Citrus Sinensis ID: 011892

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-----
MISSICFSFTIAERESYGEDIADTETERSTGHSDEDKYDDSFINDADLDIIPPSPVSGGGGSHRRLRKNYQLIESDDDVSAQKQMLADGSTAAAASDGESEDMQPISSLCKVSSDKQENIETREINVRKSGGTSTDEAKDEGNCFILSEERSDDDVNGEPKRSDMCDSVLPSAEVGLENGAKPKKKKKVQSKEGTQVEEKGLQNDTETDKIIQNLPVPNEENQKTSNHVENVGSVNNAKPKKRKRKEQQKSLEADSVDCTNVIKGDKALHDEVKHDRMGQDTPGRVEQNEQQVTDVIPGNDVDQSVAELQPEKKKKKKKRRTEEDGKDSNMETHPLSMDAMSGSVMVTENSSAEGKLSLLRTLPNGLVIQKLGTGKPDGKVAAPGKKISVLYTGKLKENGQVFDSNLGSTPLKFHLGGKEVIEGLNVGLEGMHVGEKRRLLIPPSLGYGSGGDDSKNIPPYSWLEFDVDLVKVHR
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccccccccccccccccccccccccccccccHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccHHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHHHccccccccccccccccHHHHHHHHcccccccccccHHHHHHHHccccccccHHHHHHcHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccEEEcccccEEEEEEEccccccccccccEEEEEEEEEEcccccEEccccccccEEEEcccccccccHHHHHcccccccEEEEEEcccccccccccccccccccccEEEEEEEEEEcc
cccEEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccEEEccccccHHHHHHccccccHHHccccccccccHHHHHEccHHHHccccHHcHHHHcccccccccccccccccEEEEEcccccccccccccccccccccccccccccccccccccEEEEEEcccccccccccccHHHccccccccccccccccEccccccccccccccccccccHHHHHHHHHcccHHHHHHHHHHHcccccHHHHHccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEcccccEEEEEEEccccccccccccEEEEEEEEEEccccEEEEHHHccccEEEEcccccccHHHHHHHcccccccEEEEEEcHHHccccccEHHHcEcccccEEEEEEEEEEcc
MISSICFSFTIAEResygediadteterstghsdedkyddsfindadldiippspvsggggshrrlrknyqliesdDDVSAQKQMLADgstaaaasdgesedmqpisslckvssdkqenietreinvrksggtstdeakdegncfilseersdddvngepkrsdmcdsvlpsaevglengakpkkkkkvqskegtqveekglqndtetdkiiqnlpvpneenqktsnhvenvgsvnnakpkkrkRKEQQKsleadsvdctnvikgdkalhdevkhdrmgqdtpgrveqneqqvtdvipgndvdqsvaelqpekkkkkkkrrteedgkdsnmethplsmdamsgsvmvtenssaegKLSLLrtlpnglviqklgtgkpdgkvaapgkkISVLYTGklkengqvfdsnlgstplkfhlggkeVIEGLNVglegmhvgekrrllippslgygsggddsknippyswlefDVDLVKVHR
MISSICFSFTiaeresygediadteterstghsdedkyDDSFINdadldiippspvsggggshrRLRKNYQLIESDDDVSAQKQMLADGSTAaaasdgesedmqpisslckvssdkqenietreinvrksggtstdeakdegncfilseersdddvngepKRSDMCDSVLPSaevglengakpkkkkkvqskegtqveekglqndtetdkiiqnlpvpneenqktsnhvenvgsvnnakpkkrkrkeqqksleadsvdctnvikgdkalhdevkhdrmgqdtpgrveQNEQQvtdvipgndvdqsvaelqpekkkkkkkrrteedgkdsnmethplsmdAMSGSVMVTENSSAEGKLSLLRTLPNGLVIQKlgtgkpdgkvaapGKKISVLYTGKLKENGQVFDSNLGSTPLKFHLGGKEVIEGLNVGLEGMHVGEKRRLLIPPslgygsggddsknippyswlefdvDLVKVHR
MISSICFSFTIAERESYGEDIADTETERSTGHSDEDKYDDSFINDADLDIIppspvsggggsHRRLRKNYQLIESDDDVSAQKQMLadgstaaaasdgesedMQPISSLCKVSSDKQENIETREINVRKSGGTSTDEAKDEGNCFILSEERSDDDVNGEPKRSDMCDSVLPSAEVGLENGAkpkkkkkVQSKEGTQVEEKGLQNDTETDKIIQNLPVPNEENQKTSNHVENVGSVNNAkpkkrkrkeqqkSLEADSVDCTNVIKGDKALHDEVKHDRMGQDTPGRVEQNEQQVTDVIPGNDVDQSVAELQPEkkkkkkkRRTEEDGKDSNMETHPLSMDAMSGSVMVTENSSAEGKLSLLRTLPNGLVIQKLGTGKPDGKVAAPGKKISVLYTGKLKENGQVFDSNLGSTPLKFHLGGKEVIEGLNVGLEGMHVGEKRRLLIPPSLGYGSGGDDSKNIPPYSWLEFDVDLVKVHR
****ICFSFTIA**********************************************************************************************************************************************************************************************************************************************************************************************************************************************************LLRTLPNGLVIQKLGTG*****VAAPGKKISVLYTGKLKENGQVFDSNLGSTPLKFHLGGKEVIEGLNVGLEGMHVGEKRRLLIPPSLGYG*******NIPPYSWLEFDVDLVK***
**************ESYGE********************DSFINDADL**************************************************************************************************************************************************************************************************************************************************************************************************************************LPNGLVIQKLGTGK***K*AAPGKKISVLYTGKLKENGQVFDSNLGSTPLKFHLGGKEVIEGLNVGLEGMHVGEKRRLLIPPSLGYGSGGDDSKNIPPYSWLEFDVDLVKVHR
MISSICFSFTIAERESYGED***************DKYDDSFINDADLDIIPPSP*********RLRKNYQLIESD******************************SSLCKVSSDKQENIETREINV************DEGNCFILSEE****************DSVLPSAEVGLENG********************GLQNDTETDKIIQNLPVPNEENQKTSNHVENVGSVN*****************ADSVDCTNVIKGDKALHDEVKHDRMGQDTPGRVEQNEQQVTDVIPGNDVDQSVAEL*********************METHPLSMDAMSGSVMVTENSSAEGKLSLLRTLPNGLVIQKLGTGKPDGKVAAPGKKISVLYTGKLKENGQVFDSNLGSTPLKFHLGGKEVIEGLNVGLEGMHVGEKRRLLIPPSLGYGSGGDDSKNIPPYSWLEFDVDLVKVHR
*ISSICFSFTIAER**********************KYDDSFINDADLDIIPPSPV****GSHRRLRKNYQLIESDDDVS**KQMLADGSTAAAASDGESEDMQPISSLCKVSSD****************************CFI*SEER******************************KPKKKKKVQSKEGTQVEE********************************************************SVDCTNVIKGDKALHDEVKHDRMGQDTPGRVEQNEQQVTDVIPGNDVDQSVAELQPEKKKKKKKRRTEEDGKDSNMETHPLSMDAMSGSVMVTENSSAEGKLSLLRTLPNGLVIQKLGTGKPDGKVAAPGKKISVLYTGKLKENGQVFDSNLGSTPLKFHLGGKEVIEGLNVGLEGMHVGEKRRLLIPPSLGYGSGGDDSKNIPPYSWLEFDVDLVKVHR
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MISSICFSFTIAERESYGEDIADTETERSTGHSDEDKYDDSFINDADLDIIPPSPVSGGGGSHRRLRKNYQLIESDDDVSAQKQMLADGSTAAAASDGESEDMQPISSLCKVSSDKQENIETREINVRKSGGTSTDEAKDEGNCFILSEERSDDDVNGEPKRSDMCDSVLPSAEVGLENGAKPKKKKKVQSKEGTQVEEKGLQNDTETDKIIQNLPVPNEENQKTSNHVENVGSVNNAKPKKRKRKEQQKSLEADSVDCTNVIKGDKALHDEVKHDRMGQDTPGRVEQNEQQVTDVIPGNDVDQSVAELQPEKKKKKKKRRTEEDGKDSNMETHPLSMDAMSGSVMVTENSSAEGKLSLLRTLPNGLVIQKLGTGKPDGKVAAPGKKISVLYTGKLKENGQVFDSNLGSTPLKFHLGGKEVIEGLNVGLEGMHVGEKRRLLIPPSLGYGSGGDDSKNIPPYSWLEFDVDLVKVHR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query475 2.2.26 [Sep-21-2011]
Q93ZG9477 Peptidyl-prolyl cis-trans yes no 0.273 0.272 0.534 2e-35
F4J9Q6499 Peptidyl-prolyl cis-trans no no 0.237 0.226 0.570 4e-33
Q9FLB3143 Peptidyl-prolyl cis-trans no no 0.263 0.874 0.492 6e-27
P0CP98405 FK506-binding protein 4 O yes no 0.229 0.269 0.464 8e-18
P0CP99405 FK506-binding protein 4 O N/A no 0.229 0.269 0.464 8e-18
P54397357 39 kDa FK506-binding nucl yes no 0.233 0.310 0.464 9e-18
Q26486412 46 kDa FK506-binding nucl N/A no 0.231 0.266 0.433 1e-17
Q6FSC1136 FK506-binding protein 2 O yes no 0.195 0.683 0.526 2e-17
Q6BSE7437 FK506-binding protein 3 O yes no 0.227 0.247 0.442 2e-16
Q54NB6364 FK506-binding protein 4 O yes no 0.221 0.288 0.481 2e-16
>sp|Q93ZG9|FKB53_ARATH Peptidyl-prolyl cis-trans isomerase FKBP53 OS=Arabidopsis thaliana GN=FKBP53 PE=1 SV=1 Back     alignment and function desciption
 Score =  150 bits (379), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 70/131 (53%), Positives = 95/131 (72%), Gaps = 1/131 (0%)

Query: 344 SVMVTENSSAEGKLSLLRTLPNGLVIQKLGTGKPDGKVAAPGKKISVLYTGKLKENGQVF 403
           S  V + + A+ K S +RT PNGL++++L  GKP+GK A PGK +SV Y GKL++NG++F
Sbjct: 348 SGTVEKQTPADSKSSQVRTYPNGLIVEELSMGKPNGKRADPGKTVSVRYIGKLQKNGKIF 407

Query: 404 DSNLGSTPLKFHLGGKEVIEGLNVGLEGMHVGEKRRLLIPPSLGYGSGGDDSKNIPPYSW 463
           DSN+G +P KF LG   VI+G +VG+ GM VG+KR+L IPPS+GYG  G   + IPP SW
Sbjct: 408 DSNIGKSPFKFRLGIGSVIKGWDVGVNGMRVGDKRKLTIPPSMGYGVKGAGGQ-IPPNSW 466

Query: 464 LEFDVDLVKVH 474
           L FDV+L+ V 
Sbjct: 467 LTFDVELINVQ 477
PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides (By similarity). Histone chaperone possibly involved in H3/H4 deposition to the nucleosome. Associates with 18S rDNA chromatin and negatively regulates the level of its expression.
Arabidopsis thaliana (taxid: 3702)
EC: 5EC: .EC: 2EC: .EC: 1EC: .EC: 8
>sp|F4J9Q6|FKB43_ARATH Peptidyl-prolyl cis-trans isomerase FKBP43 OS=Arabidopsis thaliana GN=FKBP43 PE=2 SV=1 Back     alignment and function description
>sp|Q9FLB3|FK153_ARATH Peptidyl-prolyl cis-trans isomerase FKBP15-3 OS=Arabidopsis thaliana GN=FKBP15-3 PE=2 SV=1 Back     alignment and function description
>sp|P0CP98|FKBP4_CRYNJ FK506-binding protein 4 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=FPR4 PE=3 SV=1 Back     alignment and function description
>sp|P0CP99|FKBP4_CRYNB FK506-binding protein 4 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=FPR4 PE=3 SV=1 Back     alignment and function description
>sp|P54397|FKB39_DROME 39 kDa FK506-binding nuclear protein OS=Drosophila melanogaster GN=FK506-bp1 PE=1 SV=2 Back     alignment and function description
>sp|Q26486|FKBP4_SPOFR 46 kDa FK506-binding nuclear protein OS=Spodoptera frugiperda GN=FKBP46 PE=2 SV=1 Back     alignment and function description
>sp|Q6FSC1|FKBP2_CANGA FK506-binding protein 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=FPR2 PE=3 SV=1 Back     alignment and function description
>sp|Q6BSE7|FKBP3_DEBHA FK506-binding protein 3 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=FPR3 PE=3 SV=1 Back     alignment and function description
>sp|Q54NB6|FKBP4_DICDI FK506-binding protein 4 OS=Dictyostelium discoideum GN=fkbp4 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query475
225462092555 PREDICTED: uncharacterized protein LOC10 0.456 0.390 0.504 7e-46
357470491 870 FK506-binding protein [Medicago truncatu 0.637 0.348 0.409 4e-40
225455553525 PREDICTED: uncharacterized protein LOC10 0.818 0.740 0.336 2e-36
38564729259 putative immunophilin/FKBP-type peptidyl 0.258 0.474 0.580 2e-34
356506992406 PREDICTED: uncharacterized protein LOC10 0.292 0.342 0.570 3e-34
224134533212 predicted protein [Populus trichocarpa] 0.309 0.693 0.509 4e-34
255539695490 FK506-binding protein, putative [Ricinus 0.309 0.3 0.5 7e-34
224122580251 predicted protein [Populus trichocarpa] 0.250 0.474 0.603 9e-34
18416534477 peptidylprolyl isomerase [Arabidopsis th 0.273 0.272 0.534 1e-33
5123924487 putative protein [Arabidopsis thaliana] 0.273 0.266 0.534 2e-33
>gi|225462092|ref|XP_002271499.1| PREDICTED: uncharacterized protein LOC100267010 [Vitis vinifera] gi|296086769|emb|CBI32918.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  191 bits (485), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 115/228 (50%), Positives = 154/228 (67%), Gaps = 11/228 (4%)

Query: 250 KSLEADSVDCTNVIKGDKALHDEVKHDRMGQDTPGRVEQ---NEQQVTDVIPGNDVDQSV 306
           K LE DSV+  N +K DKA  +E K D M Q+ P R E    N  +  D      VDQ  
Sbjct: 330 KHLEVDSVNHKNDLKEDKAPQNENKADNMDQNLPERKENQRPNSYKSCDT----KVDQLA 385

Query: 307 AELQPEKKKKKKKRR---TEEDGKDSNMETHPLSMDAMSGSVMVTENSSAEGKLSLLRTL 363
            + Q ++KK K+KR+   T+E+   +NME  PLSM+  SGS +  ++ +++   S +R +
Sbjct: 386 GDNQSDEKKIKRKRKKSKTQENEGVANMEVPPLSMNKKSGSHLEVKDRNSDANSSQVRMM 445

Query: 364 PNGLVIQKLGTGKPDGKVAAPGKKISVLYTGKLKENGQVFDSNLGSTPLKFHLGGKEVIE 423
            NGLVI++L TGKPDGK+A  GKK+SV YTGKLK++GQ+FDSN+G  PLKF LG  +VI+
Sbjct: 446 SNGLVIEELITGKPDGKIACQGKKVSVYYTGKLKDSGQIFDSNIGRAPLKFRLGAGKVIK 505

Query: 424 GLNVGLEGMHVGEKRRLLIPPSLGYGSGGDDSKNIPPYSWLEFDVDLV 471
           G +VGL+GM VG+KRRL+IPPS+GYG+ G    NIPP SWL FDV+L 
Sbjct: 506 GWDVGLDGMRVGDKRRLVIPPSMGYGNEG-AGDNIPPNSWLVFDVELA 552

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|357470491|ref|XP_003605530.1| FK506-binding protein [Medicago truncatula] gi|355506585|gb|AES87727.1| FK506-binding protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|225455553|ref|XP_002268439.1| PREDICTED: uncharacterized protein LOC100258340 [Vitis vinifera] gi|296084130|emb|CBI24518.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|38564729|gb|AAR23804.1| putative immunophilin/FKBP-type peptidyl-prolyl cis-trans isomerase [Helianthus annuus] Back     alignment and taxonomy information
>gi|356506992|ref|XP_003522256.1| PREDICTED: uncharacterized protein LOC100798135 [Glycine max] Back     alignment and taxonomy information
>gi|224134533|ref|XP_002321846.1| predicted protein [Populus trichocarpa] gi|222868842|gb|EEF05973.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255539695|ref|XP_002510912.1| FK506-binding protein, putative [Ricinus communis] gi|223550027|gb|EEF51514.1| FK506-binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224122580|ref|XP_002318872.1| predicted protein [Populus trichocarpa] gi|222859545|gb|EEE97092.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|18416534|ref|NP_567717.1| peptidylprolyl isomerase [Arabidopsis thaliana] gi|75163771|sp|Q93ZG9.1|FKB53_ARATH RecName: Full=Peptidyl-prolyl cis-trans isomerase FKBP53; Short=PPIase FKBP53; AltName: Full=FK506-binding protein 53; Short=AtFKBP53; AltName: Full=Immunophilin FKBP53; AltName: Full=Rotamase gi|15982872|gb|AAL09783.1| AT4g25340/T30C3_20 [Arabidopsis thaliana] gi|23506115|gb|AAN28917.1| At4g25340/T30C3_20 [Arabidopsis thaliana] gi|332659643|gb|AEE85043.1| peptidylprolyl isomerase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|5123924|emb|CAB45512.1| putative protein [Arabidopsis thaliana] gi|7269385|emb|CAB81345.1| putative protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query475
TAIR|locus:2092467499 AT3G12340 "AT3G12340" [Arabido 0.404 0.384 0.407 4.6e-42
TAIR|locus:2138029477 FKBP53 "AT4G25340" [Arabidopsi 0.574 0.572 0.333 1e-36
UNIPROTKB|Q7XUX5525 OSJNBa0027P08.21 "Peptidyl-pro 0.416 0.377 0.373 7.3e-32
TAIR|locus:2153519143 AT5G05420 "AT5G05420" [Arabido 0.263 0.874 0.492 2.4e-28
UNIPROTKB|A8JAS8104 FKB53 "Peptidyl-prolyl cis-tra 0.216 0.990 0.533 5.9e-24
FB|FBgn0013269357 FK506-bp1 "FK506-binding prote 0.456 0.607 0.311 1.4e-18
POMBASE|SPBC1347.02361 fkbp39 "FKBP-type peptidyl-pro 0.286 0.376 0.388 3e-17
DICTYBASE|DDB_G0285357364 DDB_G0285357 "FKBP-type peptid 0.406 0.530 0.336 1.2e-16
SGD|S000004441392 FPR4 "Peptidyl-prolyl cis-tran 0.448 0.543 0.294 5.9e-16
SGD|S000002927135 FPR2 "Membrane-bound peptidyl- 0.191 0.674 0.516 6e-16
TAIR|locus:2092467 AT3G12340 "AT3G12340" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 361 (132.1 bits), Expect = 4.6e-42, Sum P(2) = 4.6e-42
 Identities = 81/199 (40%), Positives = 116/199 (58%)

Query:   276 DRMGQDTPGRVEQNEQQVTDVIPGNDVDQSVAELQPEXXXXXXXRRTEEDGKDSNMETHP 335
             D  G++ P  + QNE  V+D   G      V  L          ++ + D ++   +  P
Sbjct:   306 DGEGKNMPESL-QNENPVSD--KGIKSSSDVL-LSQNGDATLSKKKKKRDRREETTDV-P 360

Query:   336 LSMDAMSGSVMVTENSSAEGKLSL-LRTLPNGLVIQKLGTGKPDGKVAAPGKKISVLYTG 394
                +    ++       A  K  L  RTL NG++I+ +  GK DGK A  GKK+S+LYTG
Sbjct:   361 ECPEKKKQAIDKNIEKEAGTKKPLETRTLSNGVIIEDIEKGKLDGKSAVKGKKVSILYTG 420

Query:   395 KLKENGQVFDSNLGSTPLKFHLGGKEVIEGLNVGLEGMHVGEKRRLLIPPSLGYGSGGDD 454
             KLK+ G +FDSNLG  PL+F LGG+ VIEGL++G+EGM VG+KRRL+IPP+LGY   G  
Sbjct:   421 KLKDTGNLFDSNLGEDPLRFRLGGENVIEGLSIGVEGMRVGDKRRLIIPPALGYSKRGLK 480

Query:   455 SKNIPPYSWLEFDVDLVKV 473
              K +P  +WL ++V+ VK+
Sbjct:   481 EK-VPKSAWLVYEVEAVKI 498
GO:0000413 "protein peptidyl-prolyl isomerization" evidence=IBA
GO:0003755 "peptidyl-prolyl cis-trans isomerase activity" evidence=ISS;IBA
GO:0005528 "FK506 binding" evidence=ISS;IBA
GO:0005634 "nucleus" evidence=ISM
GO:0006457 "protein folding" evidence=IEA
GO:0009543 "chloroplast thylakoid lumen" evidence=ISS
GO:0016020 "membrane" evidence=IBA
GO:0018208 "peptidyl-proline modification" evidence=IBA
GO:0006312 "mitotic recombination" evidence=RCA
GO:0009560 "embryo sac egg cell differentiation" evidence=RCA
GO:0042991 "transcription factor import into nucleus" evidence=RCA
TAIR|locus:2138029 FKBP53 "AT4G25340" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q7XUX5 OSJNBa0027P08.21 "Peptidyl-prolyl cis-trans isomerase" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2153519 AT5G05420 "AT5G05420" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|A8JAS8 FKB53 "Peptidyl-prolyl cis-trans isomerase" [Chlamydomonas reinhardtii (taxid:3055)] Back     alignment and assigned GO terms
FB|FBgn0013269 FK506-bp1 "FK506-binding protein 1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
POMBASE|SPBC1347.02 fkbp39 "FKBP-type peptidyl-prolyl cis-trans isomerase (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0285357 DDB_G0285357 "FKBP-type peptidylprolyl cis-trans isomerase (PPIase)" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
SGD|S000004441 FPR4 "Peptidyl-prolyl cis-trans isomerase (PPIase) (proline isomerase)" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
SGD|S000002927 FPR2 "Membrane-bound peptidyl-prolyl cis-trans isomerase (PPIase)" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer5.2.1LOW CONFIDENCE prediction!
4th Layer5.2.1.8LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00000981001
RecName- Full=Peptidyl-prolyl cis-trans isomerase; EC=5.2.1.8; (726 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query475
pfam0025494 pfam00254, FKBP_C, FKBP-type peptidyl-prolyl cis-t 3e-28
COG0545205 COG0545, FkpA, FKBP-type peptidyl-prolyl cis-trans 1e-24
PRK11570206 PRK11570, PRK11570, peptidyl-prolyl cis-trans isom 8e-12
COG1047174 COG1047, SlpA, FKBP-type peptidyl-prolyl cis-trans 1e-08
PRK10902269 PRK10902, PRK10902, FKBP-type peptidyl-prolyl cis- 2e-06
>gnl|CDD|215821 pfam00254, FKBP_C, FKBP-type peptidyl-prolyl cis-trans isomerase Back     alignment and domain information 
 Score =  106 bits (268), Expect = 3e-28
 Identities = 45/93 (48%), Positives = 58/93 (62%), Gaps = 2/93 (2%)

Query: 380 KVAAPGKKISVLYTGKLKENGQVFDSNLG-STPLKFHLGGKEVIEGLNVGLEGMHVGEKR 438
           + A  G  ++V YTGKL E+G VFDS+     P +F LG  +VI G + GL GM VGEKR
Sbjct: 3   EKAKKGDTVTVHYTGKL-EDGTVFDSSKDRGKPFEFTLGSGQVIPGWDEGLLGMKVGEKR 61

Query: 439 RLLIPPSLGYGSGGDDSKNIPPYSWLEFDVDLV 471
           +L IPP L YG  G     IPP + L F+V+L+
Sbjct: 62  KLTIPPELAYGEEGLAGGVIPPNATLVFEVELL 94

Length = 94
>gnl|CDD|223619 COG0545, FkpA, FKBP-type peptidyl-prolyl cis-trans isomerases 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|183207 PRK11570, PRK11570, peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>gnl|CDD|223976 COG1047, SlpA, FKBP-type peptidyl-prolyl cis-trans isomerases 2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|236791 PRK10902, PRK10902, FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 475
COG0545205 FkpA FKBP-type peptidyl-prolyl cis-trans isomerase 99.94
KOG0552226 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.91
PRK11570206 peptidyl-prolyl cis-trans isomerase; Provisional 99.91
KOG0544108 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.9
TIGR03516177 ppisom_GldI peptidyl-prolyl isomerase, gliding mot 99.89
KOG0549188 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.89
PRK10902269 FKBP-type peptidyl-prolyl cis-trans isomerase; Pro 99.87
PF0025494 FKBP_C: FKBP-type peptidyl-prolyl cis-trans isomer 99.79
PRK15095156 FKBP-type peptidyl-prolyl cis-trans isomerase; Pro 99.52
KOG0543 397 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.5
PRK10737 196 FKBP-type peptidyl-prolyl cis-trans isomerase; Pro 99.44
COG1047174 SlpA FKBP-type peptidyl-prolyl cis-trans isomerase 99.42
TIGR00115 408 tig trigger factor. Trigger factor is a ribosome-a 98.85
PRK01490 435 tig trigger factor; Provisional 98.77
KOG0543 397 consensus FKBP-type peptidyl-prolyl cis-trans isom 98.6
COG0544 441 Tig FKBP-type peptidyl-prolyl cis-trans isomerase 98.5
KOG0545 329 consensus Aryl-hydrocarbon receptor-interacting pr 97.46
KOG0549 188 consensus FKBP-type peptidyl-prolyl cis-trans isom 96.61
>COG0545 FkpA FKBP-type peptidyl-prolyl cis-trans isomerases 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=99.94  E-value=1.2e-26  Score=221.06  Aligned_cols=119  Identities=45%  Similarity=0.743  Sum_probs=112.9

Q ss_pred             ccccccccCCeeeCCCCeEEEEEeecCCCCCCCCCCCEEEEEEEEEEccCCeEEeccCCC-CCeEEecCCcchhhcHHHH
Q 011892          350 NSSAEGKLSLLRTLPNGLVIQKLGTGKPDGKVAAPGKKISVLYTGKLKENGQVFDSNLGS-TPLKFHLGGKEVIEGLNVG  428 (475)
Q Consensus       350 ~~~~~~k~~~v~ttpSGl~ykILkeGkgtG~~p~~GD~VtVhYtg~l~~DGkVfDST~~~-~P~~f~LG~g~lIpGLEeA  428 (475)
                      ..+.+++...+.++++|++|+++..|  .|..|..++.|+|||++.+ .||++||+++.+ .|+.|+||  .+|+||.++
T Consensus        86 f~~~~~k~~~v~~~~sgl~y~~~~~G--~G~~~~~~~~V~vhY~G~l-~~G~vFDsS~~rg~p~~f~l~--~vI~Gw~eg  160 (205)
T COG0545          86 FLEKNAKEKGVKTLPSGLQYKVLKAG--DGAAPKKGDTVTVHYTGTL-IDGTVFDSSYDRGQPAEFPLG--GVIPGWDEG  160 (205)
T ss_pred             HHhhhcccCCceECCCCcEEEEEecc--CCCCCCCCCEEEEEEEEec-CCCCccccccccCCCceeecC--CeeehHHHH
Confidence            44577889999999999999999999  7999999999999999999 999999999887 89999999  999999999


Q ss_pred             HcCCccCcEEEEEEcCCCCCCCCCCCCCCCCCCCeEEEEEEEEeee
Q 011892          429 LEGMHVGEKRRLLIPPSLGYGSGGDDSKNIPPYSWLEFDVDLVKVH  474 (475)
Q Consensus       429 L~GMkvGEk~~ViIPp~LAYG~~G~~~kgIPPnStLVFdVELL~VK  474 (475)
                      |.+|++|++|+|+|||.+|||..|.++. ||||++|+|+|+||+|+
T Consensus       161 l~~M~vG~k~~l~IP~~laYG~~g~~g~-Ippns~LvFeVeLl~v~  205 (205)
T COG0545         161 LQGMKVGGKRKLTIPPELAYGERGVPGV-IPPNSTLVFEVELLDVK  205 (205)
T ss_pred             HhhCCCCceEEEEeCchhccCcCCCCCC-CCCCCeEEEEEEEEecC
Confidence            9999999999999999999999997776 99999999999999984

>KOG0552 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11570 peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>KOG0544 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03516 ppisom_GldI peptidyl-prolyl isomerase, gliding motility-associated Back     alignment and domain information
>KOG0549 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10902 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>PF00254 FKBP_C: FKBP-type peptidyl-prolyl cis-trans isomerase; InterPro: IPR001179 Synonym(s): Peptidylprolyl cis-trans isomerase FKBP-type peptidylprolyl isomerases (5 Back     alignment and domain information
>PRK15095 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10737 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>COG1047 SlpA FKBP-type peptidyl-prolyl cis-trans isomerases 2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00115 tig trigger factor Back     alignment and domain information
>PRK01490 tig trigger factor; Provisional Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0544 Tig FKBP-type peptidyl-prolyl cis-trans isomerase (trigger factor) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0549 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query475
3uf8_A209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 7e-14
3uqa_A209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 1e-13
3vaw_A209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 1e-13
4ggq_C209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 1e-13
4dz3_A113 Crystal Structure Of A Peptidyl-Prolyl Cis-Trans Is 2e-13
2y78_A133 Crystal Structure Of Bpss1823, A Mip-Like Chaperone 2e-13
2ke0_A117 Solution Structure Of Peptidyl-Prolyl Cis-Trans Iso 3e-13
4dip_A125 Crystal Structure Of Human Peptidyl-Prolyl Cis-Tran 8e-13
3uqb_A209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 9e-13
1jvw_A167 Trypanosoma Cruzi Macrophage Infectivity Potentiato 1e-12
2pbc_A102 Fk506-Binding Protein 2 Length = 102 2e-11
1u79_A129 Crystal Structure Of Atfkbp13 Length = 129 4e-11
2dg9_A107 Fk506-Binding Protein Mutant Wl59 Complexed With Ra 6e-11
1yat_A113 Improved Calcineurin Inhibition By Yeast Fkbp12-Dru 8e-11
2dg4_A107 Fk506-Binding Protein Mutant Wf59 Complexed With Ra 1e-10
1tco_C107 Ternary Complex Of A Calcineurin A Fragment, Calcin 2e-10
2ppp_A107 Crystal Structure Of E60q Mutant Of Fkbp12 Length = 3e-10
3h9r_B109 Crystal Structure Of The Kinase Domain Of Type I Ac 3e-10
1fkb_A107 Atomic Structure Of The Rapamycin Human Immunophili 3e-10
2fap_A107 The Structure Of The Immunophilin-Immunosuppressant 3e-10
2ppo_A107 Crystal Structure Of E60a Mutant Of Fkbp12 Length = 3e-10
1bkf_A107 Fk506 Binding Protein Fkbp Mutant R42kH87V COMPLEX 7e-10
1bl4_A107 Fkbp Mutant F36v Complexed With Remodeled Synthetic 8e-10
2lgo_A130 Solution Nmr Structure Of A Fkbp-Type Peptidyl-Prol 2e-09
4dz2_A113 Crystal Structure Of A Peptidyl-Prolyl Cis-Trans Is 2e-09
1eym_A107 Fk506 Binding Protein Mutant, Homodimeric Complex L 2e-09
3uqi_A108 Crystallographic Structure Of Fkbp12 From Aedes Aeg 2e-09
1fkk_A107 Atomic Structure Of Fkbp12, An Immunophilin Binding 2e-09
1pbk_A116 Homologous Domain Of Human Fkbp25 Length = 116 9e-09
3kz7_A119 C-Terminal Domain Of Murine Fkbp25 Rapamycin Comple 9e-09
1c9h_A107 Crystal Structure Of Fkbp12.6 In Complex With Rapam 1e-08
2ki3_A126 Structural And Biochemical Characterization Of Fk50 1e-08
2vn1_A129 Crystal Structure Of The Fk506-Binding Domain Of Pl 3e-08
2ofn_A135 Solution Structure Of Fk506-Binding Domain (Fkbd)of 3e-08
1rot_A149 Structure Of Fkbp59-I, The N-Terminal Domain Of A 5 8e-08
3jym_A 377 Crystal Structure Of The 3 Fkbp Domains Of Wheat Fk 3e-07
3jxv_A 356 Crystal Structure Of The 3 Fkbp Domains Of Wheat Fk 3e-07
1q6u_A245 Crystal Structure Of Fkpa From Escherichia Coli Len 3e-07
1q6h_A224 Crystal Structure Of A Truncated Form Of Fkpa From 4e-07
1q1c_A 280 Crystal Structure Of N(1-260) Of Human Fkbp52 Lengt 6e-07
3oe2_A219 1.6 A Crystal Structure Of Peptidyl-Prolyl Cis-Tran 1e-06
4drj_A144 O-crystal Structure Of The Ppiase Domain Of Fkbp52, 1e-06
1n1a_A140 Crystal Structure Of The N-Terminal Domain Of Human 2e-06
3b7x_A134 Crystal Structure Of Human Fk506-Binding Protein 6 6e-06
>pdb|3UF8|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With A G95a Surface Mutation From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 Back     alignment and structure 
Iteration: 1

 Score = 75.1 bits (183), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 52/117 (44%), Positives = 69/117 (58%), Gaps = 5/117 (4%)
Query: 358 SLLRTLPNGLVIQKLGTGKPDGKVAAPGKKISVLYTGKLKENGQVFDSNLGST-PLKFHL 416
           S + T  +GL  + L  G   G  A  G+ +SV YTG L  +GQ FDS+     P  F L
Sbjct: 97  STVVTTESGLKYEDLTEG--SGAEARAGQTVSVHYTGWLT-DGQKFDSSKDRNDPFAFVL 153
Query: 417 GGKEVIEGLNVGLEGMHVGEKRRLLIPPSLGYGSGGDDSKNIPPYSWLEFDVDLVKV 473
           GG  VI+G + G++GM VG  RRL IPP LGYG+ G  +  IPP + L F+V+L+ V
Sbjct: 154 GGGMVIKGWDEGVQGMKVGGVRRLTIPPQLGYGARG-AAGVIPPNATLVFEVELLDV 209
>pdb|3UQA|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation A54e From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 Back     alignment and structure
>pdb|3VAW|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation V3i From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 Back     alignment and structure
>pdb|4GGQ|C Chain C, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase From Burkholderia Pseudomallei Complexed With Cj40 Length = 209 Back     alignment and structure
>pdb|4DZ3|A Chain A, Crystal Structure Of A Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation M61h From Burkholderia Pseudomallei Complexed With Fk506 Length = 113 Back     alignment and structure
>pdb|2Y78|A Chain A, Crystal Structure Of Bpss1823, A Mip-Like Chaperone From Burkholderia Pseudomallei Length = 133 Back     alignment and structure
>pdb|2KE0|A Chain A, Solution Structure Of Peptidyl-Prolyl Cis-Trans Isomerase From Burkholderia Pseudomallei Length = 117 Back     alignment and structure
>pdb|4DIP|A Chain A, Crystal Structure Of Human Peptidyl-Prolyl Cis-Trans Isomerase Fkbp14 Length = 125 Back     alignment and structure
>pdb|3UQB|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation D44g From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 Back     alignment and structure
>pdb|1JVW|A Chain A, Trypanosoma Cruzi Macrophage Infectivity Potentiator (Tcmip) Length = 167 Back     alignment and structure
>pdb|2PBC|A Chain A, Fk506-Binding Protein 2 Length = 102 Back     alignment and structure
>pdb|1U79|A Chain A, Crystal Structure Of Atfkbp13 Length = 129 Back     alignment and structure
>pdb|2DG9|A Chain A, Fk506-Binding Protein Mutant Wl59 Complexed With Rapamycin Length = 107 Back     alignment and structure
>pdb|1YAT|A Chain A, Improved Calcineurin Inhibition By Yeast Fkbp12-Drug Complexes. Crystallographic And Functional Analysis Length = 113 Back     alignment and structure
>pdb|2DG4|A Chain A, Fk506-Binding Protein Mutant Wf59 Complexed With Rapamycin Length = 107 Back     alignment and structure
>pdb|1TCO|C Chain C, Ternary Complex Of A Calcineurin A Fragment, Calcineurin B, Fkbp12 And The Immunosuppressant Drug Fk506 (tacrolimus) Length = 107 Back     alignment and structure
>pdb|2PPP|A Chain A, Crystal Structure Of E60q Mutant Of Fkbp12 Length = 107 Back     alignment and structure
>pdb|3H9R|B Chain B, Crystal Structure Of The Kinase Domain Of Type I Activin Receptor (Acvr1) In Complex With Fkbp12 And Dorsomorphin Length = 109 Back     alignment and structure
>pdb|1FKB|A Chain A, Atomic Structure Of The Rapamycin Human Immunophilin Fkbp- 12 Complex Length = 107 Back     alignment and structure
>pdb|2FAP|A Chain A, The Structure Of The Immunophilin-Immunosuppressant Fkbp12- (C16)-Ethoxy Rapamycin Complex Interacting With Huma Length = 107 Back     alignment and structure
>pdb|2PPO|A Chain A, Crystal Structure Of E60a Mutant Of Fkbp12 Length = 107 Back     alignment and structure
>pdb|1BKF|A Chain A, Fk506 Binding Protein Fkbp Mutant R42kH87V COMPLEX WITH Immunosuppressant Fk506 Length = 107 Back     alignment and structure
>pdb|1BL4|A Chain A, Fkbp Mutant F36v Complexed With Remodeled Synthetic Ligand Length = 107 Back     alignment and structure
>pdb|2LGO|A Chain A, Solution Nmr Structure Of A Fkbp-Type Peptidyl-Prolyl Cis-Trans Isomerase From Giardia Lamblia, Seattle Structural Genomics Center For Infectious Disease Target Gilaa.00840.A Length = 130 Back     alignment and structure
>pdb|4DZ2|A Chain A, Crystal Structure Of A Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation R92g From Burkholderia Pseudomallei Complexed With Fk506 Length = 113 Back     alignment and structure
>pdb|1EYM|A Chain A, Fk506 Binding Protein Mutant, Homodimeric Complex Length = 107 Back     alignment and structure
>pdb|3UQI|A Chain A, Crystallographic Structure Of Fkbp12 From Aedes Aegypti Length = 108 Back     alignment and structure
>pdb|1FKK|A Chain A, Atomic Structure Of Fkbp12, An Immunophilin Binding Protein Length = 107 Back     alignment and structure
>pdb|1PBK|A Chain A, Homologous Domain Of Human Fkbp25 Length = 116 Back     alignment and structure
>pdb|3KZ7|A Chain A, C-Terminal Domain Of Murine Fkbp25 Rapamycin Complex Length = 119 Back     alignment and structure
>pdb|1C9H|A Chain A, Crystal Structure Of Fkbp12.6 In Complex With Rapamycin Length = 107 Back     alignment and structure
>pdb|2KI3|A Chain A, Structural And Biochemical Characterization Of Fk506 Binding Domain From Plasmodium Vivax Length = 126 Back     alignment and structure
>pdb|2VN1|A Chain A, Crystal Structure Of The Fk506-Binding Domain Of Plasmodium Falciparum Fkbp35 In Complex With Fk506 Length = 129 Back     alignment and structure
>pdb|2OFN|A Chain A, Solution Structure Of Fk506-Binding Domain (Fkbd)of Fkbp35 From Plasmodium Falciparum Length = 135 Back     alignment and structure
>pdb|1ROT|A Chain A, Structure Of Fkbp59-I, The N-Terminal Domain Of A 59 Kda Fk506-Binding Protein, Nmr, Minimized Average Structure Length = 149 Back     alignment and structure
>pdb|3JYM|A Chain A, Crystal Structure Of The 3 Fkbp Domains Of Wheat Fkbp73 Length = 377 Back     alignment and structure
>pdb|3JXV|A Chain A, Crystal Structure Of The 3 Fkbp Domains Of Wheat Fkbp73 Length = 356 Back     alignment and structure
>pdb|1Q6U|A Chain A, Crystal Structure Of Fkpa From Escherichia Coli Length = 245 Back     alignment and structure
>pdb|1Q6H|A Chain A, Crystal Structure Of A Truncated Form Of Fkpa From Escherichia Coli Length = 224 Back     alignment and structure
>pdb|1Q1C|A Chain A, Crystal Structure Of N(1-260) Of Human Fkbp52 Length = 280 Back     alignment and structure
>pdb|3OE2|A Chain A, 1.6 A Crystal Structure Of Peptidyl-Prolyl Cis-Trans Isomerase Ppiase From Pseudomonas Syringae Pv. Tomato Str. Dc3000 (Pspto Dc3000) Length = 219 Back     alignment and structure
>pdb|4DRJ|A Chain A, O-crystal Structure Of The Ppiase Domain Of Fkbp52, Rapamycin And The Frb Fragment Of Mtor Length = 144 Back     alignment and structure
>pdb|1N1A|A Chain A, Crystal Structure Of The N-Terminal Domain Of Human Fkbp52 Length = 140 Back     alignment and structure
>pdb|3B7X|A Chain A, Crystal Structure Of Human Fk506-Binding Protein 6 Length = 134 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query475
4dip_A125 Peptidyl-prolyl CIS-trans isomerase FKBP14; struct 9e-37
2vn1_A129 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR 4e-32
1u79_A129 FKBP-type peptidyl-prolyl CIS-trans isomerase 3; T 6e-32
2y78_A133 Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, 2e-31
3b7x_A134 FK506-binding protein 6; isomerase, repeat, rotama 3e-31
1yat_A113 FK506 binding protein; HET: FK5; 2.50A {Saccharomy 4e-31
3uf8_A209 Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- 6e-31
2d9f_A135 FK506-binding protein 8 variant; FKBP, rapamycin, 9e-31
2awg_A118 38 kDa FK-506 binding protein; FKBP-type, ppiase, 2e-30
2jwx_A157 FKBP38NTD, FK506-binding protein 8 variant; apopto 2e-30
2pbc_A102 FK506-binding protein 2; endoplasmic reticulum, is 3e-30
2lgo_A130 FKBP; infectious disease, isomerase, giardiasis, s 3e-29
2ppn_A107 FK506-binding protein 1A; high resolution protein 3e-29
3kz7_A119 FK506-binding protein 3; FKPB ppiase rapamycin, is 6e-29
3o5q_A128 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 2e-28
3o5e_A144 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 5e-28
2f4e_A180 ATFKBP42; FKBP-like, alpha-beta, signaling protein 7e-27
1r9h_A135 FKB-6, FK506 binding protein family; structural ge 7e-26
3jxv_A 356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 2e-24
3jxv_A356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 1e-21
3jxv_A 356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 3e-20
3oe2_A219 Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, 2e-24
1q1c_A 280 FK506-binding protein 4; rotamase, TPR repeat, nuc 3e-24
1q1c_A280 FK506-binding protein 4; rotamase, TPR repeat, nuc 2e-19
1fd9_A213 Protein (macrophage infectivity potentiator prote; 2e-23
1jvw_A167 Macrophage infectivity potentiator; chagas disease 1e-22
1q6h_A224 FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; 2e-22
1kt0_A 457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 2e-18
1kt0_A 457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 2e-16
2if4_A 338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 8e-15
2k8i_A171 SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, 5e-13
2kr7_A151 FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; 1e-12
2kfw_A 196 FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD 2e-12
4dt4_A169 FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; 8e-12
3cgm_A158 SLYD, peptidyl-prolyl CIS-trans isomerase; chapero 2e-10
1ix5_A151 FKBP; ppiase, isomerase; NMR {Methanothermococcust 2e-10
1p5q_A 336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 3e-10
3pr9_A157 FKBP-type peptidyl-prolyl CIS-trans isomerase; FKB 3e-09
3prb_A 231 FKBP-type peptidyl-prolyl CIS-trans isomerase; cha 5e-08
>4dip_A Peptidyl-prolyl CIS-trans isomerase FKBP14; structural genomics, structural genomics consortium, SGC, PE prolyl CIS-trans isomerase; 1.82A {Homo sapiens} Length = 125 Back     alignment and structure
 Score =  130 bits (329), Expect = 9e-37
 Identities = 42/117 (35%), Positives = 63/117 (53%), Gaps = 5/117 (4%)

Query: 362 TLPNGLVIQKLGTGKPDGKVAAPGKKISVLYTGKLKENGQVFDSNLG---STPLKFHLGG 418
                + I+ L       +    G  + V Y G L+++G +F S        P+ F LG 
Sbjct: 9   IPEPEVKIEVLQKPFICHRKTKGGDLMLVHYEGYLEKDGSLFHSTHKHNNGQPIWFTLGI 68

Query: 419 KEVIEGLNVGLEGMHVGEKRRLLIPPSLGYGSGGDDSKNIPPYSWLEFDVDLVKVHR 475
            E ++G + GL+GM VGEKR+L+IPP+LGYG  G     IPP S L F++DL+++  
Sbjct: 69  LEALKGWDQGLKGMCVGEKRKLIIPPALGYGKEG--KGKIPPESTLIFNIDLLEIRN 123
>2vn1_A 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR repeat; HET: FK5; 2.35A {Plasmodium falciparum} PDB: 2ofn_A 2ki3_A 3ihz_A* 3ni6_A 3pa7_A Length = 129 Back     alignment and structure
>1u79_A FKBP-type peptidyl-prolyl CIS-trans isomerase 3; TFKBP13, FK-506 binding protein; 1.85A {Arabidopsis thaliana} SCOP: d.26.1.1 PDB: 1y0o_A Length = 129 Back     alignment and structure
>2y78_A Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, virulence; HET: SO4 GOL; 0.91A {Burkholderia pseudomallei} PDB: 2ke0_A 2ko7_A* 2l2s_A* 4dz2_A* 4dz3_A* Length = 133 Back     alignment and structure
>3b7x_A FK506-binding protein 6; isomerase, repeat, rotamase, TPR repeat, williams-beuren syndrome, structural genomics consortium, SGC; 2.10A {Homo sapiens} Length = 134 Back     alignment and structure
>1yat_A FK506 binding protein; HET: FK5; 2.50A {Saccharomyces cerevisiae} SCOP: d.26.1.1 Length = 113 Back     alignment and structure
>3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 1euv_B 3v60_A 3v61_A 3v62_A* Length = 209 Back     alignment and structure
>2d9f_A FK506-binding protein 8 variant; FKBP, rapamycin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 135 Back     alignment and structure
>2awg_A 38 kDa FK-506 binding protein; FKBP-type, ppiase, BCL-2 inhibitor, SHH signalling antagonist, structural genomics consortium, SGC; 1.60A {Homo sapiens} PDB: 2f2d_A 3ey6_A Length = 118 Back     alignment and structure
>2jwx_A FKBP38NTD, FK506-binding protein 8 variant; apoptosis, beta barrel, central helix, with flexible N-terminal extension, isomerase; NMR {Homo sapiens} Length = 157 Back     alignment and structure
>2pbc_A FK506-binding protein 2; endoplasmic reticulum, isomerase, polymorphism, rotamase, structural genomics, structural genomics consortium, SGC; 1.80A {Homo sapiens} Length = 102 Back     alignment and structure
>2lgo_A FKBP; infectious disease, isomerase, giardiasis, ssgcid, structura genomics, seattle structural genomics center for infectious; NMR {Giardia lamblia} Length = 130 Back     alignment and structure
>2ppn_A FK506-binding protein 1A; high resolution protein structure, isomerase; 0.92A {Homo sapiens} SCOP: d.26.1.1 PDB: 1b6c_A 1a7x_A 1d7h_A 1d7i_A 1d7j_A* 1f40_A* 1fap_A* 1d6o_A* 1fkd_A* 1fkf_A* 1fkg_A* 1fkh_A* 1fki_A* 1fkj_A* 1fkr_A 1fks_A 1fkt_A 1j4h_A* 1j4i_A* 1j4r_A* ... Length = 107 Back     alignment and structure
>3kz7_A FK506-binding protein 3; FKPB ppiase rapamycin, isomerase, nucleus, phosphoprotein, R isomerase-inhibitor complex; HET: RAP; 1.95A {Mus musculus} PDB: 1pbk_A* Length = 119 Back     alignment and structure
>3o5q_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 0.96A {Homo sapiens} PDB: 3o5m_A 3o5l_A 3o5o_A 3o5p_A 3o5r_A* 4drq_A* 3o5j_A 3o5g_A 3o5i_A 3o5k_A Length = 128 Back     alignment and structure
>3o5e_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 1.60A {Homo sapiens} PDB: 3o5f_A Length = 144 Back     alignment and structure
>2f4e_A ATFKBP42; FKBP-like, alpha-beta, signaling protein; 2.32A {Arabidopsis thaliana} Length = 180 Back     alignment and structure
>1r9h_A FKB-6, FK506 binding protein family; structural genomics, peptidylprolyl isomerase, PSI, protein structure initiative; 1.80A {Caenorhabditis elegans} SCOP: d.26.1.1 Length = 135 Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Length = 356 Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Length = 356 Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Length = 356 Back     alignment and structure
>3oe2_A Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, FK506; HET: TAR SRT; 1.60A {Pseudomonas syringae PV} Length = 219 Back     alignment and structure
>1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Length = 280 Back     alignment and structure
>1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Length = 280 Back     alignment and structure
>1fd9_A Protein (macrophage infectivity potentiator prote; FKBP domain, long alpha helix, dimerisation VIA helical INTE isomerase; 2.41A {Legionella pneumophila} SCOP: d.26.1.1 PDB: 2uz5_A 2vcd_A* Length = 213 Back     alignment and structure
>1jvw_A Macrophage infectivity potentiator; chagas disease, X-RAY rotamase, isomeras; 1.70A {Trypanosoma cruzi} SCOP: d.26.1.1 Length = 167 Back     alignment and structure
>1q6h_A FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; chaperone, peptidyl-prolyl isomerase, heat shock protein, FK family; HET: MSE; 1.97A {Escherichia coli} SCOP: d.26.1.1 PDB: 1q6i_A* 1q6u_A Length = 224 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Length = 338 Back     alignment and structure
>2k8i_A SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, chaperone, rotamase; NMR {Escherichia coli} Length = 171 Back     alignment and structure
>2kr7_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; protein, rotamase; NMR {Helicobacter pylori} Length = 151 Back     alignment and structure
>2kfw_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD; protein, cobalt, copper, cytoplasm, metal- binding, nickel, rotamase, zinc; NMR {Escherichia coli} Length = 196 Back     alignment and structure
>4dt4_A FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; FKBP domain, IF domain, chaperone, peptidyl-prolyl isomerase isomerase; 1.35A {Escherichia coli} Length = 169 Back     alignment and structure
>3cgm_A SLYD, peptidyl-prolyl CIS-trans isomerase; chaperone function, two domain P rotamase; 2.41A {Thermus thermophilus} PDB: 3cgn_A 3luo_A* Length = 158 Back     alignment and structure
>1ix5_A FKBP; ppiase, isomerase; NMR {Methanothermococcusthermolithotrophicus} SCOP: d.26.1.1 Length = 151 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 Back     alignment and structure
>3pr9_A FKBP-type peptidyl-prolyl CIS-trans isomerase; FKBP protein, chaperone; 1.95A {Methanocaldococcus jannaschii} PDB: 3pra_A Length = 157 Back     alignment and structure
>3prb_A FKBP-type peptidyl-prolyl CIS-trans isomerase; chaperone; 2.20A {Methanocaldococcus jannaschii} PDB: 3prd_A Length = 231 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query475
2vn1_A129 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR 99.91
3kz7_A119 FK506-binding protein 3; FKPB ppiase rapamycin, is 99.91
1yat_A113 FK506 binding protein; HET: FK5; 2.50A {Saccharomy 99.91
2y78_A133 Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, 99.91
4dip_A125 Peptidyl-prolyl CIS-trans isomerase FKBP14; struct 99.91
3oe2_A219 Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, 99.91
1jvw_A167 Macrophage infectivity potentiator; chagas disease 99.9
1fd9_A213 Protein (macrophage infectivity potentiator prote; 99.9
2f4e_A180 ATFKBP42; FKBP-like, alpha-beta, signaling protein 99.9
3o5q_A128 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 99.89
2ppn_A107 FK506-binding protein 1A; high resolution protein 99.89
3o5e_A144 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 99.89
2jwx_A157 FKBP38NTD, FK506-binding protein 8 variant; apopto 99.89
2lgo_A130 FKBP; infectious disease, isomerase, giardiasis, s 99.89
3uf8_A209 Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- 99.89
2awg_A118 38 kDa FK-506 binding protein; FKBP-type, ppiase, 99.89
3b7x_A134 FK506-binding protein 6; isomerase, repeat, rotama 99.89
1q6h_A224 FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; 99.88
1u79_A129 FKBP-type peptidyl-prolyl CIS-trans isomerase 3; T 99.88
1r9h_A135 FKB-6, FK506 binding protein family; structural ge 99.88
2d9f_A135 FK506-binding protein 8 variant; FKBP, rapamycin, 99.87
2lkn_A165 AH receptor-interacting protein; FKBP-type domain, 99.86
2pbc_A102 FK506-binding protein 2; endoplasmic reticulum, is 99.84
1q1c_A 280 FK506-binding protein 4; rotamase, TPR repeat, nuc 99.83
1kt0_A 457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.8
2if4_A 338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.79
3jxv_A 356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 99.78
3jxv_A356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 99.76
1q1c_A280 FK506-binding protein 4; rotamase, TPR repeat, nuc 99.72
2k8i_A171 SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, 99.6
1hxv_A113 Trigger factor; FKBP fold, ppiase, chaperone; NMR 99.58
2kr7_A151 FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; 99.58
4dt4_A169 FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; 99.58
2kfw_A 196 FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD 99.57
3pr9_A157 FKBP-type peptidyl-prolyl CIS-trans isomerase; FKB 99.56
1p5q_A 336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.55
1ix5_A151 FKBP; ppiase, isomerase; NMR {Methanothermococcust 99.53
3prb_A 231 FKBP-type peptidyl-prolyl CIS-trans isomerase; cha 99.53
3cgm_A158 SLYD, peptidyl-prolyl CIS-trans isomerase; chapero 99.41
1w26_A 432 Trigger factor, TF; chaperone, protein folding, ri 99.29
1kt0_A 457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.15
1t11_A 392 Trigger factor, TF; helix-turn-helix, four-helix-b 99.11
3gty_X 433 Trigger factor, TF; chaperone-client complex, cell 97.76
>2vn1_A 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR repeat; HET: FK5; 2.35A {Plasmodium falciparum} PDB: 2ofn_A 2ki3_A 3ihz_A* 3ni6_A 3pa7_A Back     alignment and structure
Probab=99.91  E-value=2.6e-24  Score=188.93  Aligned_cols=123  Identities=33%  Similarity=0.574  Sum_probs=107.7

Q ss_pred             ccccccCCeeeCCCCeEE-EEEeec-CCCCCCCCCCCEEEEEEEEEEccCCeEEeccCCC-CCeEEecCCcchhhcHHHH
Q 011892          352 SAEGKLSLLRTLPNGLVI-QKLGTG-KPDGKVAAPGKKISVLYTGKLKENGQVFDSNLGS-TPLKFHLGGKEVIEGLNVG  428 (475)
Q Consensus       352 ~~~~k~~~v~ttpSGl~y-kILkeG-kgtG~~p~~GD~VtVhYtg~l~~DGkVfDST~~~-~P~~f~LG~g~lIpGLEeA  428 (475)
                      +.+.+..++.++++|+.| +++++| .++|..|..||.|+|||+++++.+|++|++++.+ .|+.|.+|.+.+|+||+++
T Consensus         2 ~~~~~~~~~~~~~~g~~~~~il~~G~~g~g~~~~~gd~V~v~Y~g~~~~dG~~fd~s~~~~~p~~f~lG~g~~i~g~e~~   81 (129)
T 2vn1_A            2 TTEQEFEKVELTADGGVIKTILKKGDEGEENIPKKGNEVTVHYVGKLESTGKVFDSSFDRNVPFKFHLEQGEVIKGWDIC   81 (129)
T ss_dssp             -----CEEEECSTTSSEEEEEEECCCCSGGGSCCTTCEEEEEEEEEETTTCCEEEEGGGTTCCEEEETTSSSSCHHHHHH
T ss_pred             CcccccCCcEECCCCCEEEEEEeCCCCCCCCcCCCCCEEEEEEEEEECCCCeEEEecCCCCccEEEEeCCCCcCHHHHHH
Confidence            356777888899999665 689976 4468999999999999999986799999999864 8999999999999999999


Q ss_pred             HcCCccCcEEEEEEcCCCCCCCCCCCCCCCCCCCeEEEEEEEEeeeC
Q 011892          429 LEGMHVGEKRRLLIPPSLGYGSGGDDSKNIPPYSWLEFDVDLVKVHR  475 (475)
Q Consensus       429 L~GMkvGEk~~ViIPp~LAYG~~G~~~kgIPPnStLVFdVELL~VKk  475 (475)
                      |.+|++|++++|+|||.+|||..+.++. |||+++|+|+|+|++|++
T Consensus        82 l~gm~~Ge~~~v~ip~~~aYG~~~~~~~-Ip~~~~l~f~vel~~v~~  127 (129)
T 2vn1_A           82 VSSMRKNEKCLVRIESMYGYGDEGCGES-IPGNSVLLFEIELLSFRE  127 (129)
T ss_dssp             HTTCCTTCEEEEEECGGGTTTTTCBTTT-BCTTCCEEEEEEEEEEEC
T ss_pred             HhCCCCCCEEEEEEChHHcCCCCCCCCC-cCCCCeEEEEEEEEEEec
Confidence            9999999999999999999999988776 999999999999999974
>3kz7_A FK506-binding protein 3; FKPB ppiase rapamycin, isomerase, nucleus, phosphoprotein, R isomerase-inhibitor complex; HET: RAP; 1.95A {Mus musculus} SCOP: d.26.1.1 PDB: 1pbk_A* Back     alignment and structure
>1yat_A FK506 binding protein; HET: FK5; 2.50A {Saccharomyces cerevisiae} SCOP: d.26.1.1 Back     alignment and structure
>2y78_A Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, virulence; HET: SO4 GOL; 0.91A {Burkholderia pseudomallei} PDB: 2ke0_A 2ko7_A* 2l2s_A* 4dz2_A* 4dz3_A* Back     alignment and structure
>4dip_A Peptidyl-prolyl CIS-trans isomerase FKBP14; structural genomics, structural genomics consortium, SGC, PE prolyl CIS-trans isomerase; 1.82A {Homo sapiens} Back     alignment and structure
>3oe2_A Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, FK506; HET: TAR SRT; 1.60A {Pseudomonas syringae PV} SCOP: d.26.1.0 Back     alignment and structure
>1jvw_A Macrophage infectivity potentiator; chagas disease, X-RAY rotamase, isomeras; 1.70A {Trypanosoma cruzi} SCOP: d.26.1.1 Back     alignment and structure
>1fd9_A Protein (macrophage infectivity potentiator prote; FKBP domain, long alpha helix, dimerisation VIA helical INTE isomerase; 2.41A {Legionella pneumophila} SCOP: d.26.1.1 PDB: 2uz5_A 2vcd_A* Back     alignment and structure
>2f4e_A ATFKBP42; FKBP-like, alpha-beta, signaling protein; 2.32A {Arabidopsis thaliana} Back     alignment and structure
>3o5q_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 0.96A {Homo sapiens} PDB: 3o5m_A 3o5l_A 3o5o_A 3o5p_A 3o5r_A* 4drk_A* 4drm_A* 4drn_A* 4dro_A* 4drp_A* 4drq_A* 3o5j_A 3o5g_A 3o5i_A 3o5k_A Back     alignment and structure
>2ppn_A FK506-binding protein 1A; high resolution protein structure, isomerase; 0.92A {Homo sapiens} SCOP: d.26.1.1 PDB: 1b6c_A 1a7x_A 1d7h_A 1d7i_A 1d7j_A* 1f40_A* 1fap_A* 1d6o_A* 1fkd_A* 1fkf_A* 1fkg_A* 1fkh_A* 1fki_A* 1fkj_A* 1fkr_A 1fks_A 1fkt_A 1j4h_A* 1j4i_A* 1j4r_A* ... Back     alignment and structure
>3o5e_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 1.60A {Homo sapiens} PDB: 3o5f_A Back     alignment and structure
>2jwx_A FKBP38NTD, FK506-binding protein 8 variant; apoptosis, beta barrel, central helix, with flexible N-terminal extension, isomerase; NMR {Homo sapiens} Back     alignment and structure
>2lgo_A FKBP; infectious disease, isomerase, giardiasis, ssgcid, structura genomics, seattle structural genomics center for infectious; NMR {Giardia lamblia} Back     alignment and structure
>3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 4giv_A* 1euv_B 3v60_A 3v61_A 3v62_A* Back     alignment and structure
>2awg_A 38 kDa FK-506 binding protein; FKBP-type, ppiase, BCL-2 inhibitor, SHH signalling antagonist, structural genomics consortium, SGC; 1.60A {Homo sapiens} PDB: 2f2d_A 3ey6_A Back     alignment and structure
>3b7x_A FK506-binding protein 6; isomerase, repeat, rotamase, TPR repeat, williams-beuren syndrome, structural genomics consortium, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>1q6h_A FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; chaperone, peptidyl-prolyl isomerase, heat shock protein, FK family; HET: MSE; 1.97A {Escherichia coli} SCOP: d.26.1.1 PDB: 1q6i_A* 1q6u_A Back     alignment and structure
>1u79_A FKBP-type peptidyl-prolyl CIS-trans isomerase 3; TFKBP13, FK-506 binding protein; 1.85A {Arabidopsis thaliana} SCOP: d.26.1.1 PDB: 1y0o_A Back     alignment and structure
>1r9h_A FKB-6, FK506 binding protein family; structural genomics, peptidylprolyl isomerase, PSI, protein structure initiative; 1.80A {Caenorhabditis elegans} SCOP: d.26.1.1 Back     alignment and structure
>2d9f_A FK506-binding protein 8 variant; FKBP, rapamycin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lkn_A AH receptor-interacting protein; FKBP-type domain, immunophilin homolog, protein binding; NMR {Homo sapiens} Back     alignment and structure
>2pbc_A FK506-binding protein 2; endoplasmic reticulum, isomerase, polymorphism, rotamase, structural genomics, structural genomics consortium, SGC; 1.80A {Homo sapiens} Back     alignment and structure
>1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Back     alignment and structure
>1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Back     alignment and structure
>2k8i_A SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, chaperone, rotamase; NMR {Escherichia coli} Back     alignment and structure
>1hxv_A Trigger factor; FKBP fold, ppiase, chaperone; NMR {Mycoplasma genitalium} SCOP: d.26.1.1 Back     alignment and structure
>2kr7_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; protein, rotamase; NMR {Helicobacter pylori} Back     alignment and structure
>4dt4_A FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; FKBP domain, IF domain, chaperone, peptidyl-prolyl isomerase isomerase; 1.35A {Escherichia coli} Back     alignment and structure
>2kfw_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD; protein, cobalt, copper, cytoplasm, metal- binding, nickel, rotamase, zinc; NMR {Escherichia coli} Back     alignment and structure
>3pr9_A FKBP-type peptidyl-prolyl CIS-trans isomerase; FKBP protein, chaperone; 1.95A {Methanocaldococcus jannaschii} SCOP: d.26.1.0 PDB: 3pra_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>1ix5_A FKBP; ppiase, isomerase; NMR {Methanothermococcusthermolithotrophicus} SCOP: d.26.1.1 Back     alignment and structure
>3prb_A FKBP-type peptidyl-prolyl CIS-trans isomerase; chaperone; 2.20A {Methanocaldococcus jannaschii} PDB: 3prd_A Back     alignment and structure
>3cgm_A SLYD, peptidyl-prolyl CIS-trans isomerase; chaperone function, two domain P rotamase; 2.41A {Thermus thermophilus} PDB: 3cgn_A 3luo_A* Back     alignment and structure
>1w26_A Trigger factor, TF; chaperone, protein folding, ribosome associated protein, nascent chain, cell division, isomerase; 2.7A {Escherichia coli} SCOP: a.223.1.1 d.241.2.1 d.26.1.1 PDB: 2vrh_A 1w2b_5 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1t11_A Trigger factor, TF; helix-turn-helix, four-helix-bundle, ppiase, chaperone; 2.50A {Vibrio cholerae} SCOP: a.223.1.1 d.241.2.1 d.26.1.1 PDB: 1l1p_A Back     alignment and structure
>3gty_X Trigger factor, TF; chaperone-client complex, cell cycle, cell division, chapero isomerase, rotamase, ribonucleoprotein, binding; 3.40A {Thermotoga maritima} PDB: 3gu0_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 475
d1q6ha_210 d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase 4e-18
d1fd9a_204 d.26.1.1 (A:) Macrophage infectivity potentiator p 2e-16
d1yata_113 d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeas 2e-15
d1pbka_116 d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 2e-15
d2ppna1107 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12) 2e-15
d1u79a_125 d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis tha 4e-15
d1kt1a3115 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {M 8e-15
d1r9ha_118 d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabd 2e-13
d1kt1a2111 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Mo 2e-13
d1q1ca1120 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Hu 4e-13
d1q1ca2117 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {H 3e-12
d1jvwa_160 d.26.1.1 (A:) Macrophage infectivity potentiator p 4e-12
d1hxva_85 d.26.1.1 (A:) Trigger factor PPIase domain {Mycopl 6e-09
>d1q6ha_ d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase FkpA {Escherichia coli [TaxId: 562]} Length = 210 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: FKBP-like
superfamily: FKBP-like
family: FKBP immunophilin/proline isomerase
domain: Peptidyl-prolyl cis-trans isomerase FkpA
species: Escherichia coli [TaxId: 562]

 Score = 80.3 bits (197), Expect = 4e-18
 Identities = 56/203 (27%), Positives = 82/203 (40%), Gaps = 17/203 (8%)

Query: 278 MGQDTPGRVEQNEQQVTDVIPGNDVDQSVAELQPEKKKKKKKRRTEEDGKDSNMETHPLS 337
           +G+     +++ E+    +    D DQ +A +Q     K K    E +      E    S
Sbjct: 17  LGRYMENSLKEQEKLGIKL----DKDQLIAGVQDAFADKSKLSDQEIEQTLQAFEARVKS 72

Query: 338 MDAMSGSVMVTENSSAEG-------KLSLLRTLPNGLVIQKLGTGKPDGKVAAPGKKISV 390
                      +N +          K   ++T   GLV Q +  G   G+       + V
Sbjct: 73  SAQAKMEKDAADNEAKGKEYREKFAKEKGVKTSSTGLVYQVVEAG--KGEAPKDSDTVVV 130

Query: 391 LYTGKLKENGQVFDSNLGSTPLKFHLGGKEVIEGLNVGLEGMHVGEKRRLLIPPSLGYGS 450
            Y G L +  +  +S     PL F L G  VI G   GL+ +  G K +L+IPP L YG 
Sbjct: 131 NYKGTLIDGKEFDNSYTRGEPLSFRLDG--VIPGWTEGLKNIKKGGKIKLVIPPELAYGK 188

Query: 451 GGDDSKNIPPYSWLEFDVDLVKV 473
            G     IPP S L FDV+L+ V
Sbjct: 189 AG--VPGIPPNSTLVFDVELLDV 209
>d1fd9a_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Legionella pneumophila [TaxId: 446]} Length = 204 Back     information, alignment and structure
>d1yata_ d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 113 Back     information, alignment and structure
>d1pbka_ d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 9606]} Length = 116 Back     information, alignment and structure
>d2ppna1 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1u79a_ d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 125 Back     information, alignment and structure
>d1kt1a3 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 115 Back     information, alignment and structure
>d1r9ha_ d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabditis elegans [TaxId: 6239]} Length = 118 Back     information, alignment and structure
>d1kt1a2 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 111 Back     information, alignment and structure
>d1q1ca1 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 120 Back     information, alignment and structure
>d1q1ca2 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1jvwa_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Trypanosoma cruzi [TaxId: 5693]} Length = 160 Back     information, alignment and structure
>d1hxva_ d.26.1.1 (A:) Trigger factor PPIase domain {Mycoplasma genitalium [TaxId: 2097]} Length = 85 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query475
d1fd9a_204 Macrophage infectivity potentiator protein (MIP) { 99.93
d1q6ha_210 Peptidyl-prolyl cis-trans isomerase FkpA {Escheric 99.93
d1q1ca1120 FKBP52, N-terminal domains {Human (Homo sapiens) [ 99.92
d2ppna1107 FK-506 binding protein (FKBP12), an immunophilin { 99.91
d1yata_113 Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyc 99.91
d1kt1a2111 FKBP51, N-terminal domains {Monkey (Saimiri bolivi 99.91
d1r9ha_118 FKB-6, N-terminal domain {Caenorhabditis elegans [ 99.91
d1jvwa_160 Macrophage infectivity potentiator protein (MIP) { 99.91
d1u79a_125 FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 99.89
d1pbka_116 FKBP25 {Human (Homo sapiens) [TaxId: 9606]} 99.89
d1kt1a3115 FKBP51, N-terminal domains {Monkey (Saimiri bolivi 99.87
d1q1ca2117 FKBP52, N-terminal domains {Human (Homo sapiens) [ 99.83
d1ix5a_151 Archaeal FKBP {Archaeon Methanococcus thermolithot 99.53
d1hxva_85 Trigger factor PPIase domain {Mycoplasma genitaliu 99.46
d1l1pa_106 Trigger factor PPIase domain {Escherichia coli [Ta 98.96
d1t11a3113 Trigger factor PPIase domain {Vibrio cholerae [Tax 98.87
>d1fd9a_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: FKBP-like
superfamily: FKBP-like
family: FKBP immunophilin/proline isomerase
domain: Macrophage infectivity potentiator protein (MIP)
species: Legionella pneumophila [TaxId: 446]

Probab=99.93  E-value=1e-26  Score=217.79  Aligned_cols=120  Identities=28%  Similarity=0.506  Sum_probs=111.1

Q ss_pred             ccccccccCCeeeCCCCeEEEEEeecCCCCCCCCCCCEEEEEEEEEEccCCeEEeccCCC-CCeEEecCCcchhhcHHHH
Q 011892          350 NSSAEGKLSLLRTLPNGLVIQKLGTGKPDGKVAAPGKKISVLYTGKLKENGQVFDSNLGS-TPLKFHLGGKEVIEGLNVG  428 (475)
Q Consensus       350 ~~~~~~k~~~v~ttpSGl~ykILkeGkgtG~~p~~GD~VtVhYtg~l~~DGkVfDST~~~-~P~~f~LG~g~lIpGLEeA  428 (475)
                      ..+++.+.+.++++++||+|+|+++|  .|..|..||.|.|||++++ .||++|++++.+ .|+.|.+|  .+|+||++|
T Consensus        83 fl~~~~~~~~v~~~~sGl~y~v~~~G--~G~~p~~~d~v~v~y~g~l-~dg~~f~~s~~~~~p~~~~~~--~~i~G~~e~  157 (204)
T d1fd9a_          83 FLTENKNKPGVVVLPSGLQYKVINSG--NGVKPGKSDTVTVEYTGRL-IDGTVFDSTEKTGKPATFQVS--QVIPGWTEA  157 (204)
T ss_dssp             HHHHHHHSTTEEECTTSCEEEEEECC--CSCCCCTTCEEEEEEEEEE-TTSCEEEEHHHHCSCEEEEGG--GSCHHHHHH
T ss_pred             HHHhcccCCceEEecCccEEEEeecC--CCcccCCCCEEEEEEEEEE-CCCCEecccccCCCCceecCC--ccchhHHHH
Confidence            34566778899999999999999999  7999999999999999999 899999998765 78888877  799999999


Q ss_pred             HcCCccCcEEEEEEcCCCCCCCCCCCCCCCCCCCeEEEEEEEEeeeC
Q 011892          429 LEGMHVGEKRRLLIPPSLGYGSGGDDSKNIPPYSWLEFDVDLVKVHR  475 (475)
Q Consensus       429 L~GMkvGEk~~ViIPp~LAYG~~G~~~kgIPPnStLVFdVELL~VKk  475 (475)
                      |.+|++|++++|+|||.+|||..|.++. ||||++|+|+|+|++|++
T Consensus       158 l~~m~~G~~~~~~iP~~laYG~~g~~~~-Ipp~s~l~feveL~~i~k  203 (204)
T d1fd9a_         158 LQLMPAGSTWEIYVPSGLAYGPRSVGGP-IGPNETLIFKIHLISVKK  203 (204)
T ss_dssp             HTTCCTTCEEEEEECGGGTTTTCCCSSS-CCTTCCEEEEEEEEEEEC
T ss_pred             hcCCCCCCEEEEEEChHHCcCCCCCCCC-cCcCCcEEEEEEEEEEEc
Confidence            9999999999999999999999998776 999999999999999985
>d1q6ha_ d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase FkpA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q1ca1 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ppna1 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yata_ d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kt1a2 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1r9ha_ d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1jvwa_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1u79a_ d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1pbka_ d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a3 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1q1ca2 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ix5a_ d.26.1.1 (A:) Archaeal FKBP {Archaeon Methanococcus thermolithotrophicus [TaxId: 2186]} Back     information, alignment and structure
>d1hxva_ d.26.1.1 (A:) Trigger factor PPIase domain {Mycoplasma genitalium [TaxId: 2097]} Back     information, alignment and structure
>d1l1pa_ d.26.1.1 (A:) Trigger factor PPIase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t11a3 d.26.1.1 (A:135-247) Trigger factor PPIase domain {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure