1dgd_A* 1dge_A* 1d7u_A* 1d7s_A* 1d7r_A* 1d7v_A* 1z3z_A* Length = 433 Back     alignment and structure
>4ffc_A 4-aminobutyrate aminotransferase (GABT); structural genomics, niaid, national institute of allergy AN infectious diseases; HET: LLP; 1.80A {Mycobacterium abscessus} Length = 453 Back     alignment and structure
>3dxv_A Alpha-amino-epsilon-caprolactam racemase; fold-TYPE1, pyridoxal-5'-phosphate dependent racemase, pyrid phosphate, isomerase; HET: PLP; 2.21A {Achromobacter obae} PDB: 2zuk_A* 3dxw_A* Length = 439 Back     alignment and structure
>1vef_A Acetylornithine/acetyl-lysine aminotransferase; PLP, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: PLP; 1.35A {Thermus thermophilus} SCOP: c.67.1.4 PDB: 1wkg_A* 1wkh_A* Length = 395 Back     alignment and structure
>2eo5_A 419AA long hypothetical aminotransferase; PLP enzyme, structural genomics, NPPSFA, N project on protein structural and functional analyses; HET: PLP; 1.90A {Sulfolobus tokodaii} Length = 419 Back     alignment and structure
>3ruy_A Ornithine aminotransferase; structural genomics, csgid, center for structural genomics O infectious diseases, alpha and beta protein; HET: LLP; 2.65A {Bacillus anthracis} Length = 392 Back     alignment and structure
>2oat_A Ornithine aminotransferase; 5-fluoromethylornithine, PLP-dependent ENZ pyridoxal phosphate; HET: PFM; 1.95A {Homo sapiens} SCOP: c.67.1.4 PDB: 1oat_A* 2byj_A* 2byl_A* 1gbn_A* 2can_A* Length = 439 Back     alignment and structure
>1z7d_A Ornithine aminotransferase; structural genomics consortium, SGC, malaria; 2.10A {Plasmodium yoelii yoelii} SCOP: c.67.1.4 PDB: 3lg0_A 3ntj_A Length = 433 Back     alignment and structure
>2eh6_A Acoat, acetylornithine aminotransferase; ARGD, structural genomics, NPPSFA, national project on prote structural and functional analyses; HET: PLP; 1.90A {Aquifex aeolicus} Length = 375 Back     alignment and structure
>2ord_A Acoat, acetylornithine aminotransferase; TM1785, acetylornithine aminotransferase (EC 2.6.1.11) (ACOA structural genomics; HET: MSE PLP; 1.40A {Thermotoga maritima MSB8} PDB: 2e54_A* Length = 397 Back     alignment and structure
>3nx3_A Acoat, acetylornithine aminotransferase; csgid, structural genomics, center for structural genomics O infectious diseases; 1.80A {Campylobacter jejuni subsp} Length = 395 Back     alignment and structure
>2pb2_A Acetylornithine/succinyldiaminopimelate aminotran; ARGD, pyridoxal 5'-phosphate, arginine metabolism, lysine biosynthesis, gabaculine; HET: PLP; 1.91A {Salmonella typhimurium} PDB: 2pb0_A* Length = 420 Back     alignment and structure
>2cjg_A L-lysine-epsilon aminotransferase; internal aldimine, pyridoxal phosphate, PLP, RV3290C, lysine amino transferase; HET: PMP; 1.95A {Mycobacterium tuberculosis} PDB: 2cjd_A* 2cin_A* 2cjh_A* 2jjg_A* 2jje_A* 2jjh_A* 2jjf_A Length = 449 Back     alignment and structure
>1ohv_A 4-aminobutyrate aminotransferase; PLP-dependent enzyme, 4- AMIN acid, antiepileptic drug target; HET: PLP; 2.3A {Sus scrofa} SCOP: c.67.1.4 PDB: 1ohw_A* 1ohy_A* Length = 472 Back     alignment and structure
>3n5m_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; aminotransferase, csgid; 2.05A {Bacillus anthracis} Length = 452 Back     alignment and structure
>3dod_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; aminotransferase, biotin biosynthesis, pyridoxal phosphate, adenosyl-L-methionine; HET: PLP; 1.90A {Bacillus subtilis} PDB: 3drd_A 3du4_A* Length = 448 Back     alignment and structure
>3i4j_A Aminotransferase, class III; structural GENOMICS,NYSGXRC, target 11246C, pyridoxal phosphate, PSI-2, protein structure initiative; 1.70A {Deinococcus radiodurans} Length = 430 Back     alignment and structure
>3gju_A Putative aminotransferase; pyridoxal phosphate, PLP-dependent transferase-like fold, ST genomics, joint center for structural genomics, JCSG; HET: MSE LLP PLP; 1.55A {Mesorhizobium loti} PDB: 3fcr_A* Length = 460 Back     alignment and structure
>4a6r_A Omega transaminase; transferase, PLP-binding enzyme, transaminase fold type I; HET: TA8; 1.35A {Chromobacterium violaceum} PDB: 4a6t_A* 4a6u_A 4a72_A* 4ah3_A* Length = 459 Back     alignment and structure
>3a8u_X Omega-amino acid--pyruvate aminotransferase; large pleated sheet, transaminase, pyridox phosphate; HET: PLP; 1.40A {Pseudomonas putida} Length = 449 Back     alignment and structure
>3nui_A Pyruvate transaminase; amino transferase, transferase; 2.00A {Vibrio fluvialis} Length = 478 Back     alignment and structure
>1s0a_A Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; fold type I, subclass II, homodimer; HET: LLP; 1.71A {Escherichia coli} SCOP: c.67.1.4 PDB: 1qj5_A* 1mlz_A* 1qj3_A* 1mly_A* 1s06_A* 1s08_A* 1s09_A* 1s07_A* 1mgv_A* 1dty_A* Length = 429 Back     alignment and structure
>3tfu_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; transferase, transferase-transferase inhibitor complex; HET: PL8; 1.94A {Mycobacterium tuberculosis} PDB: 3tft_A* 3bv0_A* 3lv2_A* Length = 457 Back     alignment and structure
>3hmu_A Aminotransferase, class III; structural genomics, pyridoxal phosphate, PSI-2, protein structure initiative; 2.10A {Silicibacter pomeroyi} Length = 472 Back     alignment and structure
>3i5t_A Aminotransferase; pyridoxal 5'-phosphate, PSI-2, NYSGXRC, ST genomics, protein structure initiative; HET: PLP; 2.00A {Rhodobacter sphaeroides 2} Length = 476 Back     alignment and structure
>4a0g_A Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; BIO3-BIO1, biotin synthesis; HET: PLP; 2.50A {Arabidopsis thaliana} PDB: 4a0h_A* 4a0r_A* 4a0f_A* Length = 831 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1bs0_A Protein (8-amino-7-oxonanoate synthase); PLP-dependent acyl-COA synthase, biotin biosynthesis, 8-AMIN oxonanoate synthase; 1.65A {Escherichia coli} SCOP: c.67.1.4 PDB: 2g6w_A* 1dje_A* 1dj9_A* Length = 384 Back     alignment and structure
>3kki_A CAI-1 autoinducer synthase; quorum sensing, CQSA, P virulence, acyltransferase, aminotransferase, pyridoxal PHO transferase; HET: PLP; 1.80A {Vibrio cholerae} PDB: 3hqt_A* 2wk9_A* 2wk8_A* 2wka_A* 2wk7_A Length = 409 Back     alignment and structure
>2bwn_A 5-aminolevulinate synthase; tetrapyrrole biosynthesis, heme biosynthesis, pyridoxal PHOS dependent, transferase, acyltransferase; HET: LLP; 2.1A {Rhodobacter capsulatus} SCOP: c.67.1.4 PDB: 2bwo_A* 2bwp_A* Length = 401 Back     alignment and structure
>2w8t_A SPT, serine palmitoyltransferase; HET: LLP; 1.25A {Sphingomonas paucimobilis} PDB: 2w8u_A* 2w8w_A* 2xbn_A* 2w8j_A* 2w8v_A* 2jg2_A* 2jgt_A 2x8u_A* Length = 427 Back     alignment and structure
>3a2b_A Serine palmitoyltransferase; vitamin B6-dependent enzyme fold type I, acyltransferase, PY phosphate; HET: PLP; 2.30A {Sphingobacterium multivorum} Length = 398 Back     alignment and structure
>3tqx_A 2-amino-3-ketobutyrate coenzyme A ligase; energy metabolism, transferase; HET: PLP; 2.30A {Coxiella burnetii} Length = 399 Back     alignment and structure
>1ax4_A Tryptophanase; tryptophan biosynthesis, tryptophan indole-lyase, pyridoxal 5'-phosphate, monovalent cation binding site; HET: LLP; 2.10A {Proteus vulgaris} SCOP: c.67.1.2 Length = 467 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query476
4ao9_A454 Beta-phenylalanine aminotransferase; HET: PLP; 1.5 100.0
4atq_A456 4-aminobutyrate transaminase; transferase; HET: PL 100.0
4e3q_A473 Pyruvate transaminase; aminotransferase, transfera 100.0
3l44_A434 Glutamate-1-semialdehyde 2,1-aminomutase 1; alpha 100.0
3k28_A429 Glutamate-1-semialdehyde 2,1-aminomutase 2; biosyn 100.0
4e77_A429 Glutamate-1-semialdehyde 2,1-aminomutase; structur 100.0
3fq8_A427 Glutamate-1-semialdehyde 2,1-aminomutase; drug res 100.0
2yky_A465 Beta-transaminase; transferase; HET: PLP SFE; 1.69 100.0
2e7u_A424 Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzy 100.0
2epj_A434 Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzy 100.0
4ffc_A453 4-aminobutyrate aminotransferase (GABT); structura 100.0
3oks_A451 4-aminobutyrate transaminase; ssgcid, transferase, 100.0
3hmu_A472 Aminotransferase, class III; structural genomics, 100.0
3i5t_A476 Aminotransferase; pyridoxal 5'-phosphate, PSI-2, N 100.0
3n5m_A452 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 100.0
3tfu_A457 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 100.0
2cy8_A453 D-phgat, D-phenylglycine aminotransferase; structu 100.0
3gju_A460 Putative aminotransferase; pyridoxal phosphate, PL 100.0
3dod_A448 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 100.0
4a6r_A459 Omega transaminase; transferase, PLP-binding enzym 100.0
4a0g_A831 Adenosylmethionine-8-amino-7-oxononanoate aminotra 100.0
1z7d_A433 Ornithine aminotransferase; structural genomics co 100.0
2oat_A439 Ornithine aminotransferase; 5-fluoromethylornithin 100.0
3dxv_A439 Alpha-amino-epsilon-caprolactam racemase; fold-TYP 100.0
1zod_A433 DGD, 2,2-dialkylglycine decarboxylase; pyridoxal, 100.0
3nx3_A395 Acoat, acetylornithine aminotransferase; csgid, st 100.0
3i4j_A430 Aminotransferase, class III; structural GENOMICS,N 100.0
1ohv_A472 4-aminobutyrate aminotransferase; PLP-dependent en 100.0
2pb2_A420 Acetylornithine/succinyldiaminopimelate aminotran; 100.0
2cjg_A449 L-lysine-epsilon aminotransferase; internal aldimi 100.0
3a8u_X449 Omega-amino acid--pyruvate aminotransferase; large 100.0
2eo5_A419 419AA long hypothetical aminotransferase; PLP enzy 100.0
4adb_A406 Succinylornithine transaminase; transferase, PLP e 100.0
1sff_A426 4-aminobutyrate aminotransferase; enzyme complexes 100.0
3ruy_A392 Ornithine aminotransferase; structural genomics, c 100.0
1s0a_A429 Adenosylmethionine-8-amino-7-oxononanoate aminotra 100.0
2ord_A397 Acoat, acetylornithine aminotransferase; TM1785, a 100.0
1vef_A395 Acetylornithine/acetyl-lysine aminotransferase; PL 100.0
2eh6_A375 Acoat, acetylornithine aminotransferase; ARGD, str 100.0
2w8t_A427 SPT, serine palmitoyltransferase; HET: LLP; 1.25A 100.0
3l8a_A421 METC, putative aminotransferase, probable beta-cys 100.0
3tqx_A399 2-amino-3-ketobutyrate coenzyme A ligase; energy m 100.0
1fc4_A401 2-amino-3-ketobutyrate conenzyme A ligase; 2-amino 100.0
3dzz_A391 Putative pyridoxal 5'-phosphate-dependent C-S LYA; 100.0
3fdb_A377 Beta C-S lyase, putative PLP-dependent beta-cystat 100.0
3a2b_A398 Serine palmitoyltransferase; vitamin B6-dependent 100.0
3kki_A409 CAI-1 autoinducer synthase; quorum sensing, CQSA, 100.0
1bs0_A384 Protein (8-amino-7-oxonanoate synthase); PLP-depen 100.0
3kax_A383 Aminotransferase, classes I and II; PLP, C-S lyase 100.0
1d2f_A390 MALY protein; aminotransferase fold, large PLP-bin 100.0
4dq6_A391 Putative pyridoxal phosphate-dependent transferas; 100.0
1c7n_A399 Cystalysin; transferase, aminotransferase, pyridox 100.0
3ftb_A361 Histidinol-phosphate aminotransferase; structural 100.0
1yiz_A429 Kynurenine aminotransferase; glutamine transaminas 100.0
3jtx_A396 Aminotransferase; NP_283882.1, structural genomics 100.0
3ly1_A354 Putative histidinol-phosphate aminotransferase; st 99.98
3nra_A407 Aspartate aminotransferase; structural genomics, j 99.98
2zc0_A407 Alanine glyoxylate transaminase; alanine:glyoxylat 99.98
3euc_A367 Histidinol-phosphate aminotransferase 2; YP_297314 99.98
3h14_A391 Aminotransferase, classes I and II; YP_167802.1, S 99.98
3b1d_A392 Betac-S lyase; HET: PLP PLS EPE; 1.66A {Streptococ 99.96
2z61_A370 Probable aspartate aminotransferase 2; amino acid 99.98
2dou_A376 Probable N-succinyldiaminopimelate aminotransfera; 99.98
3b46_A447 Aminotransferase BNA3; kynurenine aminotransferase 99.98
3ezs_A376 Aminotransferase ASPB; NP_207418.1, structural gen 99.97
1j32_A388 Aspartate aminotransferase; HET: PLP; 2.10A {Phorm 99.97
3aow_A448 Putative uncharacterized protein PH0207; protein-P 99.97
2x5d_A412 Probable aminotransferase; HET: LLP PLP; 2.25A {Ps 99.97
1lc5_A364 COBD, L-threonine-O-3-phosphate decarboxylase; PLP 99.97
3ele_A398 Amino transferase; RER070207001803, structural gen 99.97
3ffh_A363 Histidinol-phosphate aminotransferase; APC88260, l 99.97
2zyj_A397 Alpha-aminodipate aminotransferase; alpha-aminoadi 99.97
3dyd_A427 Tyrosine aminotransferase; PLP, SGC, structural ge 99.97
1v2d_A381 Glutamine aminotransferase; PLP, riken structural 99.97
1gd9_A389 Aspartate aminotransferase; pyridoxal enzyme, temp 99.97
1o4s_A389 Aspartate aminotransferase; TM1255, structural gen 99.97
3fvs_A422 Kynurenine--oxoglutarate transaminase 1; alpha bet 99.97
2q7w_A396 Aspartate aminotransferase; mechanism-based inhibi 99.97
2o1b_A404 Aminotransferase, class I; aminotrasferase; HET: P 99.97
1vp4_A425 Aminotransferase, putative; structural genomics, j 99.97
1u08_A386 Hypothetical aminotransferase YBDL; alpha beta pro 99.97
3g0t_A437 Putative aminotransferase; NP_905498.1, putative a 99.97
3op7_A375 Aminotransferase class I and II; PLP-dependent tra 99.97
3hdo_A360 Histidinol-phosphate aminotransferase; PSI-II, his 99.97
3e2y_A410 Kynurenine-oxoglutarate transaminase 3; alpha beta 99.97
2o0r_A411 RV0858C (N-succinyldiaminopimelate aminotransfera; 99.97
3piu_A435 1-aminocyclopropane-1-carboxylate synthase; fruit 99.97
3cq5_A369 Histidinol-phosphate aminotransferase; PLP, PMP, a 99.97
2gb3_A409 Aspartate aminotransferase; TM1698, structural gen 99.97
1ajs_A412 Aspartate aminotransferase; PIG, in the presence o 99.97
3fkd_A350 L-threonine-O-3-phosphate decarboxylase; structura 99.97
2bwn_A401 5-aminolevulinate synthase; tetrapyrrole biosynthe 99.97
3qgu_A449 LL-diaminopimelate aminotransferase; L-lysine, pyr 99.97
2ay1_A394 Aroat, aromatic amino acid aminotransferase; HET: 99.97
2x5f_A430 Aspartate_tyrosine_phenylalanine pyridoxal-5' phos 99.97
1xi9_A406 Putative transaminase; alanine aminotransferase, s 99.97
4f4e_A420 Aromatic-amino-acid aminotransferase; ssgcid, stru 99.96
3get_A365 Histidinol-phosphate aminotransferase; NP_281508.1 99.96
1iay_A428 ACC synthase 2, 1-aminocyclopropane-1-carboxylate 99.96
1b5p_A385 Protein (aspartate aminotransferase); pyridoxal en 99.96
3fsl_A397 Aromatic-amino-acid aminotransferase; tyrosine ami 99.96
3ei9_A432 LL-diaminopimelate aminotransferase; lysine biosyn 99.96
1fg7_A356 Histidinol phosphate aminotransferase; HISC, histi 99.96
1bw0_A416 TAT, protein (tyrosine aminotransferase); tyrosine 99.96
3rq1_A418 Aminotransferase class I and II; structural genomi 99.96
3asa_A400 LL-diaminopimelate aminotransferase; PLP dependent 99.96
1yaa_A412 Aspartate aminotransferase; HET: PLP; 2.05A {Sacch 99.96
3p1t_A337 Putative histidinol-phosphate aminotransferase; PL 99.95
2e7j_A371 SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-st 99.95
2r2n_A425 Kynurenine/alpha-aminoadipate aminotransferase mit 99.95
1kmj_A406 Selenocysteine lyase; persulfide perselenide NIFS 99.95
3f9t_A397 TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L 99.95
3g7q_A417 Valine-pyruvate aminotransferase; NP_462565.1, str 99.95
1qz9_A416 Kynureninase; kynurenine, tryptophan, PLP, vitamin 99.95
3ez1_A423 Aminotransferase MOCR family; YP_604413.1, struct 99.95
3t18_A413 Aminotransferase class I and II; PSI-biology, MCSG 99.95
3if2_A444 Aminotransferase; YP_265399.1, structura genomics, 99.95
1uu1_A335 Histidinol-phosphate aminotransferase; histidine b 99.95
1elu_A390 L-cysteine/L-cystine C-S lyase; FES cluster biosyn 99.95
2dr1_A386 PH1308 protein, 386AA long hypothetical serine ami 99.94
1t3i_A420 Probable cysteine desulfurase; PLP-binding enzyme, 99.94
1eg5_A384 Aminotransferase; PLP-dependent enzymes, iron-sulf 99.94
3d6k_A422 Putative aminotransferase; APC82464, corynebacteri 99.94
3ppl_A427 Aspartate aminotransferase; dimer, PLP-dependent t 99.94
1vjo_A393 Alanine--glyoxylate aminotransferase; 17130350, AL 99.94
3meb_A448 Aspartate aminotransferase; pyridoxal PHOS transfe 99.94
3kgw_A393 Alanine-glyoxylate aminotransferase; AAH25799.1, p 99.94
2z9v_A392 Aspartate aminotransferase; pyridoxamine, pyruvate 99.94
1ax4_A467 Tryptophanase; tryptophan biosynthesis, tryptophan 99.93
4eu1_A409 Mitochondrial aspartate aminotransferase; ssgcid, 99.93
1m32_A366 2-aminoethylphosphonate-pyruvate aminotransferase; 99.93
2dkj_A407 Serine hydroxymethyltransferase; PLP dependent enz 99.93
3ke3_A379 Putative serine-pyruvate aminotransferase; structu 99.93
3zrp_A384 Serine-pyruvate aminotransferase (AGXT); HET: PLP; 99.93
3cai_A406 Possible aminotransferase; RV3778C; 1.80A {Mycobac 99.93
1svv_A359 Threonine aldolase; structural genomics, structura 99.93
1v72_A356 Aldolase; PLP-dependent enzyme, lyase; HET: PLP; 2 99.93
3f0h_A376 Aminotransferase; RER070207000802, structural geno 99.93
3nnk_A411 Ureidoglycine-glyoxylate aminotransferase; PLP-dep 99.93
3lvm_A423 Cysteine desulfurase; structural genomics, montrea 99.93
3isl_A416 Purine catabolism protein PUCG; pyridoxalphosphate 99.93
3f6t_A533 Aspartate aminotransferase; YP_194538.1, STRU geno 99.93
7aat_A401 Aspartate aminotransferase; transferase(aminotrans 99.93
2yrr_A353 Aminotransferase, class V; structural genomics, NP 99.92
2ez2_A456 Beta-tyrosinase, tyrosine phenol-lyase; PLP-depend 99.92
3e9k_A465 Kynureninase; kynurenine-L-hydrolase, kynurenine h 99.92
1jg8_A347 L-ALLO-threonine aldolase; glycine biosynthesis, p 99.92
2huf_A393 Alanine glyoxylate aminotransferase; alpha and bet 99.92
3k7y_A405 Aspartate aminotransferase; aminotrans pyridoxal p 99.92
2oqx_A467 Tryptophanase; lyase, pyridoxal phosphate, tryptop 99.92
2oga_A399 Transaminase; PLP-dependent enzyme, desosamine, de 99.91
4hvk_A382 Probable cysteine desulfurase 2; transferase and I 99.91
3tcm_A500 Alanine aminotransferase 2; pyridoxal phosphate (P 99.91
2rfv_A398 Methionine gamma-lyase; pyridoxal-5'-phosphate, PL 99.91
2vi8_A405 Serine hydroxymethyltransferase; SHMT, E53Q, FTHF, 99.91
1iug_A352 Putative aspartate aminotransferase; wild type, py 99.91
3mad_A514 Sphingosine-1-phosphate lyase; carboxy-lyase activ 99.91
2ch1_A396 3-hydroxykynurenine transaminase; PLP-enzyme, kynu 99.91
3ihj_A498 Alanine aminotransferase 2; helix, structural geno 99.91
4eb5_A382 Probable cysteine desulfurase 2; scaffold, transfe 99.91
3a9z_A432 Selenocysteine lyase; PLP, cytoplasm, pyridoxal ph 99.9
3ecd_A425 Serine hydroxymethyltransferase 2; ssgcid, decode, 99.9
3lws_A357 Aromatic amino acid beta-eliminating lyase/threoni 99.9
3vax_A400 Putative uncharacterized protein DNDA; desulfurase 99.9
3qhx_A392 Cystathionine gamma-synthase METB (CGS); structura 99.9
1cs1_A386 CGS, protein (cystathionine gamma-synthase); lyase 99.9
2aeu_A374 Hypothetical protein MJ0158; selenocysteine syntha 99.9
1mdo_A393 ARNB aminotransferase; type 1 aminotransferase fol 99.9
3pj0_A359 LMO0305 protein; structural genomics, joint center 99.9
3n0l_A417 Serine hydroxymethyltransferase; alpha beta class, 99.89
1e5e_A404 MGL, methionine gamma-lyase; methionine biosynthes 99.89
2bkw_A385 Alanine-glyoxylate aminotransferase 1; analine-gly 99.89
1wyu_B474 Glycine dehydrogenase subunit 2 (P-protein); alpha 99.89
3acz_A389 Methionine gamma-lyase; L-methionine; HET: LLP; 1. 99.89
1b9h_A388 AHBA synthase, protein (3-amino-5-hydroxybenzoic a 99.89
3ndn_A414 O-succinylhomoserine sulfhydrylase; seattle struct 99.89
3uwc_A374 Nucleotide-sugar aminotransferase; lipopolysacchar 99.89
2po3_A424 4-dehydrase; external aldimine, PLP, aminotransfer 99.89
2zy4_A546 L-aspartate beta-decarboxylase; pyridoxal 5'-phosp 99.89
3h7f_A447 Serine hydroxymethyltransferase 1; cytoplasm, one- 99.88
3mc6_A497 Sphingosine-1-phosphate lyase; carboxy-lyase activ 99.88
1gc0_A398 Methionine gamma-lyase; pyridoxal-5'-phosphate; HE 99.88
3frk_A373 QDTB; aminotransferase, sugar-modification, natura 99.88
4h51_A420 Aspartate aminotransferase; ssgcid, structural gen 99.88
2cb1_A412 O-acetyl homoserine sulfhydrylase; PLP enzyme, lya 99.88
1ibj_A464 CBL, cystathionine beta-lyase; PLP-dependent enzym 99.88
3nyt_A367 Aminotransferase WBPE; PLP binding, nucleotide-sug 99.88
3nmy_A400 Xometc, cystathionine gamma-lyase-like protein; Cy 99.88
3gbx_A420 Serine hydroxymethyltransferase; structural genomi 99.88
2fnu_A375 Aminotransferase; protein-product complex, structu 99.88
2qma_A497 Diaminobutyrate-pyruvate transaminase and L-2,4- d 99.88
1o69_A394 Aminotransferase; structural genomics, unknown fun 99.87
1pff_A331 Methionine gamma-lyase; homocysteine; 2.50A {Trich 99.87
3dr4_A391 Putative perosamine synthetase; deoxysugar, pyrido 99.87
3ffr_A362 Phosphoserine aminotransferase SERC; structural ge 99.86
1qgn_A445 Protein (cystathionine gamma-synthase); methionine 99.86
2ctz_A421 O-acetyl-L-homoserine sulfhydrylase; crystal, O-ac 99.85
1n8p_A393 Cystathionine gamma-lyase; three open alpha/beta s 99.84
3cog_A403 Cystathionine gamma-lyase; CTH, PLP, propargylglyc 99.84
3b8x_A390 WBDK, pyridoxamine 5-phosphate-dependent dehydrase 99.83
3bb8_A437 CDP-4-keto-6-deoxy-D-glucose-3-dehydrase; aspartat 99.83
2c81_A418 Glutamine-2-deoxy-scyllo-inosose aminotransferase; 99.83
2jis_A515 Cysteine sulfinic acid decarboxylase; pyridoxal ph 99.82
2okj_A504 Glutamate decarboxylase 1; PLP-dependent decarboxy 99.82
2z67_A456 O-phosphoseryl-tRNA(SEC) selenium transferase; sel 99.81
3bwn_A391 AT1G70560, L-tryptophan aminotransferase; auxin sy 99.81
2x3l_A446 ORN/Lys/Arg decarboxylase family protein; lyase; H 99.81
3ht4_A431 Aluminum resistance protein; lyase, putative cysta 99.8
1w23_A360 Phosphoserine aminotransferase; pyridoxal-5'-phosp 99.8
2dgk_A452 GAD-beta, GADB, glutamate decarboxylase beta; gadb 99.8
3ri6_A430 O-acetylhomoserine sulfhydrylase; PYR 5'-phosphate 99.79
2c0r_A362 PSAT, phosphoserine aminotransferase; pyridoxal-5' 99.79
1rv3_A483 Serine hydroxymethyltransferase, cytosolic; one-ca 99.79
2a7v_A490 Serine hydroxymethyltransferase; structural genomi 99.78
2fq6_A415 Cystathionine beta-lyase; protein-inhibitor comple 99.78
3ju7_A377 Putative PLP-dependent aminotransferase; NP_978343 99.77
2hox_A427 ALLIIN lyase 1; cysteine sulphoxide lyase, ALLIINA 99.77
3jzl_A409 Putative cystathionine beta-lyase involved in ALU 99.76
4e1o_A481 HDC, histidine decarboxylase; lyase; HET: PLP PVH; 99.76
1js3_A486 DDC;, DOPA decarboxylase; carbidopa, parkinson'S d 99.75
3k40_A475 Aromatic-L-amino-acid decarboxylase; PLP dependent 99.75
3hbx_A502 GAD 1, glutamate decarboxylase 1; calmodulin-bindi 99.74
3vp6_A511 Glutamate decarboxylase 1; catalytic loop SWAP, ly 99.74
2fyf_A398 PSAT, phosphoserine aminotransferase; PLP-dependen 99.74
3hvy_A427 Cystathionine beta-lyase family protein, YNBB B.S 99.72
3i16_A427 Aluminum resistance protein; YP_878183.1, carbon-s 99.72
1c4k_A 730 Protein (ornithine decarboxylase); lyase; HET: PLP 99.64
3n75_A 715 LDC, lysine decarboxylase, inducible; pyridoxal-5' 99.62
2vyc_A 755 Biodegradative arginine decarboxylase; pyridoxal p 99.62
1wyu_A438 Glycine dehydrogenase (decarboxylating) subunit 1; 99.61
3hl2_A501 O-phosphoseryl-tRNA(SEC) selenium transferase; sel 99.54
3bc8_A450 O-phosphoseryl-tRNA(SEC) selenium transferase; dis 99.51
3e77_A377 Phosphoserine aminotransferase; SERC, PLP, structu 99.5
3m5u_A361 Phosphoserine aminotransferase; alpha-beta half sa 99.4
3qm2_A386 Phosphoserine aminotransferase; structural genomic 99.4
3ou5_A490 Serine hydroxymethyltransferase, mitochondrial; st 99.05
>4ao9_A Beta-phenylalanine aminotransferase; HET: PLP; 1.50A {Variovorax paradoxus} PDB: 4aoa_A* Back     alignment and structure
Probab=100.00  E-value=2e-80  Score=622.75  Aligned_cols=408  Identities=33%  Similarity=0.539  Sum_probs=374.6

Q ss_pred             ccCChhHHHHHHHHhhhCCCCCCCccccccccCCCCeEEEeecCCEEEEcCCCEEEecccChhhccCCCCcHHHHHHHHH
Q 011856           47 NFTLKKSEEAFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGE  126 (476)
Q Consensus        47 ~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~p~~~~~~~G~~~~d~dG~~~iD~~~~~~~~~lG~~~p~v~~a~~~  126 (476)
                      ....++|+++++++++++|+|+++++|.|.++   |+++++++|+|+||+|||+||||+++|+++++||+||+|++|+.+
T Consensus        38 ~~~~p~s~~~~~~a~~~~pgg~~~~~~~~~~~---P~~i~~a~G~~l~D~dG~~ylD~~~g~~~~~lGH~hp~v~~Av~~  114 (454)
T 4ao9_A           38 TDANPASQRQFEAQARYMPGANSRSVLFYAPF---PLTIARGEGAALWDADGHRYADFIAEYTAGVYGHSAPEIRDAVIE  114 (454)
T ss_dssp             HHHCHHHHHHHHHHTTTSGGGCSSGGGCCSSC---CCEEEEEETTEEEETTCCEEEESSGGGGTTTTCSCCHHHHHHHHH
T ss_pred             hhcCcHhHHHHHHHhhhCCCCCCCCccccCCC---CccEEEeecCEEEECCCCEEEEccccHHhhcccCCCHHHHHHHHH
Confidence            34478899999999999999999999988764   999999999999999999999999999999999999999999999


Q ss_pred             HHHhcCCCCCCCHHHHHHHHHHHhhCCCCCeEEEeCCHHHHHHHHHHHHHhccCCceEEEEeCCCCCCchhHHhhcCCCC
Q 011856          127 TMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIIKFEGCYHGHADPFLVKAGSGV  206 (476)
Q Consensus       127 ~l~~~~~~~~~~~~~~~la~~l~~~~~~~e~v~~~~sGseA~~~al~~ar~~~~~~~ii~~~~~yhg~~~~~~~~~g~~~  206 (476)
                      |++++.+++.++..+.+|+++|++.+|+.++|+|+|||+||++.|||+||.+++|++||.|+++|||+++......+.  
T Consensus       115 q~~~~~~~~~~~~~~~~lae~l~~~~p~~~~v~f~~SGsEA~e~AiklAr~~tgr~~ii~~~~~yHG~t~~~~~~~~~--  192 (454)
T 4ao9_A          115 AMQGGINLTGHNLLEGRLARLICERFPQIEQLRFTNSGTEANLMALTAALHFTGRRKIVVFSGGYHGGVLGFGARPSP--  192 (454)
T ss_dssp             HHHTCSCCCSEESSHHHHHHHHHHHSTTCSEEEEESSHHHHHHHHHHHHHHHHTCCEEEEETTCBCSTTCBBSSSBCT--
T ss_pred             HHhcCCCccCCcHHHHHHHHHHHHhCCCCCEEEEeCchHHHHHHHHHHHHhcccCCeEEEEeCCcCCccccccccccC--
Confidence            999988888888889999999999999999999999999999999999999999999999999999988765432221  


Q ss_pred             ccCCCCCCCCCCCCCCCceeeccCCCHHHHHHHHhcCCCCeEEEEEcccCCCCCcccCCHHHHHHHHHHHHHhCCEEEEe
Q 011856          207 ATLGLPDSPGVPKGATYETLTAPFNDVSALENLFENNKGEIAAIILEPVVGNSGFIAPKPDFLNAIRRITKENGALLIFD  286 (476)
Q Consensus       207 ~~~~~~~~~~~~~~~~~~~~~~~~~d~~~le~~l~~~~~~~a~vi~ep~~~~~G~i~~~~~~l~~l~~l~~~~g~llI~D  286 (476)
                                  .....+...+||||++++++.++++++++++||+||+++++|.+.|+++||++|+++|++||++||+|
T Consensus       193 ------------~~~~~~~~~~p~nd~~~l~~~l~~~~~~iAavIvEPv~g~~G~~~p~~~fL~~lr~lc~~~g~lLI~D  260 (454)
T 4ao9_A          193 ------------TTVPFDFLVLPYNDAQTARAQIERHGPEIAVVLVEPMQGASGCIPGQPDFLQALRESATQVGALLVFD  260 (454)
T ss_dssp             ------------TSCCSEEEEECTTCHHHHHHHHHHTGGGEEEEEECSEESTTTCEECCHHHHHHHHHHHHHHTCEEEEE
T ss_pred             ------------ccCCCCcccCCCchHHHHHHHHhhcCCceEEEEeccccCCCCccCCchhhHHHHHHHHhhcCCEEEEE
Confidence                        11223577889999999999999888899999999999999999999999999999999999999999


Q ss_pred             ccccCccccccchhhccCCCCchhhhhhhcCCCCcEEEEEecHHHHHhhcC-CCCccccCCCCCcHHHHHHHHHHHHHhc
Q 011856          287 EVMTGFRLAYGGAQEYFGVTPDLTTLGKIIGGGLPVGAYGGRRDIMEMVAP-AGPMYQAGTLSGNPLAMTAGIHTLKRLK  365 (476)
Q Consensus       287 Ev~~g~r~g~~~~~~~~g~~pDi~t~sK~lg~G~~iG~~~~~~~i~~~l~~-~~~~~~~~t~~~~~~~~aaa~aal~~~~  365 (476)
                      ||||| |+|.+|+++++|+.||++|++|++|+|+|+|++++++++++.+.+ .++.+|++||++||++|+|++++|+.++
T Consensus       261 EV~tG-R~G~~~a~e~~gv~PDi~t~gK~lggG~Piga~~~~~ei~~~~~~~~~~~~h~~T~~gnPla~AAala~L~~l~  339 (454)
T 4ao9_A          261 EVMTS-RLAPHGLANKLGIRSDLTTLGKYIGGGMSFGAFGGRADVMALFDPRTGPLAHSGTFNNNVMTMAAGYAGLTKLF  339 (454)
T ss_dssp             CTTGG-GGSTTCHHHHHTCCCSEEEEEGGGGTTSSCEEEEECHHHHGGGCTTTCSCCCCCTTTTCHHHHHHHHHHHHHTS
T ss_pred             CCCcC-CCccccchhccCCCCcEEEeccccCCCCcceeeeeHHHHHHHHhhccCCccccCCCCCCHHHHHHHHHHHHHHh
Confidence            99998 999999999999999999999999999999999999999999975 3567799999999999999999999999


Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHhhhcCCceEeeeeceeEEEEEecCCCcCchhhcccchHHHHHHHHHHHHCCeEeccCC
Q 011856          366 EPGTYEYLNKITGELTQGIIDAGKKAGHAICGGYISGMFGFFFTEGPVYNFEDAKKSETTKFARFYRGMLEEGVYFAPSQ  445 (476)
Q Consensus       366 ~~~~~~~~~~~~~~l~~~L~~~~~~~~~~~~v~~~g~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~Gv~~~~~~  445 (476)
                      ++++++++++++++|+++|+++..+++++.++++.|+|++++|.++++.++.+....+......++..|+++||++.|.+
T Consensus       340 ~~~~~~~~~~~g~~l~~~L~~l~~~~~~~~~vrg~G~m~gi~f~~~~~~~~~~~~~~d~~~~~~~~~~ll~~Gv~~~p~~  419 (454)
T 4ao9_A          340 TPEAAGALAERGEALRARLNALCANEGVAMQFTGIGSLMNAHFVQGDVRSSEDLAAVDGRLRQLLFFHLLNEDIYSSPRG  419 (454)
T ss_dssp             CHHHHHHHHHHHHHHHHHHHHHHHHHTBSCEEEEETTEEEEESCCSCCCSGGGGTTCCHHHHHHHHHHHHHTTEECCTTC
T ss_pred             ccChhHHHHHHHHHHHHHHHHHHhhCCCCEEEeeeceEEEEEEecCCCCCHHHHHhhhHHHHHHHHHHHHHCCEEEcCCC
Confidence            89999999999999999999999999999999999999999998887788777777777788889999999999999875


Q ss_pred             CcceEEeCCCcHHHHHHHHHHHHHHHHHh
Q 011856          446 FEAGFTSLAHSSDDIQHTITAAEKVKMRF  474 (476)
Q Consensus       446 ~~~~~~~~~~t~e~i~~~~~~l~~~~~~~  474 (476)
                        .+++++.||++|||+++++|++++.+.
T Consensus       420 --~~~~s~~~T~~dId~~l~al~~~l~~~  446 (454)
T 4ao9_A          420 --FVVLSLPLTDADIDRYVAAIGSFIGGH  446 (454)
T ss_dssp             --EEECCTTCCHHHHHHHHHHHHHHHHHS
T ss_pred             --CEEEeCCCCHHHHHHHHHHHHHHHHhc
Confidence              456788999999999999999999864
>4atq_A 4-aminobutyrate transaminase; transferase; HET: PLP; 2.75A {Arthrobacter aurescens} PDB: 4atp_A* Back     alignment and structure
>4e3q_A Pyruvate transaminase; aminotransferase, transferase; HET: PMP; 1.90A {Vibrio fluvialis} PDB: 4e3r_A* 3nui_A Back     alignment and structure
>3l44_A Glutamate-1-semialdehyde 2,1-aminomutase 1; alpha beta class, PLP-dependent transferase-like, bacillus A csgid, porphyrin biosynthesis; HET: LLP; 2.05A {Bacillus anthracis} SCOP: c.67.1.0 Back     alignment and structure
>3k28_A Glutamate-1-semialdehyde 2,1-aminomutase 2; biosynthesis of cofactors, prosthetic groups, and carriers, csgid, cytoplasm, isomerase; HET: MSE PLP; 1.95A {Bacillus anthracis str} SCOP: c.67.1.4 PDB: 3bs8_A* Back     alignment and structure
>4e77_A Glutamate-1-semialdehyde 2,1-aminomutase; structural genomics, center for structural genomics of infec diseases, csgid, porphyrin biosynthesis; 2.00A {Yersinia pestis} Back     alignment and structure
>3fq8_A Glutamate-1-semialdehyde 2,1-aminomutase; drug resistance, microev0lution, integrated approach, chlorophyll biosynthesis; HET: PMP; 2.00A {Synechococcus elongatus pcc 6301} SCOP: c.67.1.4 PDB: 2hp1_A* 2hoz_A* 2hoy_A* 2hp2_A* 3fq7_A* 3usf_A* 2gsa_A* 3gsb_A* 4gsa_A* 3fqa_A* 2cfb_A* Back     alignment and structure
>2yky_A Beta-transaminase; transferase; HET: PLP SFE; 1.69A {Mesorhizobium SP} PDB: 2ykv_A* 2yku_A* 2ykx_A* Back     alignment and structure
>2e7u_A Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzyme, GSA, structural genomics, NPPSFA; HET: PMP; 1.90A {Thermus thermophilus} Back     alignment and structure
>2epj_A Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzyme, GSA, structural genomics, NPPSFA; HET: PMP; 1.70A {Aeropyrum pernix} PDB: 2zsl_A* 2zsm_A* Back     alignment and structure
>4ffc_A 4-aminobutyrate aminotransferase (GABT); structural genomics, niaid, national institute of allergy AN infectious diseases; HET: LLP; 1.80A {Mycobacterium abscessus} Back     alignment and structure
>3oks_A 4-aminobutyrate transaminase; ssgcid, transferase, seattle structural genomics center for infectious disease; HET: LLP; 1.80A {Mycobacterium smegmatis} PDB: 3r4t_A* 3q8n_A Back     alignment and structure
>3hmu_A Aminotransferase, class III; structural genomics, pyridoxal phosphate, PSI-2, protein structure initiative; 2.10A {Silicibacter pomeroyi} Back     alignment and structure
>3i5t_A Aminotransferase; pyridoxal 5'-phosphate, PSI-2, NYSGXRC, ST genomics, protein structure initiative; HET: PLP; 2.00A {Rhodobacter sphaeroides 2} Back     alignment and structure
>3n5m_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; aminotransferase, csgid; 2.05A {Bacillus anthracis} Back     alignment and structure
>3tfu_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; transferase, transferase-transferase inhibitor complex; HET: PL8; 1.94A {Mycobacterium tuberculosis} PDB: 3tft_A* 3bv0_A* 3lv2_A* Back     alignment and structure
>2cy8_A D-phgat, D-phenylglycine aminotransferase; structural genomics, NPPSFA, national PROJ protein structural and functional analyses; 2.30A {Pseudomonas stutzeri} Back     alignment and structure
>3gju_A Putative aminotransferase; pyridoxal phosphate, PLP-dependent transferase-like fold, ST genomics, joint center for structural genomics, JCSG; HET: MSE LLP PLP; 1.55A {Mesorhizobium loti} PDB: 3fcr_A* Back     alignment and structure
>3dod_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; aminotransferase, biotin biosynthesis, pyridoxal phosphate, adenosyl-L-methionine; HET: PLP; 1.90A {Bacillus subtilis} SCOP: c.67.1.0 PDB: 3drd_A 3du4_A* Back     alignment and structure
>4a6r_A Omega transaminase; transferase, PLP-binding enzyme, transaminase fold type I; HET: TA8; 1.35A {Chromobacterium violaceum} PDB: 4a6t_A* 4a6u_A 4a72_A* 4ah3_A* Back     alignment and structure
>4a0g_A Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; BIO3-BIO1, biotin synthesis; HET: PLP; 2.50A {Arabidopsis thaliana} PDB: 4a0h_A* 4a0r_A* 4a0f_A* Back     alignment and structure
>1z7d_A Ornithine aminotransferase; structural genomics consortium, SGC, malaria; 2.10A {Plasmodium yoelii yoelii} SCOP: c.67.1.4 PDB: 3lg0_A 3ntj_A Back     alignment and structure
>2oat_A Ornithine aminotransferase; 5-fluoromethylornithine, PLP-dependent ENZ pyridoxal phosphate; HET: PFM; 1.95A {Homo sapiens} SCOP: c.67.1.4 PDB: 1oat_A* 2byj_A* 2byl_A* 1gbn_A* 2can_A* Back     alignment and structure
>3dxv_A Alpha-amino-epsilon-caprolactam racemase; fold-TYPE1, pyridoxal-5'-phosphate dependent racemase, pyrid phosphate, isomerase; HET: PLP; 2.21A {Achromobacter obae} PDB: 2zuk_A* 3dxw_A* Back     alignment and structure
>1zod_A DGD, 2,2-dialkylglycine decarboxylase; pyridoxal, cesium, lyase; HET: MES PLP; 1.80A {Burkholderia cepacia} SCOP: c.67.1.4 PDB: 1dka_A* 1m0o_A* 1m0p_A* 1m0n_A* 1zc9_A* 1zob_A* 1m0q_A* 2dkb_A* 1dgd_A* 1dge_A* 1d7u_A* 1d7s_A* 1d7r_A* 1d7v_A* 1z3z_A* Back     alignment and structure
>3nx3_A Acoat, acetylornithine aminotransferase; csgid, structural genomics, center for structural genomics O infectious diseases; 1.80A {Campylobacter jejuni subsp} Back     alignment and structure
>3i4j_A Aminotransferase, class III; structural GENOMICS,NYSGXRC, target 11246C, deino radiodurans, pyridoxal phosphate, transfe PSI-2; 1.70A {Deinococcus radiodurans} Back     alignment and structure
>1ohv_A 4-aminobutyrate aminotransferase; PLP-dependent enzyme, 4- AMIN acid, antiepileptic drug target; HET: PLP; 2.3A {Sus scrofa} SCOP: c.67.1.4 PDB: 1ohw_A* 1ohy_A* Back     alignment and structure
>2pb2_A Acetylornithine/succinyldiaminopimelate aminotran; ARGD, pyridoxal 5'-phosphate, arginine metabolism, lysine biosynthesis, gabaculine; HET: PLP; 1.91A {Salmonella typhimurium} PDB: 2pb0_A* Back     alignment and structure
>2cjg_A L-lysine-epsilon aminotransferase; internal aldimine, pyridoxal phosphate, PLP, RV3290C, lysine amino transferase; HET: PMP; 1.95A {Mycobacterium tuberculosis} PDB: 2cjd_A* 2cin_A* 2cjh_A* 2jjg_A* 2jje_A* 2jjh_A* 2jjf_A Back     alignment and structure
>3a8u_X Omega-amino acid--pyruvate aminotransferase; large pleated sheet, transaminase, pyridox phosphate; HET: PLP; 1.40A {Pseudomonas putida} Back     alignment and structure
>2eo5_A 419AA long hypothetical aminotransferase; PLP enzyme, structural genomics, NPPSFA, N project on protein structural and functional analyses; HET: PLP; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>4adb_A Succinylornithine transaminase; transferase, PLP enzymes, aminotransferase; HET: PLP; 2.20A {Escherichia coli} PDB: 4adc_A* 4add_A* 4ade_A Back     alignment and structure
>1sff_A 4-aminobutyrate aminotransferase; enzyme complexes; HET: IK2; 1.90A {Escherichia coli} SCOP: c.67.1.4 PDB: 1sf2_A* 1szk_A* 1szu_A* 1szs_A* Back     alignment and structure
>3ruy_A Ornithine aminotransferase; structural genomics, csgid, center for structural genomics O infectious diseases, alpha and beta protein; HET: LLP; 2.65A {Bacillus anthracis} SCOP: c.67.1.0 Back     alignment and structure
>1s0a_A Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; fold type I, subclass II, homodimer; HET: LLP; 1.71A {Escherichia coli} SCOP: c.67.1.4 PDB: 1qj5_A* 1mlz_A* 1qj3_A* 1mly_A* 1s06_A* 1s08_A* 1s09_A* 1s07_A* 1mgv_A* 1dty_A* Back     alignment and structure
>2ord_A Acoat, acetylornithine aminotransferase; TM1785, acetylornithine aminotransferase (EC 2.6.1.11) (ACOA structural genomics; HET: MSE PLP; 1.40A {Thermotoga maritima MSB8} PDB: 2e54_A* Back     alignment and structure
>1vef_A Acetylornithine/acetyl-lysine aminotransferase; PLP, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: PLP; 1.35A {Thermus thermophilus} SCOP: c.67.1.4 PDB: 1wkg_A* 1wkh_A* Back     alignment and structure
>2eh6_A Acoat, acetylornithine aminotransferase; ARGD, structural genomics, NPPSFA, national project on prote structural and functional analyses; HET: PLP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>2w8t_A SPT, serine palmitoyltransferase; HET: LLP; 1.25A {Sphingomonas paucimobilis} PDB: 2w8u_A* 2w8w_A* 2xbn_A* 2w8j_A* 2w8v_A* 2jg2_A* 2jgt_A 2x8u_A* Back     alignment and structure
>3l8a_A METC, putative aminotransferase, probable beta-cystathi; beta-cystathionase, lyase; HET: PLP; 1.54A {Streptococcus mutans} Back     alignment and structure
>3tqx_A 2-amino-3-ketobutyrate coenzyme A ligase; energy metabolism, transferase; HET: PLP; 2.30A {Coxiella burnetii} Back     alignment and structure
>1fc4_A 2-amino-3-ketobutyrate conenzyme A ligase; 2-amino-3-ketobutyrate COA ligase, pyridoxal phosphate, COEN transferase, structural genomics; HET: PLP; 2.00A {Escherichia coli} SCOP: c.67.1.4 Back     alignment and structure
>3dzz_A Putative pyridoxal 5'-phosphate-dependent C-S LYA; putative PLP-dependent aminotransferase; HET: MSE LLP PG4; 1.61A {Lactobacillus delbrueckii subsp} SCOP: c.67.1.0 Back     alignment and structure
>3fdb_A Beta C-S lyase, putative PLP-dependent beta-cystathionase; PLP-dependent transferase-like fold, structural genomics; HET: LLP; 1.99A {Corynebacterium diphtheriae} Back     alignment and structure
>3a2b_A Serine palmitoyltransferase; vitamin B6-dependent enzyme fold type I, acyltransferase, PY phosphate; HET: PLP; 2.30A {Sphingobacterium multivorum} Back     alignment and structure
>3kki_A CAI-1 autoinducer synthase; quorum sensing, CQSA, P virulence, acyltransferase, aminotransferase, pyridoxal PHO transferase; HET: PLP; 1.80A {Vibrio cholerae} PDB: 3hqt_A* 2wk9_A* 2wk8_A* 2wka_A* 2wk7_A Back     alignment and structure
>1bs0_A Protein (8-amino-7-oxonanoate synthase); PLP-dependent acyl-COA synthase, biotin biosynthesis, 8-AMIN oxonanoate synthase; 1.65A {Escherichia coli} SCOP: c.67.1.4 PDB: 2g6w_A* 1dje_A* 1dj9_A* Back     alignment and structure
>1d2f_A MALY protein; aminotransferase fold, large PLP-binding domain, small C-TER domain, open alpha-beta structure., transferase; HET: PLP; 2.50A {Escherichia coli} SCOP: c.67.1.3 Back     alignment and structure
>4dq6_A Putative pyridoxal phosphate-dependent transferas; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: PLP; 1.50A {Clostridium difficile} PDB: 4dgt_A* Back     alignment and structure
>1c7n_A Cystalysin; transferase, aminotransferase, pyridoxal phosphate; HET: PLP; 1.90A {Treponema denticola} SCOP: c.67.1.3 PDB: 1c7o_A* Back     alignment and structure
>3ftb_A Histidinol-phosphate aminotransferase; structural genomics, PSI, MCSG, protein structure initiative; 2.00A {Clostridium acetobutylicum} SCOP: c.67.1.0 Back     alignment and structure
>1yiz_A Kynurenine aminotransferase; glutamine transaminase; kynurenic acid, mosquito, PLP-enzyme, pyridoxal phosphate, PLP; HET: LLP; 1.55A {Aedes aegypti} SCOP: c.67.1.1 PDB: 1yiy_A* 2r5c_A* 2r5e_A* Back     alignment and structure
>3jtx_A Aminotransferase; NP_283882.1, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; HET: LLP MES; 1.91A {Neisseria meningitidis Z2491} Back     alignment and structure
>3ly1_A Putative histidinol-phosphate aminotransferase; structural G joint center for structural genomics, JCSG; HET: MSE PLP CIT; 1.80A {Erwinia carotovora atroseptica} Back     alignment and structure
>3nra_A Aspartate aminotransferase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: LLP; 2.15A {Rhodobacter sphaeroides} Back     alignment and structure
>2zc0_A Alanine glyoxylate transaminase; alanine:glyoxylate aminotransferase, archaea, thermococcus L transferase; HET: PMP; 2.30A {Thermococcus litoralis} Back     alignment and structure
>3euc_A Histidinol-phosphate aminotransferase 2; YP_297314.1, structur genomics, joint center for structural genomics, JCSG; HET: MSE; 2.05A {Ralstonia eutropha JMP134} SCOP: c.67.1.0 Back     alignment and structure
>3h14_A Aminotransferase, classes I and II; YP_167802.1, SPO258 structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.90A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>3b1d_A Betac-S lyase; HET: PLP PLS EPE; 1.66A {Streptococcus anginosus} PDB: 3b1c_A* 3b1e_A* Back     alignment and structure
>2z61_A Probable aspartate aminotransferase 2; amino acid aminotransferase, kynurenine aminotransferase, MJ0684, cytoplasm; HET: LLP; 2.20A {Methanococcus jannaschii} Back     alignment and structure
>2dou_A Probable N-succinyldiaminopimelate aminotransfera; PLP-dependent enzyme, structural genomics, NPPSFA; HET: EPE; 2.30A {Thermus thermophilus} Back     alignment and structure
>3b46_A Aminotransferase BNA3; kynurenine aminotransferase, LLP, PLP, cytoplasm, mitochondrion, pyridoxal phosphate; HET: LLP; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3ezs_A Aminotransferase ASPB; NP_207418.1, structural genomics, JOI for structural genomics, JCSG; HET: MSE; 2.19A {Helicobacter pylori 26695} SCOP: c.67.1.0 Back     alignment and structure
>1j32_A Aspartate aminotransferase; HET: PLP; 2.10A {Phormidium lapideum} SCOP: c.67.1.1 Back     alignment and structure
>3aow_A Putative uncharacterized protein PH0207; protein-PLP-AKG triple complex, schiff-base linkage, kynuren aminotransferase; HET: PLP AKG; 1.56A {Pyrococcus horikoshii} PDB: 3aov_A* 3ath_A* 3av7_A* 1x0m_A 1wst_A* Back     alignment and structure
>2x5d_A Probable aminotransferase; HET: LLP PLP; 2.25A {Pseudomonas aeruginosa} Back     alignment and structure
>1lc5_A COBD, L-threonine-O-3-phosphate decarboxylase; PLP-dependent decarboxylase cobalamin, lyase; 1.46A {Salmonella enterica} SCOP: c.67.1.1 PDB: 1lc7_A* 1lc8_A* 1lkc_A* Back     alignment and structure
>3ele_A Amino transferase; RER070207001803, structural genomics, JOI for structural genomics, JCSG; HET: MSE PLP; 2.10A {Eubacterium rectale} Back     alignment and structure
>3ffh_A Histidinol-phosphate aminotransferase; APC88260, listeria in CLIP11262, structural genomics, PSI-2; 2.31A {Listeria innocua} SCOP: c.67.1.0 Back     alignment and structure
>2zyj_A Alpha-aminodipate aminotransferase; alpha-aminoadipate aminotransferase; HET: PGU; 1.67A {Thermus thermophilus} PDB: 2egy_A* 2dtv_A* 2zg5_A* 2zp7_A* 2z1y_A* 3cbf_A* Back     alignment and structure
>3dyd_A Tyrosine aminotransferase; PLP, SGC, structural genomics, structural genomics consortium, disease mutation, phenylalani catabolism; HET: PLP; 2.30A {Homo sapiens} PDB: 3pdx_A* Back     alignment and structure
>1v2d_A Glutamine aminotransferase; PLP, riken structural genomics/proteomics initi RSGI, structural genomics; HET: PLP; 1.90A {Thermus thermophilus} SCOP: c.67.1.1 PDB: 1v2e_A* 1v2f_A* Back     alignment and structure
>1gd9_A Aspartate aminotransferase; pyridoxal enzyme, temperature dependence O substrate recognition; HET: PLP; 1.80A {Pyrococcus horikoshii} SCOP: c.67.1.1 PDB: 1gde_A* 1dju_A* Back     alignment and structure
>1o4s_A Aspartate aminotransferase; TM1255, structural genomics, JCS protein structure initiative, joint center for structural G transferase; HET: PLP; 1.90A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>3fvs_A Kynurenine--oxoglutarate transaminase 1; alpha beta protein, PLP dependent protein, aminotransferase, pyridoxal phosphate, transferase; HET: LLP; 1.50A {Homo sapiens} SCOP: c.67.1.1 PDB: 3fvu_A* 3fvx_A* 1w7l_A* 1w7m_A* 1w7n_A* Back     alignment and structure
>2q7w_A Aspartate aminotransferase; mechanism-based inhibitor, PLP, sadta, PH dependence; HET: KST PSZ PMP GOL; 1.40A {Escherichia coli} SCOP: c.67.1.1 PDB: 2qa3_A* 2qb2_A* 2qb3_A* 2qbt_A* 3qn6_A* 3pa9_A* 1aaw_A* 1amq_A* 1ams_A* 1arg_A* 1amr_A* 1art_A* 1asa_A* 1asd_A* 1ase_A* 1asl_A* 1asm_A* 1asn_A* 1c9c_A* 1cq6_A* ... Back     alignment and structure
>2o1b_A Aminotransferase, class I; aminotrasferase; HET: PLP; 1.95A {Staphylococcus aureus} Back     alignment and structure
>1vp4_A Aminotransferase, putative; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE PLP; 1.82A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>1u08_A Hypothetical aminotransferase YBDL; alpha beta protein; HET: PLP; 2.35A {Escherichia coli} SCOP: c.67.1.1 Back     alignment and structure
>3g0t_A Putative aminotransferase; NP_905498.1, putative aspartate aminotransferase, structural genomics, joint center for structural genomics; HET: MSE LLP PE4; 1.75A {Porphyromonas gingivalis} Back     alignment and structure
>3op7_A Aminotransferase class I and II; PLP-dependent transferase, structural genomics, joint center structural genomics, JCSG; HET: LLP UNL; 1.70A {Streptococcus suis 89} PDB: 3p6k_A* Back     alignment and structure
>3hdo_A Histidinol-phosphate aminotransferase; PSI-II, histidinol-phosphate aminotrans structural genomics, protein structure initiative; 1.61A {Geobacter metallireducens gs-15} Back     alignment and structure
>3e2y_A Kynurenine-oxoglutarate transaminase 3; alpha beta protein, PLP dependent protein, aminotransferase, pyridoxal phosphate, transferase; HET: GLN PMP; 2.26A {Mus musculus} SCOP: c.67.1.0 PDB: 2zjg_A* 3e2f_A* 3e2z_A* Back     alignment and structure
>2o0r_A RV0858C (N-succinyldiaminopimelate aminotransfera; PLP-binding enzyme, lysine biosynthesis, aminotransferase, S genomics; HET: LLP; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3piu_A 1-aminocyclopropane-1-carboxylate synthase; fruit ripening, ethylene biosynthesis, lyase, pyridoxal 5'-P binding; HET: LLP PLR; 1.35A {Malus domestica} SCOP: c.67.1.4 PDB: 1m4n_A* 1m7y_A* 1ynu_A* 1b8g_A* Back     alignment and structure
>3cq5_A Histidinol-phosphate aminotransferase; PLP, PMP, amino-acid biosynthesis, histidine biosynthesis, pyridoxal phosphate; HET: PMP; 1.80A {Corynebacterium glutamicum} PDB: 3cq6_A* 3cq4_A Back     alignment and structure
>2gb3_A Aspartate aminotransferase; TM1698, structural genomics, PSI structure initiative, joint center for structural genomics; HET: LLP; 2.50A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>1ajs_A Aspartate aminotransferase; PIG, in the presence of ligand 2-methylaspartate; HET: LLP PLA; 1.60A {Sus scrofa} SCOP: c.67.1.1 PDB: 1ajr_A* 3ii0_A* 1aat_A 2cst_A* Back     alignment and structure
>3fkd_A L-threonine-O-3-phosphate decarboxylase; structural genomic, , structural genomics, PSI-2, protein structure initiative; 2.50A {Porphyromonas gingivalis} Back     alignment and structure
>2bwn_A 5-aminolevulinate synthase; tetrapyrrole biosynthesis, heme biosynthesis, pyridoxal PHOS dependent, transferase, acyltransferase; HET: LLP; 2.1A {Rhodobacter capsulatus} SCOP: c.67.1.4 PDB: 2bwo_A* 2bwp_A* Back     alignment and structure
>3qgu_A LL-diaminopimelate aminotransferase; L-lysine, pyridoxal-5' phosphate, chamydomonas reinhardtii; HET: GOL; 1.55A {Chlamydomonas reinhardtii} Back     alignment and structure
>2ay1_A Aroat, aromatic amino acid aminotransferase; HET: PLP AHC; 2.20A {Paracoccus denitrificans} SCOP: c.67.1.1 PDB: 1ay5_A* 1ay4_A* 1ay8_A* 2ay2_A* 2ay3_A* 2ay4_A* 2ay5_A* 2ay6_A* 2ay7_A* 2ay8_A* 2ay9_A* Back     alignment and structure
>2x5f_A Aspartate_tyrosine_phenylalanine pyridoxal-5' phosphate-dependent aminotransferase...; HET: PLP EPE; 1.80A {Staphylococcus aureus} Back     alignment and structure
>1xi9_A Putative transaminase; alanine aminotransferase, southeast collaboratory for structural genomics, secsg; HET: PLP; 2.33A {Pyrococcus furiosus} SCOP: c.67.1.1 Back     alignment and structure
>4f4e_A Aromatic-amino-acid aminotransferase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: LLP; 1.80A {Burkholderia pseudomallei} PDB: 4eff_A* Back     alignment and structure
>3get_A Histidinol-phosphate aminotransferase; NP_281508.1, structural genomics, joint center for structural genomics; HET: LLP MSE; 2.01A {Campylobacter jejuni subsp} Back     alignment and structure
>1iay_A ACC synthase 2, 1-aminocyclopropane-1-carboxylate synthase 2; protein-cofactor-inhibitor complex, V6-dependent enzyme, LYA; HET: PLP AVG; 2.70A {Solanum lycopersicum} SCOP: c.67.1.4 PDB: 1iax_A* Back     alignment and structure
>1b5p_A Protein (aspartate aminotransferase); pyridoxal enzyme; HET: PLP; 1.80A {Thermus thermophilus} SCOP: c.67.1.1 PDB: 1gck_A* 1b5o_A* 5bj4_A* 1gc4_A* 1gc3_A* 1bkg_A* 5bj3_A* 1bjw_A* Back     alignment and structure
>3fsl_A Aromatic-amino-acid aminotransferase; tyrosine aminotransferase, pyridoxal phosphate, internal ALD schiff base, amino-acid biosynthesis; HET: PLR; 2.35A {Escherichia coli k-12} SCOP: c.67.1.1 PDB: 3tat_A* Back     alignment and structure
>3ei9_A LL-diaminopimelate aminotransferase; lysine biosynthesis, pyridoxal 5' phosphat external aldimine, chloroplast, pyridox phosphate; HET: PL6; 1.55A {Arabidopsis thaliana} PDB: 3ei8_A* 3eib_A* 3ei6_A* 2z1z_A* 3ei5_A* 2z20_A* 3ei7_A 3eia_A* Back     alignment and structure
>1fg7_A Histidinol phosphate aminotransferase; HISC, histidine biosynthesis, pyridoxal PH montreal-kingston bacterial structural genomics initiative; HET: PMP; 1.50A {Escherichia coli} SCOP: c.67.1.1 PDB: 1fg3_A* 1gew_A* 1gex_A* 1gey_A* 1iji_A* Back     alignment and structure
>1bw0_A TAT, protein (tyrosine aminotransferase); tyrosine catabolism, pyridoxal-5'-phosphate, PLP; HET: LLP; 2.50A {Trypanosoma cruzi} SCOP: c.67.1.1 Back     alignment and structure
>3rq1_A Aminotransferase class I and II; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta structure, cytosol; HET: AKG GOL; 2.20A {Veillonella parvula} Back     alignment and structure
>3asa_A LL-diaminopimelate aminotransferase; PLP dependent aminotransferase; 2.05A {Chlamydia trachomatis} PDB: 3asb_A* Back     alignment and structure
>1yaa_A Aspartate aminotransferase; HET: PLP; 2.05A {Saccharomyces cerevisiae} SCOP: c.67.1.1 Back     alignment and structure
>3p1t_A Putative histidinol-phosphate aminotransferase; PLP-dependent transferase-like, structural genomics, joint C structural genomics, JCSG; HET: TLA; 2.60A {Burkholderia pseudomallei} Back     alignment and structure
>2e7j_A SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-strand, lyase, structural genomics; HET: PLP; 2.40A {Archaeoglobus fulgidus} SCOP: c.67.1.9 PDB: 2e7i_A* Back     alignment and structure
>2r2n_A Kynurenine/alpha-aminoadipate aminotransferase mitochondrial; alpha & beta protein, PLP-dependent transferase, aminotransf mitochondrion; HET: PMP KYN; 1.95A {Homo sapiens} PDB: 2qlr_A* 3dc1_A* 3ue8_A* 2vgz_A* 2xh1_A* Back     alignment and structure
>1kmj_A Selenocysteine lyase; persulfide perselenide NIFS pyridoxal phosphate, structural PSI, protein structure initiative; HET: PLP; 2.00A {Escherichia coli} SCOP: c.67.1.3 PDB: 1i29_A* 1jf9_A* 1kmk_A* 1c0n_A* Back     alignment and structure
>3f9t_A TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L-tyrosine decarboxylase MFNA (EC 4.1.1.25), ST genomics; HET: PLP; 2.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>3g7q_A Valine-pyruvate aminotransferase; NP_462565.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 1.80A {Salmonella typhimurium} Back     alignment and structure
>1qz9_A Kynureninase; kynurenine, tryptophan, PLP, vitamin B6, pyridoxal-5'-phosph hydrolase; HET: PLP P3G; 1.85A {Pseudomonas fluorescens} SCOP: c.67.1.3 Back     alignment and structure
>3ez1_A Aminotransferase MOCR family; YP_604413.1, struct genomics, joint center for structural genomics, JCSG; 2.60A {Deinococcus geothermalis dsm 11300} Back     alignment and structure
>3if2_A Aminotransferase; YP_265399.1, structura genomics, joint center for structural genomics, JCSG, prote structure initiative, PSI-2; HET: PLP; 2.50A {Psychrobacter arcticus 273-4} Back     alignment and structure
>1uu1_A Histidinol-phosphate aminotransferase; histidine biosynthesis, pyridoxal phosphate, complete proteome; HET: PMP HSA; 2.38A {Thermotoga maritima} SCOP: c.67.1.1 PDB: 1uu0_A 1h1c_A* 1uu2_A* 2f8j_A* Back     alignment and structure
>1elu_A L-cysteine/L-cystine C-S lyase; FES cluster biosynthesis, pyridoxal 5'-phosphate, thiocystei aminoacrylate, enzyme-product complex; HET: PDA; 1.55A {Synechocystis SP} SCOP: c.67.1.3 PDB: 1elq_A* 1n2t_A* 1n31_A* Back     alignment and structure
>2dr1_A PH1308 protein, 386AA long hypothetical serine aminotransferase; PLP, structural genomics, NPPSFA; HET: PLP; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>1t3i_A Probable cysteine desulfurase; PLP-binding enzyme, transferase; HET: 2OS PLP; 1.80A {Synechocystis SP} SCOP: c.67.1.3 Back     alignment and structure
>1eg5_A Aminotransferase; PLP-dependent enzymes, iron-sulfur-cluster synthesis, C-S BE transferase; HET: PLP; 2.00A {Thermotoga maritima} SCOP: c.67.1.3 PDB: 1ecx_A* Back     alignment and structure
>3d6k_A Putative aminotransferase; APC82464, corynebacterium diphthe structural genomics, PSI-2, protein structure initiative; 2.00A {Corynebacterium diphtheriae} Back     alignment and structure
>3ppl_A Aspartate aminotransferase; dimer, PLP-dependent transferase-like fold structural genomics, joint center for structural genomics; HET: MSE PLP UNL; 1.25A {Corynebacterium glutamicum} Back     alignment and structure
>1vjo_A Alanine--glyoxylate aminotransferase; 17130350, ALR1004, STR genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: PLP; 1.70A {Nostoc SP} SCOP: c.67.1.3 Back     alignment and structure
>3meb_A Aspartate aminotransferase; pyridoxal PHOS transferase, structural genomics, seattle structural genomi for infectious disease, ssgcid; HET: PLP; 1.90A {Giardia lamblia} Back     alignment and structure
>3kgw_A Alanine-glyoxylate aminotransferase; AAH25799.1, putative aminotransferase, structural genomics, center for structural genomics, JCSG; HET: PLP; 1.65A {Mus musculus} SCOP: c.67.1.3 PDB: 3kgx_A 3imz_A* 3r9a_A* 1h0c_A* 1j04_A* Back     alignment and structure
>2z9v_A Aspartate aminotransferase; pyridoxamine, pyruvate; HET: PXM; 1.70A {Mesorhizobium loti} PDB: 2z9u_A* 2z9w_A* 2z9x_A* Back     alignment and structure
>1ax4_A Tryptophanase; tryptophan biosynthesis, tryptophan indole-lyase, pyridoxal 5'-phosphate, monovalent cation binding site; HET: LLP; 2.10A {Proteus vulgaris} SCOP: c.67.1.2 Back     alignment and structure
>4eu1_A Mitochondrial aspartate aminotransferase; ssgcid, structural genomics, SEA structural genomics center for infectious disease; HET: LLP; 2.30A {Trypanosoma brucei} Back     alignment and structure
>1m32_A 2-aminoethylphosphonate-pyruvate aminotransferase; PLP-dependent aminotransferase fold; HET: PLP; 2.20A {Salmonella typhimurium} SCOP: c.67.1.3 Back     alignment and structure
>2dkj_A Serine hydroxymethyltransferase; PLP dependent enzyme, structural genomics; HET: PLP; 1.15A {Thermus thermophilus} Back     alignment and structure
>3ke3_A Putative serine-pyruvate aminotransferase; structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: LLP; 2.20A {Psychrobacter arcticus 273-4} Back     alignment and structure
>3zrp_A Serine-pyruvate aminotransferase (AGXT); HET: PLP; 1.75A {Sulfolobus solfataricus} PDB: 3zrq_A* 3zrr_A* Back     alignment and structure
>3cai_A Possible aminotransferase; RV3778C; 1.80A {Mycobacterium tuberculosis} Back     alignment and structure
>1svv_A Threonine aldolase; structural genomics, structural genomics of pathogenic proto SGPP, protein structure initiative, PSI; 2.10A {Leishmania major} SCOP: c.67.1.1 Back     alignment and structure
>1v72_A Aldolase; PLP-dependent enzyme, lyase; HET: PLP; 2.05A {Pseudomonas putida} SCOP: c.67.1.1 Back     alignment and structure
>3f0h_A Aminotransferase; RER070207000802, structural genomics, JOIN for structural genomics, JCSG; HET: MSE LLP; 1.70A {Eubacterium rectale} Back     alignment and structure
>3nnk_A Ureidoglycine-glyoxylate aminotransferase; PLP-dependent; HET: LLP; 2.58A {Klebsiella pneumoniae} Back     alignment and structure
>3lvm_A Cysteine desulfurase; structural genomics, montreal-kingston bacterial structural genomics initiative, BSGI, transferase; HET: PLP; 2.05A {Escherichia coli} PDB: 3lvk_A* 3lvl_B* 3lvj_A* 1p3w_B* Back     alignment and structure
>3isl_A Purine catabolism protein PUCG; pyridoxalphosphate, PLP dependent enzymes, purine metabolism transaminases, aminotransferases; HET: PLP; 2.06A {Bacillus subtilis} Back     alignment and structure
>3f6t_A Aspartate aminotransferase; YP_194538.1, STRU genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: LLP; 2.15A {Lactobacillus acidophilus ncfm} Back     alignment and structure
>7aat_A Aspartate aminotransferase; transferase(aminotransferase); HET: PLP; 1.90A {Gallus gallus} SCOP: c.67.1.1 PDB: 1ivr_A* 1map_A* 1maq_A* 1oxo_A* 1oxp_A* 1ama_A* 1tas_A* 1tat_A* 1tar_A* 8aat_A* 9aat_A* 1aka_A* 1akb_A* 1akc_A* 3pd6_A* 3hlm_A* 3pdb_A* Back     alignment and structure
>2yrr_A Aminotransferase, class V; structural genomics, NPPSFA, national PROJ protein structural and functional analyses; HET: PLP; 1.86A {Thermus thermophilus} PDB: 2yri_A* Back     alignment and structure
>2ez2_A Beta-tyrosinase, tyrosine phenol-lyase; PLP-dependent enzyme, pyridoxal-5'-phosphate, domain lyase; 1.85A {Citrobacter freundii} PDB: 2ez1_A 2vlf_A* 2vlh_A* 2yct_A* 1tpl_A 2tpl_A* 2ycn_A* 2yhk_A* 2ycp_A* 1c7g_A* Back     alignment and structure
>3e9k_A Kynureninase; kynurenine-L-hydrolase, kynurenine hydrolase, pyridoxal-5'-phosphate, inhibitor complex, 3-hydroxy hippur hydroxyhippuric acid, PLP; HET: PLP 3XH; 1.70A {Homo sapiens} PDB: 2hzp_A* Back     alignment and structure
>1jg8_A L-ALLO-threonine aldolase; glycine biosynthesis, pyridoxal-5'- phosphate, calcium binding site, structural genomics, PSI; HET: LLP; 1.80A {Thermotoga maritima} SCOP: c.67.1.1 PDB: 1lw4_A* 1lw5_A* 1m6s_A* 2fm1_A* Back     alignment and structure
>2huf_A Alanine glyoxylate aminotransferase; alpha and beta protein, PLP-dependent transferase; HET: LLP; 1.75A {Aedes aegypti} PDB: 2hui_A* 2huu_A* Back     alignment and structure
>3k7y_A Aspartate aminotransferase; aminotrans pyridoxal phosphate; HET: PLP; 2.80A {Plasmodium falciparum} SCOP: c.67.1.0 Back     alignment and structure
>2oqx_A Tryptophanase; lyase, pyridoxal phosphate, tryptophan catabolism; HET: CME EPE; 1.90A {Escherichia coli} SCOP: c.67.1.2 PDB: 2c44_A 2v1p_A* 2v0y_A* Back     alignment and structure
>2oga_A Transaminase; PLP-dependent enzyme, desosamine, deoxysugars, antibiotics, hydrolase; HET: PGU; 2.05A {Streptomyces venezuelae} PDB: 2oge_A* Back     alignment and structure
>4hvk_A Probable cysteine desulfurase 2; transferase and ISCS, transferase; HET: PMP PG4; 1.43A {Archaeoglobus fulgidus} PDB: 4eb7_A* 4eb5_A* Back     alignment and structure
>3tcm_A Alanine aminotransferase 2; pyridoxal phosphate (PLP)-binding; HET: DCS; 2.71A {Hordeum vulgare} Back     alignment and structure
>2rfv_A Methionine gamma-lyase; pyridoxal-5'-phosphate, PLP-dependent enzyme; HET: LLP; 1.35A {Citrobacter freundii} PDB: 1y4i_A* 3jwa_A* 3jw9_A* 3jwb_A* 3mkj_A* Back     alignment and structure
>2vi8_A Serine hydroxymethyltransferase; SHMT, E53Q, FTHF, enzyme memory, pyridoxal phosphate, one-carbon metabolism, PLP-dependent enzymes; HET: PLP; 1.67A {Bacillus stearothermophilus} PDB: 2vi9_A* 2via_A* 2vib_A* 1kkj_A* 1kkp_A* 1kl1_A* 1kl2_A* 1yjs_A* 2w7f_A* 2w7d_A* 2w7e_A* 2w7g_A* 2w7h_A* 1yjz_A* 1yjy_A* 2vgu_A* 2vgs_A* 2vgt_A* 2vgv_A* 2vgw_A* ... Back     alignment and structure
>1iug_A Putative aspartate aminotransferase; wild type, pyridoxal-5'-phosphate form, riken structural genomics/proteomics initiative, RSGI; HET: LLP; 2.20A {Thermus thermophilus} SCOP: c.67.1.3 Back     alignment and structure
>3mad_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxal phosphate; HET: LLP; 2.00A {Symbiobacterium thermophilum} PDB: 3maf_A* 3mau_A* 3mbb_A* Back     alignment and structure
>2ch1_A 3-hydroxykynurenine transaminase; PLP-enzyme, kynurenine pathway, transferase; HET: LLP; 2.4A {Anopheles gambiae} SCOP: c.67.1.3 PDB: 2ch2_A* Back     alignment and structure
>3ihj_A Alanine aminotransferase 2; helix, structural genomics, structural genomics consortium, pyridoxal phosphate; HET: PLP; 2.30A {Homo sapiens} Back     alignment and structure
>4eb5_A Probable cysteine desulfurase 2; scaffold, transferase-metal binding protein complex; HET: PLP EPE; 2.53A {Archaeoglobus fulgidus} PDB: 4eb7_A* Back     alignment and structure
>3a9z_A Selenocysteine lyase; PLP, cytoplasm, pyridoxal phosphate, transferase; HET: PLP SLP; 1.55A {Rattus norvegicus} PDB: 3a9x_A* 3a9y_A* 3gzd_A* 3gzc_A* 2hdy_A* Back     alignment and structure
>3ecd_A Serine hydroxymethyltransferase 2; ssgcid, decode, bupsa00008A, one-carbon metabolism, pyridoxa phosphate, structural genomics; 1.60A {Burkholderia pseudomallei} Back     alignment and structure
>3lws_A Aromatic amino acid beta-eliminating lyase/threonine aldolase; structural genomics, joint center for structural genomics, JCSG; HET: LLP MSE; 2.00A {Exiguobacterium sibiricum} Back     alignment and structure
>3vax_A Putative uncharacterized protein DNDA; desulfurase, transferase; HET: PLP; 2.40A {Streptomyces lividans} Back     alignment and structure
>3qhx_A Cystathionine gamma-synthase METB (CGS); structural genomics, seattle structural genomics center for infectious disease, ssgcid, CGS_LIKE; HET: LLP EPE; 1.65A {Mycobacterium ulcerans} SCOP: c.67.1.0 PDB: 3qi6_A* Back     alignment and structure
>1cs1_A CGS, protein (cystathionine gamma-synthase); lyase, LLP-dependent enzymes, methionine biosynthesis; HET: LLP DHD; 1.50A {Escherichia coli} SCOP: c.67.1.3 Back     alignment and structure
>2aeu_A Hypothetical protein MJ0158; selenocysteine synthase, PLP, pyridoxal phosphate, HOMO- oligomerization, unknown function; 1.70A {Methanocaldococcus jannaschii} SCOP: c.67.1.8 PDB: 2aev_A* Back     alignment and structure
>1mdo_A ARNB aminotransferase; type 1 aminotransferase fold; HET: MSE PMP; 1.70A {Salmonella typhimurium} SCOP: c.67.1.4 PDB: 1mdx_A* 1mdz_A* Back     alignment and structure
>3pj0_A LMO0305 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology, lyase; HET: LLP MSE; 1.80A {Listeria monocytogenes} Back     alignment and structure
>3n0l_A Serine hydroxymethyltransferase; alpha beta class, 3-layer(ABA) sandwich, CSGI transferase, structural genomics; HET: MSE; 1.80A {Campylobacter jejuni} SCOP: c.67.1.0 Back     alignment and structure
>1e5e_A MGL, methionine gamma-lyase; methionine biosynthesis, PLP-dependent enzymes, C-S gamma lyase; HET: PPJ; 2.18A {Trichomonas vaginalis} SCOP: c.67.1.3 PDB: 1e5f_A* Back     alignment and structure
>2bkw_A Alanine-glyoxylate aminotransferase 1; analine-glyoxylate aminotransferase, pyridoxal-5-phosphate, SAD, glycolate pathway; HET: LLP; 2.57A {Saccharomyces cerevisiae} SCOP: c.67.1.3 Back     alignment and structure
>1wyu_B Glycine dehydrogenase subunit 2 (P-protein); alpha(2)beta(2) tetramer, riken structural genomics/proteomi initiative, RSGI; HET: PLP; 2.10A {Thermus thermophilus} SCOP: c.67.1.7 PDB: 1wyt_B* 1wyv_B* Back     alignment and structure
>3acz_A Methionine gamma-lyase; L-methionine; HET: LLP; 1.97A {Entamoeba histolytica} PDB: 3aej_A* 3ael_A* 3aem_A* 3aen_A* 3aeo_A* 3aep_A* Back     alignment and structure
>1b9h_A AHBA synthase, protein (3-amino-5-hydroxybenzoic acid synthase); rifamycin biosynthesis (RIFD gene); HET: PLP; 2.00A {Amycolatopsis mediterranei} SCOP: c.67.1.4 PDB: 1b9i_A* Back     alignment and structure
>3ndn_A O-succinylhomoserine sulfhydrylase; seattle structural genomics center for infectious disease, S mycobacterium, PLP, schiff base; HET: LLP; 1.85A {Mycobacterium tuberculosis} Back     alignment and structure
>3uwc_A Nucleotide-sugar aminotransferase; lipopolysaccharide biosynthesis; HET: MSE PMP; 1.80A {Coxiella burnetii} Back     alignment and structure
>2po3_A 4-dehydrase; external aldimine, PLP, aminotransferase, TDP-sugar; HET: T4K; 2.10A {Streptomyces venezuelae} Back     alignment and structure
>2zy4_A L-aspartate beta-decarboxylase; pyridoxal 5'-phosphate, aminotransferase, lyase; HET: PLP; 2.00A {Alcaligenes faecalis subsp} PDB: 2zy3_A* 2zy5_A* 3fdd_A* 2zy2_A* Back     alignment and structure
>3h7f_A Serine hydroxymethyltransferase 1; cytoplasm, one-carbon metabolism, pyridoxal phosphate, structural genomics; HET: LLP; 1.50A {Mycobacterium tuberculosis} Back     alignment and structure
>3mc6_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxyl phosphate; HET: LLP; 3.15A {Saccharomyces cerevisiae} Back     alignment and structure
>1gc0_A Methionine gamma-lyase; pyridoxal-5'-phosphate; HET: LLP; 1.70A {Pseudomonas putida} SCOP: c.67.1.3 PDB: 1gc2_A* 1pg8_A* 1ukj_A* 2o7c_A* Back     alignment and structure
>3frk_A QDTB; aminotransferase, sugar-modification, natural porduct; HET: TQP; 2.15A {Thermoanaerobacteriumthermosaccharolyticum} Back     alignment and structure
>4h51_A Aspartate aminotransferase; ssgcid, structural genomics, seattle struc genomics center for infectious disease, aspartate aminotran transferase; HET: LLP; 1.85A {Leishmania major} Back     alignment and structure
>2cb1_A O-acetyl homoserine sulfhydrylase; PLP enzyme, lyase, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: LLP; 2.0A {Thermus thermophilus} Back     alignment and structure
>1ibj_A CBL, cystathionine beta-lyase; PLP-dependent enzyme, methionine biosynthesis, transsulfurat lyase; HET: PLP; 2.30A {Arabidopsis thaliana} SCOP: c.67.1.3 Back     alignment and structure
>3nyt_A Aminotransferase WBPE; PLP binding, nucleotide-sugar binding; HET: ULP; 1.30A {Pseudomonas aeruginosa} PDB: 3nys_A* 3nyu_A* 3nu8_A* 3nu7_A* 3nub_A* Back     alignment and structure
>3nmy_A Xometc, cystathionine gamma-lyase-like protein; Cys-Met metabolism PLP-dependent enzyme family, CYST gamma lyase, pyridoxal-phosphate; HET: PLP; 2.07A {Xanthomonas oryzae PV} SCOP: c.67.1.0 PDB: 3e6g_A* 3nnp_A* Back     alignment and structure
>3gbx_A Serine hydroxymethyltransferase; structural genomics, IDP01011, serine hydroxymethyltransfera salmonella typhimurium.; HET: MSE; 1.80A {Salmonella typhimurium} SCOP: c.67.1.4 PDB: 1dfo_A* 3g8m_A* 1eqb_A* Back     alignment and structure
>2fnu_A Aminotransferase; protein-product complex, structural genomics, montreal-kings bacterial structural genomics initiative, BSGI; HET: PMP UD1; 1.50A {Helicobacter pylori} SCOP: c.67.1.4 PDB: 2fni_A* 2fn6_A* Back     alignment and structure
>2qma_A Diaminobutyrate-pyruvate transaminase and L-2,4- diaminobutyrate decarboxylase; structural genomics, APC91511.1, glutamate decarboxylase; HET: MSE; 1.81A {Vibrio parahaemolyticus} Back     alignment and structure
>1o69_A Aminotransferase; structural genomics, unknown function; HET: X04; 1.84A {Campylobacter jejuni} SCOP: c.67.1.4 PDB: 1o62_A 1o61_A* Back     alignment and structure
>1pff_A Methionine gamma-lyase; homocysteine; 2.50A {Trichomonas vaginalis} SCOP: c.67.1.3 Back     alignment and structure
>3dr4_A Putative perosamine synthetase; deoxysugar, pyridoxal phosphate, aspartate aminotransferase, O-antigen; HET: G4M; 1.60A {Caulobacter crescentus} PDB: 3dr7_A* 3bn1_A* Back     alignment and structure
>3ffr_A Phosphoserine aminotransferase SERC; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: LLP MSE P33; 1.75A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>1qgn_A Protein (cystathionine gamma-synthase); methionine biosynthesis, pyridoxal 5'-phosphate, gamma-famil; HET: PLP; 2.90A {Nicotiana tabacum} SCOP: c.67.1.3 PDB: 1i41_A* 1i48_A* 1i43_A* Back     alignment and structure
>2ctz_A O-acetyl-L-homoserine sulfhydrylase; crystal, O-acetyl homoserine sulfhydrase, structural genomic structural genomics/proteomics initiative; HET: PLP; 2.60A {Thermus thermophilus} SCOP: c.67.1.3 Back     alignment and structure
>1n8p_A Cystathionine gamma-lyase; three open alpha/beta structures; HET: PLP; 2.60A {Saccharomyces cerevisiae} SCOP: c.67.1.3 Back     alignment and structure
>3cog_A Cystathionine gamma-lyase; CTH, PLP, propargylglycine, SGC, inhibitor, structural genom stockholm, structural genomics consortium; HET: PLP; 2.00A {Homo sapiens} PDB: 2nmp_A* 3elp_B Back     alignment and structure
>3b8x_A WBDK, pyridoxamine 5-phosphate-dependent dehydrase; aspartate aminotransferase, colitose, perosamine, O-antigen, pyridoxal phosphate,; HET: G4M; 1.70A {Escherichia coli} PDB: 2gms_A* 2gmu_A* 2r0t_A* 3gr9_A* Back     alignment and structure
>2c81_A Glutamine-2-deoxy-scyllo-inosose aminotransferase; SMAT, butirosin, aminoglycoside antibiotics; HET: PMP; 1.7A {Bacillus circulans} PDB: 2c7t_A* Back     alignment and structure
>2jis_A Cysteine sulfinic acid decarboxylase; pyridoxal phosphate, alternative splicing, pyridoxal phosphate (PLP), structural genomics consortium (SGC); HET: PLP; 1.6A {Homo sapiens} Back     alignment and structure
>2okj_A Glutamate decarboxylase 1; PLP-dependent decarboxylase, lyase; HET: LLP PLZ; 2.30A {Homo sapiens} PDB: 2okk_A* Back     alignment and structure
>2z67_A O-phosphoseryl-tRNA(SEC) selenium transferase; selenocysteine biosynthesis, seven-stranded BETE-strand, PYR 5'-phosphate; HET: PLP; 2.50A {Methanococcus maripaludis} SCOP: c.67.1.9 Back     alignment and structure
>3bwn_A AT1G70560, L-tryptophan aminotransferase; auxin synthesis, pyridoxal-5'- phosphate, indole-3-pyruvate; HET: LLP PMP PHE; 2.25A {Arabidopsis thaliana} PDB: 3bwo_A* Back     alignment and structure
>2x3l_A ORN/Lys/Arg decarboxylase family protein; lyase; HET: LLP; 2.00A {Staphylococcus aureus} Back     alignment and structure
>3ht4_A Aluminum resistance protein; lyase, putative cystathionine BEAT-lyase, aluminium resistance protein, Q81A77_baccr, NESG, BCR213; 2.90A {Bacillus cereus atcc 14579} Back     alignment and structure
>1w23_A Phosphoserine aminotransferase; pyridoxal-5'-phosphate; HET: PGE PLP EPE; 1.08A {Bacillus alcalophilus} SCOP: c.67.1.4 PDB: 2bhx_A* 2bi1_A* 2bi2_A* 2bi3_A* 2bi5_A* 2bi9_A* 2bia_A* 2bie_A* 2big_A* Back     alignment and structure
>2dgk_A GAD-beta, GADB, glutamate decarboxylase beta; gadbd1-14, autoinhibition, substituted aldamine, lyase; HET: PLP; 1.90A {Escherichia coli} PDB: 2dgm_A* 1pmo_A* 2dgl_A* 1pmm_A* 3fz6_A* 3fz7_A 3fz8_A* 1xey_A* Back     alignment and structure
>3ri6_A O-acetylhomoserine sulfhydrylase; PYR 5'-phosphate, gamma-elimination, direct sulfhydrylation, CY metabolism, protein thiocarboxylate, TR; 2.20A {Wolinella succinogenes} Back     alignment and structure
>2c0r_A PSAT, phosphoserine aminotransferase; pyridoxal-5'-phosphate, pyridine serine biosynthesis, amino-acid biosynthesis, pyridoxal phosphate; HET: PLP; 1.2A {Bacillus circulans} SCOP: c.67.1.4 PDB: 1bt4_A* 1w3u_A* Back     alignment and structure
>1rv3_A Serine hydroxymethyltransferase, cytosolic; one-carbon metabolism; HET: GLY PLP; 2.40A {Oryctolagus cuniculus} SCOP: c.67.1.4 PDB: 1rv4_A* 1rvu_A* 1rvy_A* 1ls3_A* 1cj0_A* 1bj4_A* 1eji_A* Back     alignment and structure
>2a7v_A Serine hydroxymethyltransferase; structural genomics, structural genomics consortium, SGC; 2.04A {Homo sapiens} PDB: 3ou5_A Back     alignment and structure
>2fq6_A Cystathionine beta-lyase; protein-inhibitor complex, PLP cofactor covalently bound to inhibitor; HET: P3F; 1.78A {Escherichia coli} SCOP: c.67.1.3 PDB: 2gqn_A* 1cl1_A* 1cl2_A* Back     alignment and structure
>3ju7_A Putative PLP-dependent aminotransferase; NP_978343.1, struct genomics, joint center for structural genomics, JCSG; HET: LLP PGE; 2.19A {Bacillus cereus atcc 10987} Back     alignment and structure
>2hox_A ALLIIN lyase 1; cysteine sulphoxide lyase, ALLIINASE; HET: NAG FUC BMA P1T; 1.40A {Allium sativum} SCOP: c.67.1.1 PDB: 2hor_A* 1lk9_A* Back     alignment and structure
>3jzl_A Putative cystathionine beta-lyase involved in ALU resistance; putative cystathionine beta-lyase involved in aluminum resis structural genomics; HET: LLP; 1.91A {Listeria monocytogenes str} PDB: 3fd0_A* Back     alignment and structure
>4e1o_A HDC, histidine decarboxylase; lyase; HET: PLP PVH; 1.80A {Homo sapiens} Back     alignment and structure
>1js3_A DDC;, DOPA decarboxylase; carbidopa, parkinson'S disease, vitamin; HET: PLP 142; 2.25A {Sus scrofa} SCOP: c.67.1.6 PDB: 1js6_A* 3rch_A* 3rbl_A 3rbf_A* Back     alignment and structure
>3k40_A Aromatic-L-amino-acid decarboxylase; PLP dependent protein, alpha beta protein, alternative splicing, catecholamine biosynthesis, lyase; HET: LLP; 1.75A {Drosophila melanogaster} SCOP: c.67.1.6 Back     alignment and structure
>3hbx_A GAD 1, glutamate decarboxylase 1; calmodulin-binding, lyase, pyridoxal phosphate; HET: LLP; 2.67A {Arabidopsis thaliana} Back     alignment and structure
>3vp6_A Glutamate decarboxylase 1; catalytic loop SWAP, lyase; HET: LLP HLD; 2.10A {Homo sapiens} PDB: 2okj_A* 2okk_A* Back     alignment and structure
>2fyf_A PSAT, phosphoserine aminotransferase; PLP-dependent enzyme, dimer, structural genomics; HET: PLP; 1.50A {Mycobacterium tuberculosis} PDB: 3vom_A* Back     alignment and structure
>3hvy_A Cystathionine beta-lyase family protein, YNBB B.S ortholog; NP_348457.1, putative cystathionine beta-lyase involved in A resistance; HET: LLP MSE; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>3i16_A Aluminum resistance protein; YP_878183.1, carbon-sulfur lyase involved in aluminum resist structural genomics; HET: MSE TLA PLP; 2.00A {Clostridium novyi} PDB: 3gwp_A* Back     alignment and structure
>1c4k_A Protein (ornithine decarboxylase); lyase; HET: PLP GTP; 2.70A {Lactobacillus SP} SCOP: c.23.1.4 c.67.1.5 d.125.1.1 PDB: 1ord_A* Back     alignment and structure
>3n75_A LDC, lysine decarboxylase, inducible; pyridoxal-5'-phosphate dependent decarboxylase, acid stress stringent response; HET: LLP G4P P6G; 2.00A {Escherichia coli} PDB: 3q16_A* Back     alignment and structure
>2vyc_A Biodegradative arginine decarboxylase; pyridoxal phosphate, PLP-dependent E lyase, acid resistance; HET: LLP; 2.4A {Escherichia coli} Back     alignment and structure
>1wyu_A Glycine dehydrogenase (decarboxylating) subunit 1; alpha(2)beta(2) tetramer, riken structural genomics/proteomi initiative, RSGI; HET: PLP; 2.10A {Thermus thermophilus} SCOP: c.67.1.7 PDB: 1wyt_A* 1wyv_A* Back     alignment and structure
>3hl2_A O-phosphoseryl-tRNA(SEC) selenium transferase; selenocysteine, sepsecs, protein-RNA complex, alternative splicing, cytoplasm, protein biosynthesis, pyridoxal phosphate, selenium; HET: PLR SEP; 2.81A {Homo sapiens} Back     alignment and structure
>3bc8_A O-phosphoseryl-tRNA(SEC) selenium transferase; disorder-order transition, phosphate-loop, pyridoxal phospha selenocysteine synthase (SECS, sepsecs); HET: LLP; 1.65A {Mus musculus} SCOP: c.67.1.9 PDB: 3bca_A* 3bcb_A* Back     alignment and structure
>3e77_A Phosphoserine aminotransferase; SERC, PLP, structural genomi structural genomics consortium, SGC, amino-acid biosynthesi aminotransferase; HET: PLP; 2.50A {Homo sapiens} Back     alignment and structure
>3m5u_A Phosphoserine aminotransferase; alpha-beta half sandwich, csgid, amino-acid biosynthesis, cytoplasm, pyridoxal phosphate; HET: MES; 2.15A {Campylobacter jejuni} SCOP: c.67.1.0 Back     alignment and structure
>3qm2_A Phosphoserine aminotransferase; structural genomics, center for structural genomics of infec diseases, csgid; 2.25A {Salmonella enterica subsp} PDB: 1bjn_A* 1bjo_A* 3qbo_A* Back     alignment and structure
>3ou5_A Serine hydroxymethyltransferase, mitochondrial; structural genomics, STRU genomics consortium, SGC; 2.04A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 476
d2gsaa_427 c.67.1.4 (A:) Glutamate-1-semialdehyde aminomutase 1e-141
d1sffa_425 c.67.1.4 (A:) 4-aminobutyrate aminotransferase, GA 7e-78
d1z7da1404 c.67.1.4 (A:7-410) Ornithine aminotransferase {Pla 3e-65
d2byla1404 c.67.1.4 (A:36-439) Ornithine aminotransferase {Hu 4e-65
d1vefa1387 c.67.1.4 (A:9-395) Acetylornithine/acetyl-lysine a 8e-64
d1zoda1431 c.67.1.4 (A:3-433) Dialkylglycine decarboxylase {P 4e-45
d1s0aa_429 c.67.1.4 (A:) Adenosylmethionine-8-amino-7-oxonona 2e-40
d1ohwa_461 c.67.1.4 (A:) 4-aminobutyrate aminotransferase, GA 1e-26
d2v1pa1467 c.67.1.2 (A:5-471) Tryptophan indol-lyase (tryptop 2e-14
d1ax4a_465 c.67.1.2 (A:) Tryptophan indol-lyase (tryptophanas 7e-13
d1m6sa_343 c.67.1.1 (A:) Low-specificity threonine aldolase { 2e-11
d1fc4a_401 c.67.1.4 (A:) 2-amino-3-ketobutyrate CoA ligase {E 2e-10
d1bs0a_383 c.67.1.4 (A:) PLP-dependent acyl-CoA synthase (8-a 5e-07
d1v72a1345 c.67.1.1 (A:6-350) Phenylserine aldolase PSALD {Ps 9e-07
d2z67a1434 c.67.1.9 (A:1-434) Selenocysteinyl-tRNA synthase ( 1e-06
>d2gsaa_ c.67.1.4 (A:) Glutamate-1-semialdehyde aminomutase (aminotransferase) {Synechococcus sp., strain GR6 [TaxId: 1131]} Length = 427 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: PLP-dependent transferase-like
superfamily: PLP-dependent transferases
family: GABA-aminotransferase-like
domain: Glutamate-1-semialdehyde aminomutase (aminotransferase)
species: Synechococcus sp., strain GR6 [TaxId: 1131]

 Score =  411 bits (1056), Expect = e-141
 Identities = 308/423 (72%), Positives = 357/423 (84%)

Query: 48  FTLKKSEEAFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGS 107
           F   KS+E F  A++LMPGGV+SPVRAFKSVGGQPIVFD VK ++ WD+DGN YIDYVG+
Sbjct: 1   FKTIKSDEIFAAAQKLMPGGVSSPVRAFKSVGGQPIVFDRVKDAYAWDVDGNRYIDYVGT 60

Query: 108 WGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEA 167
           WGPAI GHA  +V+ AL   M+KGTSFGAPC LENVLAEMV  AVPSIEMVRFVNSGTEA
Sbjct: 61  WGPAICGHAHPEVIEALKVAMEKGTSFGAPCALENVLAEMVNDAVPSIEMVRFVNSGTEA 120

Query: 168 CMGVLRLARAFTGRERIIKFEGCYHGHADPFLVKAGSGVATLGLPDSPGVPKGATYETLT 227
           CM VLRL RA+TGR++IIKFEGCYHGHAD FLVKAGSGVATLGLP SPGVPK  T  TLT
Sbjct: 121 CMAVLRLMRAYTGRDKIIKFEGCYHGHADMFLVKAGSGVATLGLPSSPGVPKKTTANTLT 180

Query: 228 APFNDVSALENLFENNKGEIAAIILEPVVGNSGFIAPKPDFLNAIRRITKENGALLIFDE 287
            P+ND+ A++ LF  N GEIA +ILEP+VGNSGFI P   FL  +R IT E+ ALL+FDE
Sbjct: 181 TPYNDLEAVKALFAENPGEIAGVILEPIVGNSGFIVPDAGFLEGLREITLEHDALLVFDE 240

Query: 288 VMTGFRLAYGGAQEYFGVTPDLTTLGKIIGGGLPVGAYGGRRDIMEMVAPAGPMYQAGTL 347
           VMTGFR+AYGG QE FGVTPDLTTLGKIIGGGLPVGAYGG+R+IM++VAPAGPMYQAGTL
Sbjct: 241 VMTGFRIAYGGVQEKFGVTPDLTTLGKIIGGGLPVGAYGGKREIMQLVAPAGPMYQAGTL 300

Query: 348 SGNPLAMTAGIHTLKRLKEPGTYEYLNKITGELTQGIIDAGKKAGHAICGGYISGMFGFF 407
           SGNPLAMTAGI TL+ L++PGTYEYL++IT  L+ G++   ++ GHA CGG +SGMFGFF
Sbjct: 301 SGNPLAMTAGIKTLELLRQPGTYEYLDQITKRLSDGLLAIAQETGHAACGGQVSGMFGFF 360

Query: 408 FTEGPVYNFEDAKKSETTKFARFYRGMLEEGVYFAPSQFEAGFTSLAHSSDDIQHTITAA 467
           FTEGPV+N+EDAKKS+  KF+RF+RGMLE+G+Y APSQFEAGFTSLAH+ +DI  T+ AA
Sbjct: 361 FTEGPVHNYEDAKKSDLQKFSRFHRGMLEQGIYLAPSQFEAGFTSLAHTEEDIDATLAAA 420

Query: 468 EKV 470
             V
Sbjct: 421 RTV 423
>d1sffa_ c.67.1.4 (A:) 4-aminobutyrate aminotransferase, GABA-aminotransferase {Escherichia coli [TaxId: 562]} Length = 425 Back     information, alignment and structure
>d1z7da1 c.67.1.4 (A:7-410) Ornithine aminotransferase {Plasmodium yoelii yoelii [TaxId: 73239]} Length = 404 Back     information, alignment and structure
>d2byla1 c.67.1.4 (A:36-439) Ornithine aminotransferase {Human (Homo sapiens) [TaxId: 9606]} Length = 404 Back     information, alignment and structure
>d1vefa1 c.67.1.4 (A:9-395) Acetylornithine/acetyl-lysine aminotransferase ArgD {Thermus thermophilus [TaxId: 274]} Length = 387 Back     information, alignment and structure
>d1zoda1 c.67.1.4 (A:3-433) Dialkylglycine decarboxylase {Pseudomonas cepacia [TaxId: 292]} Length = 431 Back     information, alignment and structure
>d1s0aa_ c.67.1.4 (A:) Adenosylmethionine-8-amino-7-oxononanoate aminotransferase, BioA {Escherichia coli [TaxId: 562]} Length = 429 Back     information, alignment and structure
>d1ohwa_ c.67.1.4 (A:) 4-aminobutyrate aminotransferase, GABA-aminotransferase {Pig (Sus scrofa) [TaxId: 9823]} Length = 461 Back     information, alignment and structure
>d2v1pa1 c.67.1.2 (A:5-471) Tryptophan indol-lyase (tryptophanase) {Escherichia coli [TaxId: 562]} Length = 467 Back     information, alignment and structure
>d1ax4a_ c.67.1.2 (A:) Tryptophan indol-lyase (tryptophanase) {Proteus vulgaris [TaxId: 585]} Length = 465 Back     information, alignment and structure
>d1m6sa_ c.67.1.1 (A:) Low-specificity threonine aldolase {Thermotoga maritima [TaxId: 2336]} Length = 343 Back     information, alignment and structure
>d1fc4a_ c.67.1.4 (A:) 2-amino-3-ketobutyrate CoA ligase {Escherichia coli [TaxId: 562]} Length = 401 Back     information, alignment and structure
>d1bs0a_ c.67.1.4 (A:) PLP-dependent acyl-CoA synthase (8-amino-7-oxonanoate synthase, AONS) {Escherichia coli [TaxId: 562]} Length = 383 Back     information, alignment and structure
>d1v72a1 c.67.1.1 (A:6-350) Phenylserine aldolase PSALD {Pseudomonas putida [TaxId: 303]} Length = 345 Back     information, alignment and structure
>d2z67a1 c.67.1.9 (A:1-434) Selenocysteinyl-tRNA synthase (SepSecS) {Methanococcus maripaludis [TaxId: 39152]} Length = 434 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query476
d2gsaa_427 Glutamate-1-semialdehyde aminomutase (aminotransfe 100.0
d1sffa_425 4-aminobutyrate aminotransferase, GABA-aminotransf 100.0
d2byla1404 Ornithine aminotransferase {Human (Homo sapiens) [ 100.0
d1vefa1387 Acetylornithine/acetyl-lysine aminotransferase Arg 100.0
d1zoda1431 Dialkylglycine decarboxylase {Pseudomonas cepacia 100.0
d1z7da1404 Ornithine aminotransferase {Plasmodium yoelii yoel 100.0
d1s0aa_429 Adenosylmethionine-8-amino-7-oxononanoate aminotra 100.0
d1ohwa_461 4-aminobutyrate aminotransferase, GABA-aminotransf 100.0
d1fc4a_401 2-amino-3-ketobutyrate CoA ligase {Escherichia col 100.0
d1bs0a_383 PLP-dependent acyl-CoA synthase (8-amino-7-oxonano 100.0
d2bwna1396 5-aminolevulinate synthase {Rhodobacter capsulatus 100.0
d1b5pa_382 Aspartate aminotransferase, AAT {Thermus thermophi 99.97
d1j32a_388 Aspartate aminotransferase, AAT {Phormidium lapide 99.96
d1gdea_388 Aromatic aminoacid aminotransferase, AroAT {Archae 99.96
d2r5ea1418 Kynurenine--oxoglutarate transaminase I {Yellowfev 99.95
d1v2da_368 Glutamine aminotransferase {Thermus thermophilus [ 99.95
d1c7na_394 Cystalysin {Treponema denticola [TaxId: 158]} 99.95
d1d2fa_361 Modulator in mal gene expression, MalY {Escherichi 99.94
d1xi9a_395 Putative alanine aminotransferase {Pyrococcus furi 99.94
d1o4sa_375 Aspartate aminotransferase, AAT {Thermotoga mariti 99.94
d1lc5a_355 L-threonine-O-3-phosphate decarboxylase CobD {Salm 99.94
d1wsta1403 Multiple substrate aminotransferase, MSAT {Thermoc 99.94
d1w7la_418 Kynurenine--oxoglutarate transaminase I {Human (Ho 99.93
d2gb3a1389 AAT homologue TM1698 {Thermotoga maritima [TaxId: 99.93
d1m6sa_343 Low-specificity threonine aldolase {Thermotoga mar 99.93
d1bw0a_412 Tyrosine aminotransferase (TAT) {Trypanosoma cruzi 99.92
d1u08a_382 Putative methionine aminotransferase YdbL {Escheri 99.92
d1vp4a_420 Putative aminotransferase TM1131 {Thermotoga marit 99.92
d1iaya_428 1-aminocyclopropane-1-carboxylate synthase (ACC sy 99.91
d1m7ya_431 1-aminocyclopropane-1-carboxylate synthase (ACC sy 99.91
d2f8ja1334 Histidinol-phosphate aminotransferase HisC {Thermo 99.91
d1v72a1345 Phenylserine aldolase PSALD {Pseudomonas putida [T 99.9
d1fg7a_354 Histidinol-phosphate aminotransferase HisC {Escher 99.89
d1ax4a_465 Tryptophan indol-lyase (tryptophanase) {Proteus vu 99.88
d7aata_401 Aspartate aminotransferase, AAT {Chicken (Gallus g 99.88
d1ajsa_412 Aspartate aminotransferase, AAT {Pig (Sus scrofa), 99.88
d2q7wa1396 Aspartate aminotransferase, AAT {Escherichia coli 99.87
d1yaaa_412 Aspartate aminotransferase, AAT {Baker's yeast (Sa 99.86
d2v1pa1467 Tryptophan indol-lyase (tryptophanase) {Escherichi 99.85
d2e7ja1364 Selenocysteinyl-tRNA synthase (SepSecS) {Archaeogl 99.84
d2aeua1366 Hypothetical protein MJ0158 {Archaeon Methanococcu 99.83
d3tata_397 Aromatic aminoacid aminotransferase, AroAT {Escher 99.83
d2ay1a_394 Aromatic aminoacid aminotransferase, AroAT {Paraco 99.83
d1svva_340 Low-specificity threonine aldolase {Leishmania maj 99.81
d1elua_381 Cystine C-S lyase C-des {Synechocystis sp. [TaxId: 99.79
d1p3wa_391 Cysteine desulfurase IscS {Escherichia coli [TaxId 99.78
d1jf9a_405 NifS-like protein/selenocysteine lyase {Escherichi 99.77
d1t3ia_408 Probable cysteine desulfurase SufS {Synechocystis 99.74
d2hoxa1425 Alliinase {Garlic (Allium sativum) [TaxId: 4682]} 99.74
d2z67a1434 Selenocysteinyl-tRNA synthase (SepSecS) {Methanoco 99.73
d1h0ca_388 Alanine-glyoxylate aminotransferase {Human (Homo s 99.7
d1qz9a_404 Kynureninase {Pseudomonas fluorescens [TaxId: 294] 99.69
d1c7ga_456 Tyrosine phenol-lyase {Erwinia herbicola [TaxId: 5 99.68
d1eg5a_376 NifS-like protein/selenocysteine lyase {Thermotoga 99.68
d3bc8a1445 Selenocysteinyl-tRNA synthase (SepSecS) {Mouse (Mu 99.66
d1m32a_361 2-aminoethylphosphonate transaminase {Salmonella t 99.65
d1mdoa_376 Aminotransferase ArnB {Salmonella typhimurium [Tax 99.63
d1b9ha_384 3-amino-5-hydroxybenzoic acid synthase (AHBA synth 99.62
d1gc0a_392 Methionine gamma-lyase, MGL {Pseudomonas putida [T 99.6
d1c4ka2462 Ornithine decarboxylase major domain {Lactobacillu 99.59
d2bkwa1382 Alanine-glyoxylate aminotransferase {Baker's yeast 99.58
d1js3a_476 DOPA decarboxylase {Pig (Sus scrofa) [TaxId: 9823] 99.56
d1vjoa_377 Alanine-glyoxylate aminotransferase {Cyanobacteria 99.56
d1qgna_398 Cystathionine gamma-synthase, CGS {Common tobacco 99.55
d1y4ia1397 Methionine gamma-lyase, MGL {Citrobacter freundii 99.55
d1o69a_374 Aminotransferase homolog WlaK (PglE, Cj1121c) {Cam 99.55
d1cs1a_384 Cystathionine gamma-synthase, CGS {Escherichia col 99.53
d1ibja_380 Cystathionine beta-lyase, CBL {Thale cress (Arabid 99.53
d2ch1a1388 3-hydroxykynurenine transaminase {Malaria mosquito 99.49
d2fnua1371 Spore coat polysaccharide biosynthesis protein C { 99.49
d1cl1a_391 Cystathionine beta-lyase, CBL {Escherichia coli [T 99.48
d1pffa_331 Methionine gamma-lyase, MGL {Trichomonas vaginalis 99.47
d1e5ea_394 Methionine gamma-lyase, MGL {Trichomonas vaginalis 99.46
d1iuga_348 Subgroup IV putative aspartate aminotransferase {T 99.45
d1pmma_450 Glutamate decarboxylase beta, GadB {Escherichia co 99.44
d1n8pa_393 Cystathionine gamma-lyase (CYS3) {Baker's yeast (S 99.38
d2ctza1421 O-acetyl-L-homoserine sulfhydrylase {Thermus therm 99.3
d2c0ra1361 Phosphoserine aminotransferase, PSAT {Bacillus cir 99.21
d1kl1a_405 Serine hydroxymethyltransferase {Bacillus stearoth 99.17
d1dfoa_416 Serine hydroxymethyltransferase {Escherichia coli 99.17
d1w23a_360 Phosphoserine aminotransferase, PSAT {Bacillus alc 99.1
d1bjna_360 Phosphoserine aminotransferase, PSAT {Escherichia 99.01
d2a7va1463 Serine hydroxymethyltransferase {Human (Homo sapie 98.94
d1rv3a_470 Serine hydroxymethyltransferase {Rabbit (Oryctolag 98.93
d1wyub1471 Glycine dehydrogenase subunit 2 (P-protein) {Therm 98.81
d1wyua1437 Glycine dehydrogenase (decarboxylating) subunit 1 98.79
>d2gsaa_ c.67.1.4 (A:) Glutamate-1-semialdehyde aminomutase (aminotransferase) {Synechococcus sp., strain GR6 [TaxId: 1131]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: PLP-dependent transferase-like
superfamily: PLP-dependent transferases
family: GABA-aminotransferase-like
domain: Glutamate-1-semialdehyde aminomutase (aminotransferase)
species: Synechococcus sp., strain GR6 [TaxId: 1131]

Probab=100.00  E-value=1.2e-78  Score=609.21  Aligned_cols=426  Identities=72%  Similarity=1.203  Sum_probs=394.3

Q ss_pred             CChhHHHHHHHHhhhCCCCCCCccccccccCCCCeEEEeecCCEEEEcCCCEEEecccChhhccCCCCcHHHHHHHHHHH
Q 011856           49 TLKKSEEAFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETM  128 (476)
Q Consensus        49 ~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~p~~~~~~~G~~~~d~dG~~~iD~~~~~~~~~lG~~~p~v~~a~~~~l  128 (476)
                      ++.+|+++++++++++|+|+++++|.|..++++|+++++++|+|+||.|||+||||.++++++++||+||+|++|+++|+
T Consensus         2 ~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~P~~i~~a~G~~l~D~~G~~ylD~~~~~~~~~lGh~hp~i~~ai~~~~   81 (427)
T d2gsaa_           2 KTIKSDEIFAAAQKLMPGGVSSPVRAFKSVGGQPIVFDRVKDAYAWDVDGNRYIDYVGTWGPAICGHAHPEVIEALKVAM   81 (427)
T ss_dssp             CCHHHHHHHHHHHHHSGGGSSSGGGCCTTTSSCCCCEEEEEBTEEEETTSCEEEESSGGGTTTTTCBTCHHHHHHHHHHH
T ss_pred             CchhHHHHHHHHHhhcCCCCCCCccccccCCCCCcEEEEeecCEEEECCCCEEEEechhHHHHhccCCcHHHHHHHHHHH
Confidence            57889999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HhcCCCCCCCHHHHHHHHHHHhhCCCCCeEEEeCCHHHHHHHHHHHHHhccCCceEEEEeCCCCCCchhHHhhcCCCCcc
Q 011856          129 KKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIIKFEGCYHGHADPFLVKAGSGVAT  208 (476)
Q Consensus       129 ~~~~~~~~~~~~~~~la~~l~~~~~~~e~v~~~~sGseA~~~al~~ar~~~~~~~ii~~~~~yhg~~~~~~~~~g~~~~~  208 (476)
                      +++.....+.....++++++.+..|..++++|++||+||++.|+|+||.+++|.+||.++++|||++..++..++.+...
T Consensus        82 ~~~~~~~~~~~~~~~la~~~~~~~~~~~~v~f~~sGseA~e~Alk~ar~~t~r~~ii~~~~~yHG~t~~~~~~~~~~~~~  161 (427)
T d2gsaa_          82 EKGTSFGAPCALENVLAEMVNDAVPSIEMVRFVNSGTEACMAVLRLMRAYTGRDKIIKFEGCYHGHADMFLVKAGSGVAT  161 (427)
T ss_dssp             TTCSCCSSCCHHHHHHHHHHHHHSTTCSEEEEESSHHHHHHHHHHHHHHHHCCCEEEEETTCCCCSCGGGCSSCCHHHHH
T ss_pred             HhcCccccchhHHHHHHHHHHhhCCccccccccCCcHHHHHHHHHHHHHhcCCCeEEEEecccccCcceeeeecCCcccc
Confidence            99777777888889999999999888899999999999999999999999999999999999999999999888776655


Q ss_pred             CCCCCCCCCCCCCCCceeeccCCCHHHHHHHHhcCCCCeEEEEEcccCCCCCcccCCHHHHHHHHHHHHHhCCEEEEecc
Q 011856          209 LGLPDSPGVPKGATYETLTAPFNDVSALENLFENNKGEIAAIILEPVVGNSGFIAPKPDFLNAIRRITKENGALLIFDEV  288 (476)
Q Consensus       209 ~~~~~~~~~~~~~~~~~~~~~~~d~~~le~~l~~~~~~~a~vi~ep~~~~~G~i~~~~~~l~~l~~l~~~~g~llI~DEv  288 (476)
                      ...|..+++......+...++++|++++|++++++++++++||+||+++++|.+.|+++||++|+++|++||++||+|||
T Consensus       162 ~~~p~~~~~~~~~~~~~~~~~~~~~~~le~~~~~~~~~iaavi~Epi~g~~G~~~~~~~~l~~l~~lc~~~~~llI~DEv  241 (427)
T d2gsaa_         162 LGLPSSPGVPKKTTANTLTTPYNDLEAVKALFAENPGEIAGVILEPIVGNSGFIVPDAGFLEGLREITLEHDALLVFDEV  241 (427)
T ss_dssp             TTCCSCSSSCHHHHTTEEEECTTCHHHHHHHHTTSTTTEEEEEECSSBCSSSCBCCCTTHHHHHHHHHHHTTCEEEEECT
T ss_pred             cCCCCCCCCcccCccceeccCcchHHHHHHHHHhCCCCeEEEEEcCCcCCCCCccCCHHHHHHHHHHHHHhceeeeeccc
Confidence            55566666655556678889999999999999988889999999999999999999999999999999999999999999


Q ss_pred             ccCccccccchhhccCCCCchhhhhhhcCCCCcEEEEEecHHHHHhhcCCCCccccCCCCCcHHHHHHHHHHHHHhcCCC
Q 011856          289 MTGFRLAYGGAQEYFGVTPDLTTLGKIIGGGLPVGAYGGRRDIMEMVAPAGPMYQAGTLSGNPLAMTAGIHTLKRLKEPG  368 (476)
Q Consensus       289 ~~g~r~g~~~~~~~~g~~pDi~t~sK~lg~G~~iG~~~~~~~i~~~l~~~~~~~~~~t~~~~~~~~aaa~aal~~~~~~~  368 (476)
                      ++|||+|.+|+++++|+.|||+|+||++++|+|+|++++++++++.+.+.+...+++||++||++|+|++++|+++++++
T Consensus       242 ~tG~r~g~~~~~~~~gi~PDi~~~gK~lggG~p~~a~~~~~~i~~~~~~~~~~~~~~T~~gnpla~AAala~Le~i~~~~  321 (427)
T d2gsaa_         242 MTGFRIAYGGVQEKFGVTPDLTTLGKIIGGGLPVGAYGGKREIMQLVAPAGPMYQAGTLSGNPLAMTAGIKTLELLRQPG  321 (427)
T ss_dssp             TTBTTTBTTCHHHHTTCCCSEEEECGGGGTTSCCEEEEECHHHHTTBTTTSSBCCCCTTTTCHHHHHHHHHHHHHHTSTT
T ss_pred             cccceecccchHHhcCCCHHHHhhhhccCCCcceeeeeehHHHHHHhcccCCCcCCCCCCCCchhhHHHHHhhHHhhhhh
Confidence            99998899999999999999999999999999999999999999998866667889999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHhhhcCCceEeeeeceeEEEEEecCCCcCchhhcccchHHHHHHHHHHHHCCeEeccCCCcc
Q 011856          369 TYEYLNKITGELTQGIIDAGKKAGHAICGGYISGMFGFFFTEGPVYNFEDAKKSETTKFARFYRGMLEEGVYFAPSQFEA  448 (476)
Q Consensus       369 ~~~~~~~~~~~l~~~L~~~~~~~~~~~~v~~~g~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~Gv~~~~~~~~~  448 (476)
                      +.+++++++++|+++|+++..+++....+.+.|.|+++.+...++.++.+....+......+...|+++||++.|+....
T Consensus       322 l~~~~~~~g~~l~~~L~~l~~~~~~~~~v~~~ggm~~i~~~~~~v~~~~~~~~~d~~~~~~~~~~ll~~Gv~l~p~~~~~  401 (427)
T d2gsaa_         322 TYEYLDQITKRLSDGLLAIAQETGHAACGGQVSGMFGFFFTEGPVHNYEDAKKSDLQKFSRFHRGMLEQGIYLAPSQFEA  401 (427)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHTTCCCEEEEETTEEEEESSSCCCCSHHHHTTSCHHHHHHHHHHHHHTTEECCSSTTSC
T ss_pred             HHhhhhHHHHHHHHHHHHHHhhcCCCcEEcccCCeEEEEEeccCCCCHHHhhcccHHHHHHHHHHHHHCCEEECCCCCcc
Confidence            99999999999999999999999988888899999999998877777777666677777889999999999999987766


Q ss_pred             eEEeCCCcHHHHHHHHHHHHHHHHHh
Q 011856          449 GFTSLAHSSDDIQHTITAAEKVKMRF  474 (476)
Q Consensus       449 ~~~~~~~t~e~i~~~~~~l~~~~~~~  474 (476)
                      ++++++||++|||+++++|+++++++
T Consensus       402 ~~~~l~~Te~dId~~l~al~~al~~L  427 (427)
T d2gsaa_         402 GFTSLAHTEEDIDATLAAARTVMSAL  427 (427)
T ss_dssp             EECCTTCCHHHHHHHHHHHHHHHTCC
T ss_pred             eeCCCCCCHHHHHHHHHHHHHHHHhC
Confidence            77899999999999999999998764
>d1sffa_ c.67.1.4 (A:) 4-aminobutyrate aminotransferase, GABA-aminotransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2byla1 c.67.1.4 (A:36-439) Ornithine aminotransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vefa1 c.67.1.4 (A:9-395) Acetylornithine/acetyl-lysine aminotransferase ArgD {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1zoda1 c.67.1.4 (A:3-433) Dialkylglycine decarboxylase {Pseudomonas cepacia [TaxId: 292]} Back     information, alignment and structure
>d1z7da1 c.67.1.4 (A:7-410) Ornithine aminotransferase {Plasmodium yoelii yoelii [TaxId: 73239]} Back     information, alignment and structure
>d1s0aa_ c.67.1.4 (A:) Adenosylmethionine-8-amino-7-oxononanoate aminotransferase, BioA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ohwa_ c.67.1.4 (A:) 4-aminobutyrate aminotransferase, GABA-aminotransferase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1fc4a_ c.67.1.4 (A:) 2-amino-3-ketobutyrate CoA ligase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bs0a_ c.67.1.4 (A:) PLP-dependent acyl-CoA synthase (8-amino-7-oxonanoate synthase, AONS) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bwna1 c.67.1.4 (A:2-397) 5-aminolevulinate synthase {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1b5pa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1j32a_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1gdea_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2r5ea1 c.67.1.1 (A:12-429) Kynurenine--oxoglutarate transaminase I {Yellowfever mosquito (Aedes aegypti) [TaxId: 7159]} Back     information, alignment and structure
>d1v2da_ c.67.1.1 (A:) Glutamine aminotransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1c7na_ c.67.1.3 (A:) Cystalysin {Treponema denticola [TaxId: 158]} Back     information, alignment and structure
>d1d2fa_ c.67.1.3 (A:) Modulator in mal gene expression, MalY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xi9a_ c.67.1.1 (A:) Putative alanine aminotransferase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1o4sa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1lc5a_ c.67.1.1 (A:) L-threonine-O-3-phosphate decarboxylase CobD {Salmonella enterica [TaxId: 28901]} Back     information, alignment and structure
>d1wsta1 c.67.1.1 (A:13-415) Multiple substrate aminotransferase, MSAT {Thermococcus profundus [TaxId: 49899]} Back     information, alignment and structure
>d1w7la_ c.67.1.1 (A:) Kynurenine--oxoglutarate transaminase I {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gb3a1 c.67.1.1 (A:4-392) AAT homologue TM1698 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1m6sa_ c.67.1.1 (A:) Low-specificity threonine aldolase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1bw0a_ c.67.1.1 (A:) Tyrosine aminotransferase (TAT) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1u08a_ c.67.1.1 (A:) Putative methionine aminotransferase YdbL {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vp4a_ c.67.1.1 (A:) Putative aminotransferase TM1131 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1iaya_ c.67.1.4 (A:) 1-aminocyclopropane-1-carboxylate synthase (ACC synthase) {Tomato (Lycopersicon esculentum) [TaxId: 4081]} Back     information, alignment and structure
>d1m7ya_ c.67.1.4 (A:) 1-aminocyclopropane-1-carboxylate synthase (ACC synthase) {Apple (Malus domestica) [TaxId: 3750]} Back     information, alignment and structure
>d2f8ja1 c.67.1.1 (A:1-334) Histidinol-phosphate aminotransferase HisC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1v72a1 c.67.1.1 (A:6-350) Phenylserine aldolase PSALD {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1fg7a_ c.67.1.1 (A:) Histidinol-phosphate aminotransferase HisC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ax4a_ c.67.1.2 (A:) Tryptophan indol-lyase (tryptophanase) {Proteus vulgaris [TaxId: 585]} Back     information, alignment and structure
>d7aata_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Chicken (Gallus gallus), mitochondria [TaxId: 9031]} Back     information, alignment and structure
>d1ajsa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Pig (Sus scrofa), cytosolic form [TaxId: 9823]} Back     information, alignment and structure
>d2q7wa1 c.67.1.1 (A:1-396) Aspartate aminotransferase, AAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yaaa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Baker's yeast (Saccharomyces cerevisiae), cytosolic form [TaxId: 4932]} Back     information, alignment and structure
>d2v1pa1 c.67.1.2 (A:5-471) Tryptophan indol-lyase (tryptophanase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2e7ja1 c.67.1.9 (A:8-371) Selenocysteinyl-tRNA synthase (SepSecS) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2aeua1 c.67.1.8 (A:9-374) Hypothetical protein MJ0158 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d3tata_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ay1a_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1svva_ c.67.1.1 (A:) Low-specificity threonine aldolase {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1elua_ c.67.1.3 (A:) Cystine C-S lyase C-des {Synechocystis sp. [TaxId: 1143]} Back     information, alignment and structure
>d1p3wa_ c.67.1.3 (A:) Cysteine desulfurase IscS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jf9a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t3ia_ c.67.1.3 (A:) Probable cysteine desulfurase SufS {Synechocystis sp. PCC 6803 [TaxId: 1148]} Back     information, alignment and structure
>d2hoxa1 c.67.1.1 (A:1-425) Alliinase {Garlic (Allium sativum) [TaxId: 4682]} Back     information, alignment and structure
>d2z67a1 c.67.1.9 (A:1-434) Selenocysteinyl-tRNA synthase (SepSecS) {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1h0ca_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qz9a_ c.67.1.3 (A:) Kynureninase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1c7ga_ c.67.1.2 (A:) Tyrosine phenol-lyase {Erwinia herbicola [TaxId: 549]} Back     information, alignment and structure
>d1eg5a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d3bc8a1 c.67.1.9 (A:23-467) Selenocysteinyl-tRNA synthase (SepSecS) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1m32a_ c.67.1.3 (A:) 2-aminoethylphosphonate transaminase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1mdoa_ c.67.1.4 (A:) Aminotransferase ArnB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1b9ha_ c.67.1.4 (A:) 3-amino-5-hydroxybenzoic acid synthase (AHBA synthase) {Amycolatopsis mediterranei [TaxId: 33910]} Back     information, alignment and structure
>d1gc0a_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1c4ka2 c.67.1.5 (A:108-569) Ornithine decarboxylase major domain {Lactobacillus sp., strain 30a [TaxId: 1591]} Back     information, alignment and structure
>d2bkwa1 c.67.1.3 (A:3-384) Alanine-glyoxylate aminotransferase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1js3a_ c.67.1.6 (A:) DOPA decarboxylase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1vjoa_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Cyanobacteria (Nostoc sp. pcc 7120) [TaxId: 103690]} Back     information, alignment and structure
>d1qgna_ c.67.1.3 (A:) Cystathionine gamma-synthase, CGS {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1y4ia1 c.67.1.3 (A:2-398) Methionine gamma-lyase, MGL {Citrobacter freundii [TaxId: 546]} Back     information, alignment and structure
>d1o69a_ c.67.1.4 (A:) Aminotransferase homolog WlaK (PglE, Cj1121c) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1cs1a_ c.67.1.3 (A:) Cystathionine gamma-synthase, CGS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ibja_ c.67.1.3 (A:) Cystathionine beta-lyase, CBL {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2ch1a1 c.67.1.3 (A:2-389) 3-hydroxykynurenine transaminase {Malaria mosquito (Anopheles gambiae) [TaxId: 7165]} Back     information, alignment and structure
>d2fnua1 c.67.1.4 (A:2-372) Spore coat polysaccharide biosynthesis protein C {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1cl1a_ c.67.1.3 (A:) Cystathionine beta-lyase, CBL {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pffa_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Trichomonas vaginalis, MGL2 [TaxId: 5722]} Back     information, alignment and structure
>d1e5ea_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Trichomonas vaginalis, MGL1 [TaxId: 5722]} Back     information, alignment and structure
>d1iuga_ c.67.1.3 (A:) Subgroup IV putative aspartate aminotransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1pmma_ c.67.1.6 (A:) Glutamate decarboxylase beta, GadB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n8pa_ c.67.1.3 (A:) Cystathionine gamma-lyase (CYS3) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ctza1 c.67.1.3 (A:1-421) O-acetyl-L-homoserine sulfhydrylase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2c0ra1 c.67.1.4 (A:2-362) Phosphoserine aminotransferase, PSAT {Bacillus circulans, subsp. alkalophilus [TaxId: 1397]} Back     information, alignment and structure
>d1kl1a_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1dfoa_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w23a_ c.67.1.4 (A:) Phosphoserine aminotransferase, PSAT {Bacillus alcalophilus [TaxId: 1445]} Back     information, alignment and structure
>d1bjna_ c.67.1.4 (A:) Phosphoserine aminotransferase, PSAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a7va1 c.67.1.4 (A:26-488) Serine hydroxymethyltransferase {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Back     information, alignment and structure
>d1rv3a_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1wyub1 c.67.1.7 (B:2-472) Glycine dehydrogenase subunit 2 (P-protein) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wyua1 c.67.1.7 (A:1-437) Glycine dehydrogenase (decarboxylating) subunit 1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure