Citrus Sinensis ID: 011907


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-----
MATRFIFLSFCLLFSSTLTISNAKIFPTFPSSRITPEKLSSLISSSKDSQGLYKTKYHTQILDHFNYNPQSYQTFQQRYLINDTHWGGSKNNAPIFVYTGNEGDIEWFAQNTGFMYDVAPKFKALLVFIEHRYYGKSIPYGGNKEIAYKNASTTGYLSSTQALADYASLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAPILNFDNIVSPYSFSNIITQDFRSVSENCYKVIKGSWKQIEETAKKPGGLEKLQKAFRICKSEKNLAIESWLSTAFVYTAMTDYPTPSNFLNPLPAFPVKEMCKAIDDPKTGNDVFAKLYGAASVYYNYSGTAKCFDLNGDSDPHGLSEWGWQACTEMIMLTGGDNKDSIFEESEEDYDARARYCKEAYGVDPRPNWITTEFGGHKIGLVLKRFASNIIFFNGLRDPWSGGGYDLYPFAIQTSLSVEKIFITFCICICFH
ccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccEEEEEEEEcccccccccccccEEEEEEEEccccccccccccEEEEEcccccccHHHHcccHHHHHHHHcccEEEEEEccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccccEEEEcccccccccccccccccccEEEEEEccccEEccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHcccccccHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccHHHHHHHHHccccccccccccccccccccccccccccccEEEEEccccccccccccccccccccccHHHHHHHHHHHcccccccccHHcccccccccccccccccEEEEEccccccccccccccccccccccccccEEEEEcccccccc
cccHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccEEEEEEEEcccccccccccccEEEEEEEEcHHcccccccccEEEEEccccccHHEcccccHHHHHHHHcccEEEEEEEEEcccccccccccccccccHHHcccccHHHHHHHHHHHHHHHHHccccccccEEEEEccHHHHHHHHHHHHcccEEEEEEHccccEEEccccccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHccccHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHcccccccHHHHHHHHHcEEEEEccccccccccccccccccccccEEEEcEEEEEEccccccccccccccccHHHHHHHHHHHHcccccccHEEEHccccccHHHccccccEEEEEcccccccccccEEEEEEEEccccccccccccEEEEEEcc
MATRFIFLSFCLLFSstltisnakifptfpssritpekLSSLISsskdsqglyktkYHTQILdhfnynpqsyqTFQQRYLIndthwggsknnapifvytgnegdieWFAQNTGFMYDVAPKFKALLVFIEHRyygksipyggnkeiayknasttgylssTQALADYASLIIDLKknltatdspvvvfggsyggMLAAWFRLKYPHVAIGalassapilnfdnivspysfsniitqdfRSVSENCYKVIKGSWKQIEETAKKPGGLEKLQKAFRICKSEKNLAIESWLSTAFVYTAmtdyptpsnflnplpafpvkemckaiddpktgndVFAKLYGAASVYYnysgtakcfdlngdsdphglsewgWQACTEMIMLtggdnkdsifEESEEDYDARARYCKeaygvdprpnwittefgghKIGLVLKRFASNIiffnglrdpwsgggydlypfaIQTSLSVEKIFITFCICICFH
MATRFIFLSFCLLFSSTLTISNAkifptfpssritpEKLSSLISSSKDSQGLYKTKYHTQILDHFNYNPQSYQTFQQRYLINDTHWGGSKNNAPIFVYTGNEGDIEWFAQNTGFMYDVAPKFKALLVFIEHRYYgksipyggNKEIAYKNASTTGYLSSTQALADYASLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAPILNFDNIVSPYSFSNIITQDFRSVSENCYKVIKGSWKQIeetakkpgglekLQKAFRICKSEKNLAIESWLSTAFVYTAMTDYPTPSNFLNPLPAFPVKEMCKAIDDPKTGNDVFAKLYGAASVYYNYSGTAKCFDLNGDSDPHGLSEWGWQACTEMIMLTGGDNKDSIFEESEEDYDARARYCKEaygvdprpnwITTEFGGHKIGLVLKRFASNIIFFNGLRDPWSGGGYDLYPFAIQTSLSVEKIFITFCICICFH
MATRfiflsfcllfsstltisNAKIFPTFPSSRITPEklsslissskdsQGLYKTKYHTQILDHFNYNPQSYQTFQQRYLINDTHWGGSKNNAPIFVYTGNEGDIEWFAQNTGFMYDVAPKFKALLVFIEHRYYGKSIPYGGNKEIAYKNASTTGYLSSTQALADYASLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAPILNFDNIVSPYSFSNIITQDFRSVSENCYKVIKGSWKQIEETAKKPGGLEKLQKAFRICKSEKNLAIESWLSTAFVYTAMTDYPTPSNFLNPLPAFPVKEMCKAIDDPKTGNDVFAKLYGAASVYYNYSGTAKCFDLNGDSDPHGLSEWGWQACTEMIMLTGGDNKDSIFEESEEDYDARARYCKEAYGVDPRPNWITTEFGGHKIGLVLKRFASNIIFFNGLRDPWSGGGYDLYPFAIQTSLSVEKifitfcicicfH
***RFIFLSFCLLFSSTLTISNAKIFPTF*********************GLYKTKYHTQILDHFNYNPQSYQTFQQRYLINDTHWGGSKNNAPIFVYTGNEGDIEWFAQNTGFMYDVAPKFKALLVFIEHRYYGKSIPYGGNKEIAYKNASTTGYLSSTQALADYASLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAPILNFDNIVSPYSFSNIITQDFRSVSENCYKVIKGSWKQIEETAKKPGGLEKLQKAFRICKSEKNLAIESWLSTAFVYTAMTDYPTPSNFLNPLPAFPVKEMCKAIDDPKTGNDVFAKLYGAASVYYNYSGTAKCFDLNGDSDPHGLSEWGWQACTEMIMLTGGDNKDSIF*****DYDARARYCKEAYGVDPRPNWITTEFGGHKIGLVLKRFASNIIFFNGLRDPWSGGGYDLYPFAIQTSLSVEKIFITFCICICF*
*ATRFIFLSFCLLFSSTLTISNAK*****************************KTKYHTQILDHFNYNPQSYQTFQQRYLINDTHWGGSKNNAPIFVYTGNEGDIEWFAQNTGFMYDVAPKFKALLVFIEHRYYGKSIPYGGNKEIAYKNASTTGYLSSTQALADYASLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAPILNFDNIVSPYSFSNIITQDFRSVSENCYKVIKGSWKQIEETAKKPGGLEKLQKAFRICKSEKNLAIESWLSTAFVYTAMTDYPTPSNFLNPLPAFPVKEMCKAIDDPKTGNDVFAKLYGAASVYYNYSGTAKCFDLNGDSDPHGLSEWGWQACTEMIMLTGGDNKDSIFEESEEDYDARARYCKEAYGVDPRPNWITTEFGGHKIGLVLKRFASNIIFFNGLRDPWSGGGY***************IFITFCICICFH
MATRFIFLSFCLLFSSTLTISNAKIFPTFPSSRITPEKLSSLISSSKDSQGLYKTKYHTQILDHFNYNPQSYQTFQQRYLINDTHWGGSKNNAPIFVYTGNEGDIEWFAQNTGFMYDVAPKFKALLVFIEHRYYGKSIPYGGNKEIAYKNASTTGYLSSTQALADYASLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAPILNFDNIVSPYSFSNIITQDFRSVSENCYKVIKGSWKQIEETAKKPGGLEKLQKAFRICKSEKNLAIESWLSTAFVYTAMTDYPTPSNFLNPLPAFPVKEMCKAIDDPKTGNDVFAKLYGAASVYYNYSGTAKCFDLNGDSDPHGLSEWGWQACTEMIMLTGGDNKDSIFEESEEDYDARARYCKEAYGVDPRPNWITTEFGGHKIGLVLKRFASNIIFFNGLRDPWSGGGYDLYPFAIQTSLSVEKIFITFCICICFH
*ATRFIFLSFCLLFSSTLTISNAKIFPTFPSSRIT************DSQGLYKTKYHTQILDHFNYNPQSYQTFQQRYLINDTHWGGSKNNAPIFVYTGNEGDIEWFAQNTGFMYDVAPKFKALLVFIEHRYYGKSIPYGGNKEIAYKNASTTGYLSSTQALADYASLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAPILNFDNIVSPYSFSNIITQDFRSVSENCYKVIKGSWKQIEETAKKPGGLEKLQKAFRICKSEKNLAIESWLSTAFVYTAMTDYPTPSNFLNPLPAFPVKEMCKAIDDPKTGNDVFAKLYGAASVYYNYSGTAKCFDLNGDSDPHGLSEWGWQACTEMIMLTGGDNKDSIFEESEEDYDARARYCKEAYGVDPRPNWITTEFGGHKIGLVLKRFASNIIFFNGLRDPWSGGGYDLYPFAIQTSLSVEKIFITFCICICFH
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooo
SSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATRFIFLSFCLLFSSTLTISNAKIFPTFPSSRITPEKLSSLISSSKDSQGLYKTKYHTQILDHFNYNPQSYQTFQQRYLINDTHWGGSKNNAPIFVYTGNEGDIEWFAQNTGFMYDVAPKFKALLVFIEHRYYGKSIPYGGNKEIAYKNASTTGYLSSTQALADYASLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAPILNFDNIVSPYSFSNIITQDFRSVSENCYKVIKGSWKQIEETAKKPGGLEKLQKAFRICKSEKNLAIESWLSTAFVYTAMTDYPTPSNFLNPLPAFPVKEMCKAIDDPKTGNDVFAKLYGAASVYYNYSGTAKCFDLNGDSDPHGLSEWGWQACTEMIMLTGGDNKDSIFEESEEDYDARARYCKEAYGVDPRPNWITTEFGGHKIGLVLKRFASNIIFFNGLRDPWSGGGYDLYPFAIQTSLSVEKIFITFCICICFH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query475 2.2.26 [Sep-21-2011]
Q7TMR0491 Lysosomal Pro-X carboxype yes no 0.806 0.780 0.446 3e-94
Q5RBU7496 Lysosomal Pro-X carboxype yes no 0.833 0.798 0.433 4e-94
P42785496 Lysosomal Pro-X carboxype yes no 0.833 0.798 0.433 5e-94
Q2TA14499 Lysosomal Pro-X carboxype yes no 0.806 0.767 0.450 2e-93
Q9EPB1500 Dipeptidyl peptidase 2 OS no no 0.827 0.786 0.393 1e-77
Q9UHL4492 Dipeptidyl peptidase 2 OS no no 0.827 0.798 0.384 2e-76
Q9ET22506 Dipeptidyl peptidase 2 OS no no 0.827 0.776 0.389 8e-72
P34676507 Prolyl carboxy peptidase yes no 0.888 0.832 0.359 5e-65
P34610565 Putative serine protease no no 0.821 0.690 0.337 1e-55
Q9NQE7514 Thymus-specific serine pr no no 0.770 0.712 0.255 3e-30
>sp|Q7TMR0|PCP_MOUSE Lysosomal Pro-X carboxypeptidase OS=Mus musculus GN=Prcp PE=2 SV=2 Back     alignment and function desciption
 Score =  346 bits (887), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 179/401 (44%), Positives = 245/401 (61%), Gaps = 18/401 (4%)

Query: 53  YKTKYHTQILDHFNYNPQSYQTFQQRYLINDTHWGGSKNNAPIFVYTGNEGDIEWFAQNT 112
           Y   Y  Q +DHF +     +TF+QRYL+ D HW   +N   I  YTGNEGDI WF  NT
Sbjct: 46  YSVLYFEQKVDHFGF--ADMRTFKQRYLVADKHW--QRNGGSILFYTGNEGDIVWFCNNT 101

Query: 113 GFMYDVAPKFKALLVFIEHRYYGKSIPYGGNKEIAYKNASTTGYLSSTQALADYASLIID 172
           GFM+DVA + KA+LVF EHRYYG+S+P+G +   ++K++    +L+S QALAD+A LI  
Sbjct: 102 GFMWDVAEELKAMLVFAEHRYYGESLPFGQD---SFKDSQHLNFLTSEQALADFAELIRH 158

Query: 173 LKKNLT-ATDSPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAPILNFDNIVSPYSFSN 231
           L+K +  A   PV+  GGSYGGMLAAWFR+KYPH+ +GALA+SAPI   D +V    F  
Sbjct: 159 LEKTIPGAQGQPVIAIGGSYGGMLAAWFRMKYPHIVVGALAASAPIWQLDGMVPCGEFMK 218

Query: 232 IITQDFRSVSENCYKVIKGSWKQIEETAKKPGGLEKLQKAFRICK---SEKNLAIESWLS 288
           I+T DFR     C + I+ SW  I++ +    GL+ L     +C    SEK   ++ W++
Sbjct: 219 IVTNDFRKSGPYCSESIRKSWNVIDKLSGSGSGLQSLTNILHLCSPLTSEKIPTLKGWIA 278

Query: 289 TAFVYTAMTDYPTPSNFLNPLPAFPVKEMCKAIDDPKTGNDVFAK-LYGAASVYYNYSGT 347
             +V  AM +YP   NFL PLPA+P+KE+C+ + +P   + V  + ++ A SVYYNYSG 
Sbjct: 279 ETWVNLAMVNYPYACNFLQPLPAWPIKEVCQYLKNPNVSDTVLLQNIFQALSVYYNYSGQ 338

Query: 348 AKCFDLNGDSDPH-GLSEWGWQACTEMIMLTGGDNKDSIFEESEEDYDARARYCKEAYGV 406
           A C +++  +    G   W +QACTEM+M    +  D +FE    D +  +  C   +GV
Sbjct: 339 AACLNISQTTTSSLGSMGWSFQACTEMVMPFCTNGIDDMFEPFLWDLEKYSNDCFNQWGV 398

Query: 407 DPRPNWITTEFGGHKIGLVLKRFASNIIFFNGLRDPWSGGG 447
            PRP+W+TT +GG  I        SNIIF NG  DPWSGGG
Sbjct: 399 KPRPHWMTTMYGGKNIS-----SHSNIIFSNGELDPWSGGG 434




Cleaves C-terminal amino acids linked to proline in peptides such as angiotensin II, III and des-Arg9-bradykinin. This cleavage occurs at acidic pH, but enzymatic activity is retained with some substrates at neutral pH.
Mus musculus (taxid: 10090)
EC: 3EC: .EC: 4EC: .EC: 1EC: 6EC: .EC: 2
>sp|Q5RBU7|PCP_PONAB Lysosomal Pro-X carboxypeptidase OS=Pongo abelii GN=PRCP PE=2 SV=1 Back     alignment and function description
>sp|P42785|PCP_HUMAN Lysosomal Pro-X carboxypeptidase OS=Homo sapiens GN=PRCP PE=1 SV=1 Back     alignment and function description
>sp|Q2TA14|PCP_BOVIN Lysosomal Pro-X carboxypeptidase OS=Bos taurus GN=PRCP PE=2 SV=1 Back     alignment and function description
>sp|Q9EPB1|DPP2_RAT Dipeptidyl peptidase 2 OS=Rattus norvegicus GN=Dpp7 PE=1 SV=1 Back     alignment and function description
>sp|Q9UHL4|DPP2_HUMAN Dipeptidyl peptidase 2 OS=Homo sapiens GN=DPP7 PE=1 SV=3 Back     alignment and function description
>sp|Q9ET22|DPP2_MOUSE Dipeptidyl peptidase 2 OS=Mus musculus GN=Dpp7 PE=2 SV=2 Back     alignment and function description
>sp|P34676|PCP5_CAEEL Prolyl carboxy peptidase like protein 5 OS=Caenorhabditis elegans GN=pcp-5 PE=1 SV=1 Back     alignment and function description
>sp|P34610|PCP1_CAEEL Putative serine protease pcp-1 OS=Caenorhabditis elegans GN=pcp-1 PE=1 SV=2 Back     alignment and function description
>sp|Q9NQE7|TSSP_HUMAN Thymus-specific serine protease OS=Homo sapiens GN=PRSS16 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query475
225440787507 PREDICTED: lysosomal Pro-X carboxypeptid 0.930 0.871 0.745 0.0
224088466461 predicted protein [Populus trichocarpa] 0.930 0.958 0.732 0.0
297740163485 unnamed protein product [Vitis vinifera] 0.871 0.853 0.766 0.0
255579351508 lysosomal pro-X carboxypeptidase, putati 0.901 0.842 0.746 0.0
147788546554 hypothetical protein VITISV_036738 [Viti 0.907 0.777 0.723 0.0
356503833508 PREDICTED: lysosomal Pro-X carboxypeptid 0.926 0.866 0.709 0.0
356570875507 PREDICTED: lysosomal Pro-X carboxypeptid 0.926 0.867 0.708 0.0
449437430502 PREDICTED: lysosomal Pro-X carboxypeptid 0.92 0.870 0.656 1e-167
449521545501 PREDICTED: lysosomal Pro-X carboxypeptid 0.917 0.870 0.656 1e-166
356505400504 PREDICTED: lysosomal Pro-X carboxypeptid 0.930 0.876 0.66 1e-165
>gi|225440787|ref|XP_002281618.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  684 bits (1765), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/448 (74%), Positives = 377/448 (84%), Gaps = 6/448 (1%)

Query: 1   MATRFIFLSFCLLFSSTLTISNAKIFPTFPSSRITPEKLSSLISSSKDSQGLYKTKYHTQ 60
           MAT FI     L   S+   S+AKI P FPSS + PE+LS  +SS  +   LY+ KY TQ
Sbjct: 4   MATTFILPCIFLFSISSSGFSSAKITPRFPSSIVRPEQLS--VSSQTE---LYEAKYFTQ 58

Query: 61  ILDHFNYNPQSYQTFQQRYLINDTHWGGSKNNAPIFVYTGNEGDIEWFAQNTGFMYDVAP 120
           +LDHFNY PQSY+TFQQRYLIND +WGG+   APIFVYTGNEGDIEWFAQNTGFM+D AP
Sbjct: 59  LLDHFNYQPQSYRTFQQRYLINDKYWGGADKLAPIFVYTGNEGDIEWFAQNTGFMFDTAP 118

Query: 121 KFKALLVFIEHRYYGKSIPYGGNKEIAYKNASTTGYLSSTQALADYASLIIDLKKNLTAT 180
            F+ALLVFIEHR+YGKSIP+GG+  +AY NAST GYLSSTQALADYA+LIIDLKKNL+AT
Sbjct: 119 HFQALLVFIEHRFYGKSIPFGGDTNVAYSNASTLGYLSSTQALADYATLIIDLKKNLSAT 178

Query: 181 DSPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAPILNFDNIVSPYSFSNIITQDFRSV 240
           +SPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAPILNF+NI SPY+F+NIITQDFRS 
Sbjct: 179 NSPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAPILNFENITSPYTFNNIITQDFRSE 238

Query: 241 SENCYKVIKGSWKQIEETAKKPGGLEKLQKAFRICKSE-KNLAIESWLSTAFVYTAMTDY 299
           SENCYKVIKGSW+QIEETA K GGLE L+K+FRICK+     AIE+WLSTA+VYTAMTDY
Sbjct: 239 SENCYKVIKGSWEQIEETAMKNGGLEVLRKSFRICKNYISGGAIENWLSTAYVYTAMTDY 298

Query: 300 PTPSNFLNPLPAFPVKEMCKAIDDPKTGNDVFAKLYGAASVYYNYSGTAKCFDLNGDSDP 359
           PTPSNFL+P+PA+PVK+MCKAIDDP  GND FAKLYGAA+VYYNY+GTA CFDL  DSDP
Sbjct: 299 PTPSNFLSPMPAYPVKQMCKAIDDPAQGNDTFAKLYGAANVYYNYTGTAACFDLADDSDP 358

Query: 360 HGLSEWGWQACTEMIMLTGGDNKDSIFEESEEDYDARARYCKEAYGVDPRPNWITTEFGG 419
           HGL EW WQACTEMIM    +N++SIF  S  +Y  RA +CK A+ ++PRPNWITTEFGG
Sbjct: 359 HGLGEWTWQACTEMIMPVNANNEESIFPVSTWNYSNRAAFCKFAFDIEPRPNWITTEFGG 418

Query: 420 HKIGLVLKRFASNIIFFNGLRDPWSGGG 447
           H I  VLKRF SNIIFFNGLRDPWSGGG
Sbjct: 419 HDIKRVLKRFGSNIIFFNGLRDPWSGGG 446




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224088466|ref|XP_002308456.1| predicted protein [Populus trichocarpa] gi|222854432|gb|EEE91979.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297740163|emb|CBI30345.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255579351|ref|XP_002530520.1| lysosomal pro-X carboxypeptidase, putative [Ricinus communis] gi|223529924|gb|EEF31852.1| lysosomal pro-X carboxypeptidase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|147788546|emb|CAN61013.1| hypothetical protein VITISV_036738 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356503833|ref|XP_003520707.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Glycine max] Back     alignment and taxonomy information
>gi|356570875|ref|XP_003553609.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Glycine max] Back     alignment and taxonomy information
>gi|449437430|ref|XP_004136495.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449521545|ref|XP_004167790.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356505400|ref|XP_003521479.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query475
TAIR|locus:2047495494 AT2G24280 "AT2G24280" [Arabido 0.816 0.785 0.580 2.4e-124
TAIR|locus:2169945515 AT5G65760 [Arabidopsis thalian 0.884 0.815 0.5 2.1e-116
UNIPROTKB|F1STV0493 PRCP "Uncharacterized protein" 0.806 0.776 0.457 1.5e-92
UNIPROTKB|F1NWF2433 PRCP "Uncharacterized protein" 0.785 0.861 0.454 3.5e-91
RGD|1307842493 Prcp "prolylcarboxypeptidase ( 0.806 0.776 0.441 6.5e-90
MGI|MGI:1919711491 Prcp "prolylcarboxypeptidase ( 0.806 0.780 0.446 1.4e-89
UNIPROTKB|F1MAU4499 PRCP "Lysosomal Pro-X carboxyp 0.806 0.767 0.452 2.2e-89
UNIPROTKB|P42785496 PRCP "Lysosomal Pro-X carboxyp 0.806 0.772 0.441 7.5e-89
UNIPROTKB|Q2TA14499 PRCP "Lysosomal Pro-X carboxyp 0.806 0.767 0.450 2e-88
UNIPROTKB|F1PWK3497 PRCP "Uncharacterized protein" 0.806 0.770 0.442 3.7e-87
TAIR|locus:2047495 AT2G24280 "AT2G24280" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1222 (435.2 bits), Expect = 2.4e-124, P = 2.4e-124
 Identities = 230/396 (58%), Positives = 289/396 (72%)

Query:    53 YKTKYHTQILDHFNYNPQSYQTFQQRYLINDTHWGGSKNNAPIFVYTGNEGDIEWFAQNT 112
             ++T+Y  Q LDHF++ P SY+ F Q+YLIN+  W   +   PIFVYTGNEGDI+WFA NT
Sbjct:    46 FETRYFPQNLDHFSFTPDSYKVFHQKYLINNRFW---RKGGPIFVYTGNEGDIDWFASNT 102

Query:   113 GFMYDVAPKFKALLVFIEHRYYGKSIPYGGNKEIAYKNASTTGYLSSTQALADYASLIID 172
             GFM D+APKF+ALLVFIEHR+YG+S P+G  K+ ++K+A T GYL+S QALADYA LI  
Sbjct:   103 GFMLDIAPKFRALLVFIEHRFYGESTPFG--KK-SHKSAETLGYLNSQQALADYAILIRS 159

Query:   173 LKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAPILNFDNIVSPYSFSNI 232
             LK+NL++  SPVVVFGGSYGGMLAAWFRLKYPH+ IGALASSAPIL+FDNIV   SF + 
Sbjct:   160 LKQNLSSEASPVVVFGGSYGGMLAAWFRLKYPHITIGALASSAPILHFDNIVPLTSFYDA 219

Query:   233 ITQDFRSVSENCYKVIKGSWKQIEETAKKPGGLEKLQKAFRICKS-EKNLAIESWLSTAF 291
             I+QDF+  S NC+KVIK SW+++E  +    GL++L K FR CK      +   WLS AF
Sbjct:   220 ISQDFKDASINCFKVIKRSWEELEAVSTMKNGLQELSKKFRTCKGLHSQYSARDWLSGAF 279

Query:   292 VYTAMTDYPTPSNFLNPLPAFPVKEMCKAIDDPKTGNDVFAKLYGAASVYYNYSGTAKCF 351
             VYTAM +YPT +NF+ PLP +PV++MCK ID    G+    + + AAS+YYNYSG+ KCF
Sbjct:   280 VYTAMVNYPTAANFMAPLPGYPVEQMCKIIDGFPRGSSNLDRAFAAASLYYNYSGSEKCF 339

Query:   352 DLNGDSDPHGLSEWGWQACTEMIMLTGGDNKDSIFEESEEDYDARARYCKEAYGVDPRPN 411
             ++   +D HGL  W +QACTEM+M     N+ S+    E D +A    C   YGV PRP+
Sbjct:   340 EMEQQTDDHGLDGWQYQACTEMVMPMSCSNQ-SMLPPYENDSEAFQEQCMTRYGVKPRPH 398

Query:   412 WITTEFGGHKIGLVLKRFASNIIFFNGLRDPWSGGG 447
             WITTEFGG +I  VLKRF SNIIF NG++DPWS GG
Sbjct:   399 WITTEFGGMRIETVLKRFGSNIIFSNGMQDPWSRGG 434




GO:0004185 "serine-type carboxypeptidase activity" evidence=ISS
GO:0005764 "lysosome" evidence=ISS
GO:0006508 "proteolysis" evidence=IEA
GO:0008236 "serine-type peptidase activity" evidence=IEA
GO:0009507 "chloroplast" evidence=ISM
GO:0019761 "glucosinolate biosynthetic process" evidence=RCA
TAIR|locus:2169945 AT5G65760 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|F1STV0 PRCP "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1NWF2 PRCP "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
RGD|1307842 Prcp "prolylcarboxypeptidase (angiotensinase C)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1919711 Prcp "prolylcarboxypeptidase (angiotensinase C)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1MAU4 PRCP "Lysosomal Pro-X carboxypeptidase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P42785 PRCP "Lysosomal Pro-X carboxypeptidase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q2TA14 PRCP "Lysosomal Pro-X carboxypeptidase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1PWK3 PRCP "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P34676PCP5_CAEEL3, ., 4, ., -, ., -0.35970.88840.8323yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00021554001
SubName- Full=Chromosome chr8 scaffold_23, whole genome shotgun sequence; (504 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query475
pfam05577433 pfam05577, Peptidase_S28, Serine carboxypeptidase 2e-75
pfam12697187 pfam12697, Abhydrolase_6, Alpha/beta hydrolase fam 3e-04
>gnl|CDD|218645 pfam05577, Peptidase_S28, Serine carboxypeptidase S28 Back     alignment and domain information
 Score =  243 bits (621), Expect = 2e-75
 Identities = 116/411 (28%), Positives = 176/411 (42%), Gaps = 40/411 (9%)

Query: 60  QILDHFNYNPQSYQTFQQRYLINDTHWGGSKNNAPIFVYTGNEGDIEWFAQNTGFMYDVA 119
           Q LDHF+  P + +TFQQRY  ND H+   +N  PIF+  G EG         G   D+A
Sbjct: 1   QKLDHFD--PSNNRTFQQRYFYNDQHY---RNGGPIFLMIGGEGPESASWVRNGHWLDLA 55

Query: 120 PKFKALLVFIEHRYYGKSIPYGGNKEIAYKNASTTG--YLSSTQALADYASLIIDLKKNL 177
            +F AL+  +EHR+YG+S P G          ST    YLSS QALAD AS I  + +  
Sbjct: 56  KEFGALVFSLEHRFYGQSKPIGDL--------STANLRYLSSLQALADVASFIKAMNQKF 107

Query: 178 -TATDSPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAPILNFDNIVSPYSFSNIITQD 236
              + S  + FGGSY G LAAW R KYPH+ +GA+ASSAP+L     V    ++ ++   
Sbjct: 108 NGLSSSKWITFGGSYSGSLAAWARKKYPHLVVGAVASSAPLLAK---VDFKEYNMVVETS 164

Query: 237 FRSVSENCYKVIKGSWKQIEETAKKPGGLEKLQKAFRIC-----KSEKNLAIESWLSTAF 291
                  CY  ++  + ++EE      G + L K  ++C      ++ ++    + +   
Sbjct: 165 LAQTGGECYDAVENGFAEVEELLLTKEGRQALSKLLQLCPPLNVTTDLDILNF-FSNIYS 223

Query: 292 VYTAMTDYPTPSNFLNPLPAFPVKEMCKAIDDPKTGNDV--FAKL-----YGAASVYYNY 344
            +  +  Y       + L  + + ++CK + +  T + +     L     Y       N 
Sbjct: 224 PFQGVVQYTYDGQGNSTLNGYSIPDLCKIMLNATTTDLILRVEVLIQLFNYLNQKSGNNS 283

Query: 345 SGTAKCFDLNGDSDPHGLS-----EWGWQACTEMIMLTGGDNKDSIFEESEEDYDARARY 399
           +        N        S     +W WQ CTE       D+ +  F  S          
Sbjct: 284 TMDISYQLANASYGDSSGSYADDRQWTWQTCTEFGWYQTTDSGNGPF-GSPVPASLFIDM 342

Query: 400 CKEAYGVDPRPNWITT--EFGGHKIGLVLKRFASNIIFFNGLRDPWSGGGY 448
           C + +G D     I+       +  G      A+N++F NG  DPW   G 
Sbjct: 343 CMDVFGADYNSTKISLRVSATNYYYGGADNPNATNVVFVNGDLDPWHALGK 393


These serine proteases include several eukaryotic enzymes such as lysosomal Pro-X carboxypeptidase, dipeptidyl-peptidase II, and thymus-specific serine peptidase. Length = 433

>gnl|CDD|221720 pfam12697, Abhydrolase_6, Alpha/beta hydrolase family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 475
KOG2183492 consensus Prolylcarboxypeptidase (angiotensinase C 100.0
PF05577434 Peptidase_S28: Serine carboxypeptidase S28; InterP 100.0
KOG2182514 consensus Hydrolytic enzymes of the alpha/beta hyd 100.0
PF05576448 Peptidase_S37: PS-10 peptidase S37; InterPro: IPR0 99.96
PLN02298330 hydrolase, alpha/beta fold family protein 98.46
PLN02385349 hydrolase; alpha/beta fold family protein 98.34
TIGR01250288 pro_imino_pep_2 proline-specific peptidases, Bacil 98.23
PF12697228 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3 98.21
TIGR01840212 esterase_phb esterase, PHB depolymerase family. Th 98.19
TIGR01249306 pro_imino_pep_1 proline iminopeptidase, Neisseria- 98.18
PRK00870302 haloalkane dehalogenase; Provisional 98.16
TIGR02427251 protocat_pcaD 3-oxoadipate enol-lactonase. Members 98.11
PRK10749330 lysophospholipase L2; Provisional 98.08
PLN02824294 hydrolase, alpha/beta fold family protein 98.03
TIGR03056278 bchO_mg_che_rel putative magnesium chelatase acces 97.98
TIGR02240276 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymer 97.96
PHA02857276 monoglyceride lipase; Provisional 97.94
TIGR03695251 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene 97.93
TIGR03343282 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-die 97.87
TIGR03611257 RutD pyrimidine utilization protein D. This protei 97.86
PRK10673255 acyl-CoA esterase; Provisional 97.85
PF00561230 Abhydrolase_1: alpha/beta hydrolase fold A web pag 97.82
TIGR01607332 PST-A Plasmodium subtelomeric family (PST-A). Thes 97.8
PRK03592295 haloalkane dehalogenase; Provisional 97.8
PRK10566249 esterase; Provisional 97.78
PLN02211273 methyl indole-3-acetate methyltransferase 97.74
PLN02894402 hydrolase, alpha/beta fold family protein 97.74
PLN02511388 hydrolase 97.68
PLN02965255 Probable pheophorbidase 97.66
PLN02652395 hydrolase; alpha/beta fold family protein 97.61
PLN03084383 alpha/beta hydrolase fold protein; Provisional 97.58
PRK11126242 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxyl 97.57
KOG1455313 consensus Lysophospholipase [Lipid transport and m 97.52
COG2267298 PldB Lysophospholipase [Lipid metabolism] 97.51
PRK08775343 homoserine O-acetyltransferase; Provisional 97.47
PRK06489360 hypothetical protein; Provisional 97.45
TIGR01738245 bioH putative pimeloyl-BioC--CoA transferase BioH. 97.41
PRK14875371 acetoin dehydrogenase E2 subunit dihydrolipoyllysi 97.41
KOG4178322 consensus Soluble epoxide hydrolase [Lipid transpo 97.4
PF00326213 Peptidase_S9: Prolyl oligopeptidase family This fa 97.4
PRK03204286 haloalkane dehalogenase; Provisional 97.39
PLN029801655 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesi 97.38
PLN03087481 BODYGUARD 1 domain containing hydrolase; Provision 97.33
PLN02578354 hydrolase 97.32
PRK10985324 putative hydrolase; Provisional 97.32
TIGR03101266 hydr2_PEP hydrolase, ortholog 2, exosortase system 97.31
TIGR02821275 fghA_ester_D S-formylglutathione hydrolase. This m 97.31
PLN02679360 hydrolase, alpha/beta fold family protein 97.28
TIGR00976 550 /NonD putative hydrolase, CocE/NonD family. This m 97.16
PF10503220 Esterase_phd: Esterase PHB depolymerase 97.11
PRK10349256 carboxylesterase BioH; Provisional 97.11
PRK07581339 hypothetical protein; Validated 97.03
TIGR03100274 hydr1_PEP hydrolase, ortholog 1, exosortase system 96.95
PRK05855 582 short chain dehydrogenase; Validated 96.9
PLN02442283 S-formylglutathione hydrolase 96.89
PRK05077414 frsA fermentation/respiration switch protein; Revi 96.83
KOG2564343 consensus Predicted acetyltransferases and hydrola 96.69
PF12695145 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3 96.65
TIGR01836350 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synth 96.65
PF07859211 Abhydrolase_3: alpha/beta hydrolase fold A web pag 96.63
PRK10115686 protease 2; Provisional 96.62
PRK11460232 putative hydrolase; Provisional 96.5
TIGR03502792 lipase_Pla1_cef extracellular lipase, Pla-1/cef fa 96.49
TIGR01392351 homoserO_Ac_trn homoserine O-acetyltransferase. Th 96.41
COG0596282 MhpC Predicted hydrolases or acyltransferases (alp 96.28
cd00707275 Pancreat_lipase_like Pancreatic lipase-like enzyme 96.01
PRK10162318 acetyl esterase; Provisional 96.01
PLN00021313 chlorophyllase 95.74
TIGR03230442 lipo_lipase lipoprotein lipase. Members of this pr 95.69
PLN02872395 triacylglycerol lipase 95.62
PF11144403 DUF2920: Protein of unknown function (DUF2920); In 95.6
PF09752348 DUF2048: Uncharacterized conserved protein (DUF204 95.5
COG1506620 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-pept 95.36
cd00312493 Esterase_lipase Esterases and lipases (includes fu 95.2
PTZ00472462 serine carboxypeptidase (CBP1); Provisional 95.17
COG3509312 LpqC Poly(3-hydroxybutyrate) depolymerase [Seconda 94.99
PF00975229 Thioesterase: Thioesterase domain; InterPro: IPR00 94.91
KOG2382315 consensus Predicted alpha/beta hydrolase [General 94.75
PF00756251 Esterase: Putative esterase; InterPro: IPR000801 T 94.29
COG0657312 Aes Esterase/lipase [Lipid metabolism] 94.27
PRK00175379 metX homoserine O-acetyltransferase; Provisional 94.21
KOG4391300 consensus Predicted alpha/beta hydrolase BEM46 [Ge 93.79
COG0429345 Predicted hydrolase of the alpha/beta-hydrolase fo 93.55
TIGR01838532 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, 93.44
PRK06765389 homoserine O-acetyltransferase; Provisional 93.04
PF05677365 DUF818: Chlamydia CHLPS protein (DUF818); InterPro 92.97
PF07819225 PGAP1: PGAP1-like protein; InterPro: IPR012908 The 92.78
KOG4409365 consensus Predicted hydrolase/acyltransferase (alp 92.05
PRK11071190 esterase YqiA; Provisional 92.04
COG2021368 MET2 Homoserine acetyltransferase [Amino acid tran 91.75
KOG2281867 consensus Dipeptidyl aminopeptidases/acylaminoacyl 91.06
COG1770682 PtrB Protease II [Amino acid transport and metabol 91.02
PRK13604307 luxD acyl transferase; Provisional 90.73
PF02129272 Peptidase_S15: X-Pro dipeptidyl-peptidase (S15 fam 90.59
PRK10439411 enterobactin/ferric enterobactin esterase; Provisi 90.23
KOG1838409 consensus Alpha/beta hydrolase [General function p 90.1
COG3208244 GrsT Predicted thioesterase involved in non-riboso 89.99
PF10230266 DUF2305: Uncharacterised conserved protein (DUF230 89.65
PF03403379 PAF-AH_p_II: Platelet-activating factor acetylhydr 89.13
PLN02733440 phosphatidylcholine-sterol O-acyltransferase 88.46
COG4099387 Predicted peptidase [General function prediction o 87.81
COG0400207 Predicted esterase [General function prediction on 87.81
KOG1553517 consensus Predicted alpha/beta hydrolase BAT5 [Gen 87.56
KOG1552258 consensus Predicted alpha/beta hydrolase [General 87.47
PF00135535 COesterase: Carboxylesterase family The prints ent 87.36
PF02230216 Abhydrolase_2: Phospholipase/Carboxylesterase; Int 86.93
PRK05371 767 x-prolyl-dipeptidyl aminopeptidase; Provisional 86.78
COG2819264 Predicted hydrolase of the alpha/beta superfamily 86.33
KOG1454326 consensus Predicted hydrolase/acyltransferase (alp 86.3
PF06259177 Abhydrolase_8: Alpha/beta hydrolase; InterPro: IPR 85.86
KOG2100755 consensus Dipeptidyl aminopeptidase [Posttranslati 85.15
PF05728187 UPF0227: Uncharacterised protein family (UPF0227); 84.36
PF01764140 Lipase_3: Lipase (class 3); InterPro: IPR002921 Tr 83.2
cd00741153 Lipase Lipase. Lipases are esterases that can hydr 81.19
PF06500411 DUF1100: Alpha/beta hydrolase of unknown function 80.25
>KOG2183 consensus Prolylcarboxypeptidase (angiotensinase C) [Posttranslational modification, protein turnover, chaperones; General function prediction only] Back     alignment and domain information
Probab=100.00  E-value=1.6e-115  Score=877.36  Aligned_cols=390  Identities=51%  Similarity=0.984  Sum_probs=368.8

Q ss_pred             CCCcceeeeEEecCCCCCCCCCCCCeeeeEEEEeccccCCCCCCCcEEEEeCCCCCccccccccchhhchhhhcCceEEE
Q 011907           49 SQGLYKTKYHTQILDHFNYNPQSYQTFQQRYLINDTHWGGSKNNAPIFVYTGNEGDIEWFAQNTGFMYDVAPKFKALLVF  128 (475)
Q Consensus        49 ~~~~~~~~~f~Q~lDHF~~~~~~~~TF~QRY~vn~~~~~~~~~~gPIfly~GgEg~~~~~~~~~g~~~~lA~~~gA~vv~  128 (475)
                      .+..++++||.|+||||++.+.  .||+|||++|++||++  .+||||+|+|+||++++|.+++|||+++|+++||+||+
T Consensus        41 ~~~~ye~~yf~q~LDHFsF~~~--~tF~qRylin~~fw~~--g~gPIffYtGNEGdie~Fa~ntGFm~D~Ap~~~AllVF  116 (492)
T KOG2183|consen   41 GEYNYETRYFQQPLDHFSFTDN--KTFDQRYLINDDFWKK--GEGPIFFYTGNEGDIEWFANNTGFMWDLAPELKALLVF  116 (492)
T ss_pred             ccccceeEEeecccccccccCc--cceeeEEEEecccccC--CCCceEEEeCCcccHHHHHhccchHHhhhHhhCceEEE
Confidence            4677999999999999999865  8999999999999985  24999999999999999999999999999999999999


Q ss_pred             EeeeeeecCccCCCCccccccCCCCCCCCChhhHHHHHHHHHHHHhhhCCCCCCCEEEEccChhhHHHHHHHHhCCCeeE
Q 011907          129 IEHRYYGKSIPYGGNKEIAYKNASTTGYLSSTQALADYASLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVAI  208 (475)
Q Consensus       129 lEHRyYG~S~P~~~~~~~~~~st~nL~yLts~QALaD~a~Fi~~~k~~~~~~~~pwI~fGGSY~G~LAAW~R~kYP~lv~  208 (475)
                      +||||||||+||++.   ++++.++|.|||+||||||+|.+++++|+++++..+|||+||||||||||||||+||||++.
T Consensus       117 aEHRyYGeS~PFG~~---s~k~~~hlgyLtseQALADfA~ll~~lK~~~~a~~~pvIafGGSYGGMLaAWfRlKYPHiv~  193 (492)
T KOG2183|consen  117 AEHRYYGESLPFGSQ---SYKDARHLGYLTSEQALADFAELLTFLKRDLSAEASPVIAFGGSYGGMLAAWFRLKYPHIVL  193 (492)
T ss_pred             eehhccccCCCCcch---hccChhhhccccHHHHHHHHHHHHHHHhhccccccCcEEEecCchhhHHHHHHHhcChhhhh
Confidence            999999999999984   89999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEEecccccccccCCcCchhhhHHHHHhhhcCChhhHHHHHHHHHHHHHHhcCCCcHHHHHHHhhhcCCCC--hHHHHHH
Q 011907          209 GALASSAPILNFDNIVSPYSFSNIITQDFRSVSENCYKVIKGSWKQIEETAKKPGGLEKLQKAFRICKSEK--NLAIESW  286 (475)
Q Consensus       209 gavASSAPv~a~~~~~df~~y~~~V~~~~~~~~~~C~~~i~~a~~~i~~~~~~~~g~~~Lk~~F~lc~~l~--~~d~~~~  286 (475)
                      ||+||||||++|++.+|...|+.+|+++|+..+++|.+.|+++|..|+++..+++|++.|++.|++|.+++  ..++..|
T Consensus       194 GAlAaSAPvl~f~d~vp~~~f~~ivT~~F~~as~~C~~~I~~sW~ai~~l~~~~nG~q~Ls~~f~lc~~ln~d~~~l~d~  273 (492)
T KOG2183|consen  194 GALAASAPVLYFEDTVPKDVFYRIVTRDFKDASPNCRNTIRKSWDAIDRLAAKDNGLQILSKAFKLCKPLNDDIGDLKDY  273 (492)
T ss_pred             hhhhccCceEeecCCCCcchhhhHHHHHHHhhcHHHHHHHHHHHHHHHHHhcCcchHHHHHHHhhhcccccccHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999984  4678999


Q ss_pred             HHHhhhhhhhccCCCCCCCCCCCCCCcHHHHhhhccCCCCC-chHHHHHHHHhhhhhcccCCcccccCCCCCCCC--CCC
Q 011907          287 LSTAFVYTAMTDYPTPSNFLNPLPAFPVKEMCKAIDDPKTG-NDVFAKLYGAASVYYNYSGTAKCFDLNGDSDPH--GLS  363 (475)
Q Consensus       287 l~~~~~~~~~~~y~~~~~~~~~~p~~~v~~~C~~i~~~~~~-~~~~~~l~~~~~~~~n~~~~~~C~d~~~~~~~~--~~r  363 (475)
                      ++.++.+++|+|||++++|+.++|++||+++|+.|++.... .+.++++++++++||||+|+..|+|+++++..+  +.|
T Consensus       274 l~ea~~ylAMVdYPy~t~Fl~pLPa~PV~~~C~~i~~~~~~~~~ll~~i~a~~~~yyNytg~~~C~d~sd~t~~~~~d~~  353 (492)
T KOG2183|consen  274 LREAYEYLAMVDYPYPTSFLAPLPAWPVKVVCKYINAPGPNDSDLLDRIFAAVNLYYNYTGSEKCYDISDPTYGSGLDDL  353 (492)
T ss_pred             HHHHHHHHHHhcCCCCccccCcCCCCcHHHHHHHhccCCCChHHHHHHHHHHhhheeccCCCcchhccccccCCCCCCcC
Confidence            99999999999999999999999999999999999876544 678999999999999999999999998655433  358


Q ss_pred             cceeeeecccccccCCCCCCCCCcCCCCChHHHHHHHHhhhCCCCChhHHHHhhCCCCccccccCCCCeEEEECCCCCCC
Q 011907          364 EWGWQACTEMIMLTGGDNKDSIFEESEEDYDARARYCKEAYGVDPRPNWITTEFGGHKIGLVLKRFASNIIFFNGLRDPW  443 (475)
Q Consensus       364 ~W~wQtCtE~g~~~t~~~~~~~f~~~~~~~~~~~~~C~~~FGi~~~~~~~n~~yGG~~~~~~~~~~~snIiFsNG~~DPW  443 (475)
                      +|.||+|||++|++++++..+||++.++|.+.+++.|.+.||++|+|+|++++|||.++..     .|||||+||.+|||
T Consensus       354 gW~~QaCtEmVMp~~~ng~~~mf~~~~fn~~~y~e~C~~~~~v~prP~wi~t~fgg~~l~~-----~SNiIFSNG~LDPW  428 (492)
T KOG2183|consen  354 GWPWQACTEMVMPMCSNGVDDMFPDCPFNSESYQEGCMQTFGVTPRPKWITTEFGGADLSA-----FSNIIFSNGLLDPW  428 (492)
T ss_pred             CCchhhhhhhhhccccCCCcccCCCCCCCHHHHHHHHHHhcCCCCCCcceehhhccccchh-----hcceeeeCCCcCCc
Confidence            9999999999999999999999999999999999999999999999999999999988764     59999999999999


Q ss_pred             CCCCccc
Q 011907          444 SGGGYDL  450 (475)
Q Consensus       444 ~~~gv~~  450 (475)
                      +++||++
T Consensus       429 SGGGV~~  435 (492)
T KOG2183|consen  429 SGGGVLK  435 (492)
T ss_pred             cCcCeec
Confidence            9999988



>PF05577 Peptidase_S28: Serine carboxypeptidase S28; InterPro: IPR008758 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG2182 consensus Hydrolytic enzymes of the alpha/beta hydrolase fold [Posttranslational modification, protein turnover, chaperones; General function prediction only] Back     alignment and domain information
>PF05576 Peptidase_S37: PS-10 peptidase S37; InterPro: IPR008761 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PLN02298 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PLN02385 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>TIGR01250 pro_imino_pep_2 proline-specific peptidases, Bacillus coagulans-type subfamily Back     alignment and domain information
>PF12697 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3LLC_A 3A2N_E 3A2M_A 3A2L_A 3AFI_F 3C5V_A 3C5W_P 3E0X_A 2ZJF_A 3QYJ_A Back     alignment and domain information
>TIGR01840 esterase_phb esterase, PHB depolymerase family Back     alignment and domain information
>TIGR01249 pro_imino_pep_1 proline iminopeptidase, Neisseria-type subfamily Back     alignment and domain information
>PRK00870 haloalkane dehalogenase; Provisional Back     alignment and domain information
>TIGR02427 protocat_pcaD 3-oxoadipate enol-lactonase Back     alignment and domain information
>PRK10749 lysophospholipase L2; Provisional Back     alignment and domain information
>PLN02824 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein Back     alignment and domain information
>TIGR02240 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymerase Back     alignment and domain information
>PHA02857 monoglyceride lipase; Provisional Back     alignment and domain information
>TIGR03695 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Back     alignment and domain information
>TIGR03343 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase Back     alignment and domain information
>TIGR03611 RutD pyrimidine utilization protein D Back     alignment and domain information
>PRK10673 acyl-CoA esterase; Provisional Back     alignment and domain information
>PF00561 Abhydrolase_1: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>TIGR01607 PST-A Plasmodium subtelomeric family (PST-A) Back     alignment and domain information
>PRK03592 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PRK10566 esterase; Provisional Back     alignment and domain information
>PLN02211 methyl indole-3-acetate methyltransferase Back     alignment and domain information
>PLN02894 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PLN02511 hydrolase Back     alignment and domain information
>PLN02965 Probable pheophorbidase Back     alignment and domain information
>PLN02652 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>PLN03084 alpha/beta hydrolase fold protein; Provisional Back     alignment and domain information
>PRK11126 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase; Provisional Back     alignment and domain information
>KOG1455 consensus Lysophospholipase [Lipid transport and metabolism] Back     alignment and domain information
>COG2267 PldB Lysophospholipase [Lipid metabolism] Back     alignment and domain information
>PRK08775 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PRK06489 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01738 bioH putative pimeloyl-BioC--CoA transferase BioH Back     alignment and domain information
>PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional Back     alignment and domain information
>KOG4178 consensus Soluble epoxide hydrolase [Lipid transport and metabolism] Back     alignment and domain information
>PF00326 Peptidase_S9: Prolyl oligopeptidase family This family belongs to family S9 of the peptidase classification Back     alignment and domain information
>PRK03204 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PLN02980 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding / thiamin pyrophosphate binding Back     alignment and domain information
>PLN03087 BODYGUARD 1 domain containing hydrolase; Provisional Back     alignment and domain information
>PLN02578 hydrolase Back     alignment and domain information
>PRK10985 putative hydrolase; Provisional Back     alignment and domain information
>TIGR03101 hydr2_PEP hydrolase, ortholog 2, exosortase system type 1 associated Back     alignment and domain information
>TIGR02821 fghA_ester_D S-formylglutathione hydrolase Back     alignment and domain information
>PLN02679 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>TIGR00976 /NonD putative hydrolase, CocE/NonD family Back     alignment and domain information
>PF10503 Esterase_phd: Esterase PHB depolymerase Back     alignment and domain information
>PRK10349 carboxylesterase BioH; Provisional Back     alignment and domain information
>PRK07581 hypothetical protein; Validated Back     alignment and domain information
>TIGR03100 hydr1_PEP hydrolase, ortholog 1, exosortase system type 1 associated Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PLN02442 S-formylglutathione hydrolase Back     alignment and domain information
>PRK05077 frsA fermentation/respiration switch protein; Reviewed Back     alignment and domain information
>KOG2564 consensus Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>PF12695 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3D0K_B 2I3D_B 3DOH_B 3DOI_B 3PFB_A 3S2Z_B 3PFC_A 3QM1_A 3PF8_B 3PF9_A Back     alignment and domain information
>TIGR01836 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synthase, class III, PhaC subunit Back     alignment and domain information
>PF07859 Abhydrolase_3: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>PRK11460 putative hydrolase; Provisional Back     alignment and domain information
>TIGR03502 lipase_Pla1_cef extracellular lipase, Pla-1/cef family Back     alignment and domain information
>TIGR01392 homoserO_Ac_trn homoserine O-acetyltransferase Back     alignment and domain information
>COG0596 MhpC Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>cd00707 Pancreat_lipase_like Pancreatic lipase-like enzymes Back     alignment and domain information
>PRK10162 acetyl esterase; Provisional Back     alignment and domain information
>PLN00021 chlorophyllase Back     alignment and domain information
>TIGR03230 lipo_lipase lipoprotein lipase Back     alignment and domain information
>PLN02872 triacylglycerol lipase Back     alignment and domain information
>PF11144 DUF2920: Protein of unknown function (DUF2920); InterPro: IPR022605 This bacterial family of proteins has no known function Back     alignment and domain information
>PF09752 DUF2048: Uncharacterized conserved protein (DUF2048); InterPro: IPR019149 This family of proteins has no known function Back     alignment and domain information
>COG1506 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism] Back     alignment and domain information
>cd00312 Esterase_lipase Esterases and lipases (includes fungal lipases, cholinesterases, etc Back     alignment and domain information
>PTZ00472 serine carboxypeptidase (CBP1); Provisional Back     alignment and domain information
>COG3509 LpqC Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF00975 Thioesterase: Thioesterase domain; InterPro: IPR001031 Thioesterase domains often occur integrated in or associated with peptide synthetases which are involved in the non-ribosomal synthesis of peptide antibiotics [] Back     alignment and domain information
>KOG2382 consensus Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>PF00756 Esterase: Putative esterase; InterPro: IPR000801 This family contains several seemingly unrelated proteins, including human esterase D; mycobacterial antigen 85, which is responsible for the high affinity of mycobacteria to fibronectin; Corynebacterium glutamicum major secreted protein PS1; and hypothetical proteins from Escherichia coli, yeast, mycobacteria and Haemophilus influenzae Back     alignment and domain information
>COG0657 Aes Esterase/lipase [Lipid metabolism] Back     alignment and domain information
>PRK00175 metX homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>KOG4391 consensus Predicted alpha/beta hydrolase BEM46 [General function prediction only] Back     alignment and domain information
>COG0429 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only] Back     alignment and domain information
>TIGR01838 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, class I Back     alignment and domain information
>PRK06765 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PF05677 DUF818: Chlamydia CHLPS protein (DUF818); InterPro: IPR008536 This family of unknown function includes several Chlamydia CHLPS proteins and Legionella SidB proteins Back     alignment and domain information
>PF07819 PGAP1: PGAP1-like protein; InterPro: IPR012908 The sequences found in this family are similar to PGAP1 (Q765A7 from SWISSPROT) Back     alignment and domain information
>KOG4409 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>PRK11071 esterase YqiA; Provisional Back     alignment and domain information
>COG2021 MET2 Homoserine acetyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2281 consensus Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1770 PtrB Protease II [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13604 luxD acyl transferase; Provisional Back     alignment and domain information
>PF02129 Peptidase_S15: X-Pro dipeptidyl-peptidase (S15 family); InterPro: IPR000383 This entry represents a domain found peptidases Xaa-Pro dipeptidyl-peptidase and glutaryl-7-aminocephalosporanic-acid acylase, which belong to MEROPS peptidase families S15 and S45 respectively [] Back     alignment and domain information
>PRK10439 enterobactin/ferric enterobactin esterase; Provisional Back     alignment and domain information
>KOG1838 consensus Alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>COG3208 GrsT Predicted thioesterase involved in non-ribosomal peptide biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF10230 DUF2305: Uncharacterised conserved protein (DUF2305); InterPro: IPR019363 This entry contains proteins that have no known function Back     alignment and domain information
>PF03403 PAF-AH_p_II: Platelet-activating factor acetylhydrolase, isoform II; PDB: 3F98_B 3F97_B 3D59_A 3F96_A 3D5E_B 3F9C_A Back     alignment and domain information
>PLN02733 phosphatidylcholine-sterol O-acyltransferase Back     alignment and domain information
>COG4099 Predicted peptidase [General function prediction only] Back     alignment and domain information
>COG0400 Predicted esterase [General function prediction only] Back     alignment and domain information
>KOG1553 consensus Predicted alpha/beta hydrolase BAT5 [General function prediction only] Back     alignment and domain information
>KOG1552 consensus Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>PF00135 COesterase: Carboxylesterase family The prints entry is specific to acetylcholinesterase; InterPro: IPR002018 Higher eukaryotes have many distinct esterases Back     alignment and domain information
>PF02230 Abhydrolase_2: Phospholipase/Carboxylesterase; InterPro: IPR003140 This entry represents the alpha/beta hydrolase domain found in phospholipases [], carboxylesterases [] and thioesterases Back     alignment and domain information
>PRK05371 x-prolyl-dipeptidyl aminopeptidase; Provisional Back     alignment and domain information
>COG2819 Predicted hydrolase of the alpha/beta superfamily [General function prediction only] Back     alignment and domain information
>KOG1454 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>PF06259 Abhydrolase_8: Alpha/beta hydrolase; InterPro: IPR010427 This is a family of uncharacterised proteins found in Actinobacteria Back     alignment and domain information
>KOG2100 consensus Dipeptidyl aminopeptidase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05728 UPF0227: Uncharacterised protein family (UPF0227); InterPro: IPR008886 Despite being classed as uncharacterised proteins, the members of this family are almost certainly enzymes in that they contain a domain distantly related to IPR000073 from INTERPRO Back     alignment and domain information
>PF01764 Lipase_3: Lipase (class 3); InterPro: IPR002921 Triglyceride lipases are lipolytic enzymes that hydrolyse ester linkages of triglycerides [] Back     alignment and domain information
>cd00741 Lipase Lipase Back     alignment and domain information
>PF06500 DUF1100: Alpha/beta hydrolase of unknown function (DUF1100); InterPro: IPR010520 Proteins in this entry display esterase activity toward pNP-butyrate [] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query475
3n2z_B446 The Structure Of Human Prolylcarboxypeptidase At 2. 5e-95
3jyh_A469 Human Dipeptidyl Peptidase Dpp7 Length = 469 4e-77
4ebb_A472 Structure Of Dpp2 Length = 472 9e-75
>pdb|3N2Z|B Chain B, The Structure Of Human Prolylcarboxypeptidase At 2.80 Angstroms Resolution Length = 446 Back     alignment and structure

Iteration: 1

Score = 345 bits (884), Expect = 5e-95, Method: Compositional matrix adjust. Identities = 177/401 (44%), Positives = 247/401 (61%), Gaps = 18/401 (4%) Query: 53 YKTKYHTQILDHFNYNPQSYQTFQQRYLINDTHWGGSKNNAPIFVYTGNEGDIEWFAQNT 112 Y Y Q +DHF +N + +TF QRYL+ D +W KN I YTGNEGDI WF NT Sbjct: 3 YSVLYFQQKVDHFGFN--TVKTFNQRYLVADKYW--KKNGGSILFYTGNEGDIIWFCNNT 58 Query: 113 GFMYDVAPKFKALLVFIEHRYYGKSIPYGGNKEIAYKNASTTGYLSSTQALADYASLIID 172 GFM+DVA + KA+LVF EHRYYG+S+P+G N ++K++ +L+S QALAD+A LI Sbjct: 59 GFMWDVAEELKAMLVFAEHRYYGESLPFGDN---SFKDSRHLNFLTSEQALADFAELIKH 115 Query: 173 LKKNLT-ATDSPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAPILNFDNIVSPYSFSN 231 LK+ + A + PV+ GGSYGGMLAAWFR+KYPH+ +GALA+SAPI F+++V F Sbjct: 116 LKRTIPGAENQPVIAIGGSYGGMLAAWFRMKYPHMVVGALAASAPIWQFEDLVPCGVFMK 175 Query: 232 IITQDFRSVSENCYKVIKGSWKQIEETAKKPGGLEKLQKAFRICK---SEKNLAIESWLS 288 I+T DFR +C + I SW I + GL+ L A +C S+ ++ W+S Sbjct: 176 IVTTDFRKSGPHCSESIHRSWDAINRLSNTGSGLQWLTGALHLCSPLTSQDIQHLKDWIS 235 Query: 289 TAFVYTAMTDYPTPSNFLNPLPAFPVKEMCKAIDDPKTGNDVFAK-LYGAASVYYNYSGT 347 +V AM DYP SNFL PLPA+P+K +C+ + +P + + + ++ A +VYYNYSG Sbjct: 236 ETWVNLAMVDYPYASNFLQPLPAWPIKVVCQYLKNPNVSDSLLLQNIFQALNVYYNYSGQ 295 Query: 348 AKCFDLNGDSDPH-GLSEWGWQACTEMIMLTGGDNKDSIFEESEEDYDARARYCKEAYGV 406 KC +++ + G W +QACTE++M + D +FE + + C + +GV Sbjct: 296 VKCLNISETATSSLGTLGWSYQACTEVVMPFCTNGVDDMFEPHSWNLKELSDDCFQQWGV 355 Query: 407 DPRPNWITTEFGGHKIGLVLKRFASNIIFFNGLRDPWSGGG 447 PRP+WITT +GG I +NI+F NG DPWSGGG Sbjct: 356 RPRPSWITTMYGGKNIS-----SHTNIVFSNGELDPWSGGG 391
>pdb|3JYH|A Chain A, Human Dipeptidyl Peptidase Dpp7 Length = 469 Back     alignment and structure
>pdb|4EBB|A Chain A, Structure Of Dpp2 Length = 472 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query475
3n2z_B446 Lysosomal Pro-X carboxypeptidase; alpha/beta hydro 1e-114
3jyh_A469 Dipeptidyl-peptidase 2; structural genomics, struc 1e-111
3r0v_A262 Alpha/beta hydrolase fold protein; structural geno 7e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-04
3pe6_A303 Monoglyceride lipase; alpha-beta hydrolase fold, 2 4e-04
3hju_A342 Monoglyceride lipase; alpha/beta hydrolase, hydrol 5e-04
>3n2z_B Lysosomal Pro-X carboxypeptidase; alpha/beta hydrolase, PRCP, serine carboxypeptidase, hydrola; HET: NAG; 2.79A {Homo sapiens} Length = 446 Back     alignment and structure
 Score =  342 bits (877), Expect = e-114
 Identities = 174/402 (43%), Positives = 242/402 (60%), Gaps = 18/402 (4%)

Query: 53  YKTKYHTQILDHFNYNPQSYQTFQQRYLINDTHWGGSKNNAPIFVYTGNEGDIEWFAQNT 112
           Y   Y  Q +DHF     + +TF QRYL+ D +W    N   I  YTGNEGDI WF  NT
Sbjct: 3   YSVLYFQQKVDHFG--FNTVKTFNQRYLVADKYWKK--NGGSILFYTGNEGDIIWFCNNT 58

Query: 113 GFMYDVAPKFKALLVFIEHRYYGKSIPYGGNKEIAYKNASTTGYLSSTQALADYASLIID 172
           GFM+DVA + KA+LVF EHRYYG+S+P+G N   ++K++    +L+S QALAD+A LI  
Sbjct: 59  GFMWDVAEELKAMLVFAEHRYYGESLPFGDN---SFKDSRHLNFLTSEQALADFAELIKH 115

Query: 173 LKKNL-TATDSPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAPILNFDNIVSPYSFSN 231
           LK+ +  A + PV+  GGSYGGMLAAWFR+KYPH+ +GALA+SAPI  F+++V    F  
Sbjct: 116 LKRTIPGAENQPVIAIGGSYGGMLAAWFRMKYPHMVVGALAASAPIWQFEDLVPCGVFMK 175

Query: 232 IITQDFRSVSENCYKVIKGSWKQIEETAKKPGGLEKLQKAFRICKSEKN---LAIESWLS 288
           I+T DFR    +C + I  SW  I   +    GL+ L  A  +C    +     ++ W+S
Sbjct: 176 IVTTDFRKSGPHCSESIHRSWDAINRLSNTGSGLQWLTGALHLCSPLTSQDIQHLKDWIS 235

Query: 289 TAFVYTAMTDYPTPSNFLNPLPAFPVKEMCKAIDDPKTGN-DVFAKLYGAASVYYNYSGT 347
             +V  AM DYP  SNFL PLPA+P+K +C+ + +P   +  +   ++ A +VYYNYSG 
Sbjct: 236 ETWVNLAMVDYPYASNFLQPLPAWPIKVVCQYLKNPNVSDSLLLQNIFQALNVYYNYSGQ 295

Query: 348 AKCFDLNGDSDPH-GLSEWGWQACTEMIMLTGGDNKDSIFEESEEDYDARARYCKEAYGV 406
            KC +++  +    G   W +QACTE++M    +  D +FE    +    +  C + +GV
Sbjct: 296 VKCLNISETATSSLGTLGWSYQACTEVVMPFCTNGVDDMFEPHSWNLKELSDDCFQQWGV 355

Query: 407 DPRPNWITTEFGGHKIGLVLKRFASNIIFFNGLRDPWSGGGY 448
            PRP+WITT +GG  I        +NI+F NG  DPWSGGG 
Sbjct: 356 RPRPSWITTMYGGKNI-----SSHTNIVFSNGELDPWSGGGV 392


>3jyh_A Dipeptidyl-peptidase 2; structural genomics, structural genomics consortium, SGC, aminopeptidase, cleavage on PAIR of basic residues; HET: NAG BMA; 2.19A {Homo sapiens} PDB: 3n0t_A* Length = 469 Back     alignment and structure
>3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus} Length = 262 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3pe6_A Monoglyceride lipase; alpha-beta hydrolase fold, 2-arachidonyl-glycerol, M associated, hydrolase, hydrolase-hydrolase inhibitor comple; HET: ZYH; 1.35A {Homo sapiens} PDB: 3jw8_A 3jwe_A* Length = 303 Back     alignment and structure
>3hju_A Monoglyceride lipase; alpha/beta hydrolase, hydrolase, serine esterase; 2.20A {Homo sapiens} Length = 342 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query475
4ebb_A472 Dipeptidyl peptidase 2; hydrolase; HET: MSE NAG; 2 100.0
3n2z_B446 Lysosomal Pro-X carboxypeptidase; alpha/beta hydro 100.0
3pe6_A303 Monoglyceride lipase; alpha-beta hydrolase fold, 2 98.57
3nwo_A330 PIP, proline iminopeptidase; structural genomics, 98.52
4dnp_A269 DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petu 98.49
3pfb_A270 Cinnamoyl esterase; alpha/beta hydrolase fold, hyd 98.47
3hju_A342 Monoglyceride lipase; alpha/beta hydrolase, hydrol 98.42
3qvm_A282 OLEI00960; structural genomics, PSI-biology, midwe 98.41
3qit_A286 CURM TE, polyketide synthase; thioesterase, alpha/ 98.41
2o2g_A223 Dienelactone hydrolase; YP_324580.1, structural ge 98.4
1mtz_A293 Proline iminopeptidase; alpha-beta hydrolase, CAP 98.4
3dqz_A258 Alpha-hydroxynitrIle lyase-like protein; A/B-hydrl 98.39
3r40_A306 Fluoroacetate dehalogenase; FACD, defluorinase, al 98.38
4f0j_A315 Probable hydrolytic enzyme; alpha/beta hydrolase f 98.37
3dkr_A251 Esterase D; alpha beta hydrolase, mechanism, catal 98.37
1azw_A313 Proline iminopeptidase; aminopeptidase, serine pro 98.36
3om8_A266 Probable hydrolase; structural genomics, PSI-2, pr 98.35
3bdi_A207 Uncharacterized protein TA0194; NP_393672.1, predi 98.34
3fsg_A272 Alpha/beta superfamily hydrolase; PF00561, MCSG, P 98.34
3u1t_A309 DMMA haloalkane dehalogenase; alpha/beta-hydrolase 98.32
3oos_A278 Alpha/beta hydrolase family protein; APC67239.0, p 98.32
3rm3_A270 MGLP, thermostable monoacylglycerol lipase; alpha/ 98.32
3g9x_A299 Haloalkane dehalogenase; alpha/beta hydrolase, hel 98.32
2qvb_A297 Haloalkane dehalogenase 3; RV2579, alpha-beta hydr 98.31
1wm1_A317 Proline iminopeptidase; complex with inhibitor, hy 98.31
2h1i_A226 Carboxylesterase; structural genomics, PSI-2, prot 98.3
3e0x_A245 Lipase-esterase related protein; APC60309, clostri 98.3
2xmz_A269 Hydrolase, alpha/beta hydrolase fold family; menaq 98.3
3ibt_A264 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, 98.3
1mj5_A302 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; 98.29
3kda_A301 CFTR inhibitory factor (CIF); alpha/beta hydrolase 98.29
3llc_A270 Putative hydrolase; structural genomics, joint cen 98.28
2yys_A286 Proline iminopeptidase-related protein; TTHA1809, 98.27
1k8q_A377 Triacylglycerol lipase, gastric; APHA beta hydrola 98.27
2xua_A266 PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, cate 98.26
3bwx_A285 Alpha/beta hydrolase; YP_496220.1, joint center fo 98.26
1q0r_A298 RDMC, aclacinomycin methylesterase; anthracycline, 98.24
3sty_A267 Methylketone synthase 1; alpha/beta hydrolase, dec 98.24
2rau_A354 Putative esterase; NP_343859.1, putative lipase, s 98.24
1wom_A271 RSBQ, sigma factor SIGB regulation protein RSBQ; a 98.24
3l80_A292 Putative uncharacterized protein SMU.1393C; alpha/ 98.22
3r0v_A262 Alpha/beta hydrolase fold protein; structural geno 98.22
1ehy_A294 Protein (soluble epoxide hydrolase); alpha/beta hy 98.22
1ufo_A238 Hypothetical protein TT1662; alpha-beta fold, hydr 98.21
2r11_A306 Carboxylesterase NP; 2632844, putative hydrolase, 98.21
1a88_A275 Chloroperoxidase L; haloperoxidase, oxidoreductase 98.2
2psd_A318 Renilla-luciferin 2-monooxygenase; alpha/beta-hydr 98.2
1a8s_A273 Chloroperoxidase F; haloperoxidase, oxidoreductase 98.2
2wfl_A264 Polyneuridine-aldehyde esterase; alkaloid metaboli 98.19
2qmq_A286 Protein NDRG2, protein NDR2; alpha/beta-hydrolases 98.18
2cjp_A328 Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu 98.18
3v48_A268 Aminohydrolase, putative aminoacrylate hydrolase R 98.17
3bf7_A255 Esterase YBFF; thioesterase, helical CAP, hydrolas 98.16
3i28_A555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 98.16
1hkh_A279 Gamma lactamase; hydrolase, alpha/beta hydrolase, 98.16
1brt_A277 Bromoperoxidase A2; haloperoxidase, oxidoreductase 98.15
1zoi_A276 Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo 98.15
3hss_A293 Putative bromoperoxidase; alpha beta hydrolase, ox 98.15
3fob_A281 Bromoperoxidase; structural genomics, IDP00046, ba 98.15
2ocg_A254 Valacyclovir hydrolase; alpha beta hydrolase fold; 98.15
1c4x_A285 BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-di 98.15
3ia2_A271 Arylesterase; alpha-beta hydrolase fold, transitio 98.14
2xt0_A297 Haloalkane dehalogenase; hydrolase, alpha-beta hyd 98.14
2puj_A286 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; 98.14
2i3d_A249 AGR_C_3351P, hypothetical protein ATU1826; structu 98.13
3p2m_A330 Possible hydrolase; alpha/beta hydrolase superfami 98.12
1a8q_A274 Bromoperoxidase A1; haloperoxidase, oxidoreductase 98.12
2y6u_A398 Peroxisomal membrane protein LPX1; hydrolase, puta 98.12
1iup_A282 META-cleavage product hydrolase; aromatic compound 98.11
4g9e_A279 AHL-lactonase, alpha/beta hydrolase fold protein; 98.11
3c6x_A257 Hydroxynitrilase; atomic resolution, hydroxynitril 98.1
3e4d_A278 Esterase D; S-formylglutathione hydrolase, hydrola 98.1
1j1i_A296 META cleavage compound hydrolase; carbazole degrad 98.09
2pl5_A366 Homoserine O-acetyltransferase; alpha/beta hydrola 98.08
2wue_A291 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas 98.08
3afi_E316 Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 98.07
3c5v_A316 PME-1, protein phosphatase methylesterase 1; demet 98.06
4fbl_A281 LIPS lipolytic enzyme; thermostable, structural ge 98.05
2hdw_A367 Hypothetical protein PA2218; alpha/beta hydrolase 98.05
2uz0_A263 Esterase, tributyrin esterase; alpha/beta hydrolas 98.04
3kxp_A314 Alpha-(N-acetylaminomethylene)succinic acid hydrol 98.04
3fla_A267 RIFR; alpha-beta hydrolase thioesterase, hydrolase 98.04
1xkl_A273 SABP2, salicylic acid-binding protein 2; alpha-bet 98.02
1u2e_A289 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase 98.02
2wtm_A251 EST1E; hydrolase; 1.60A {Clostridium proteoclastic 98.02
2r8b_A251 AGR_C_4453P, uncharacterized protein ATU2452; APC6 97.99
2qjw_A176 Uncharacterized protein XCC1541; putative hydrolas 97.98
2e3j_A356 Epoxide hydrolase EPHB; epoxide hydrolase B, struc 97.98
1fj2_A232 Protein (acyl protein thioesterase 1); alpha/beta 97.96
1zi8_A236 Carboxymethylenebutenolidase; alpha and beta prote 97.94
3qyj_A291 ALR0039 protein; alpha/beta fold, hydrolase; 1.78A 97.93
3qmv_A280 Thioesterase, REDJ; alpha/beta hydrolase fold, hyd 97.93
3b5e_A223 MLL8374 protein; NP_108484.1, carboxylesterase, st 97.92
1imj_A210 CIB, CCG1-interacting factor B; alpha/beta hydrola 97.92
4i19_A388 Epoxide hydrolase; structural genomics, PSI-biolog 97.91
3vdx_A456 Designed 16NM tetrahedral protein CAGE containing 97.9
1r3d_A264 Conserved hypothetical protein VC1974; structural 97.9
3ksr_A290 Putative serine hydrolase; catalytic triad, struct 97.89
3f67_A241 Putative dienelactone hydrolase; alpha-beta-alpha 97.88
1l7a_A318 Cephalosporin C deacetylase; structural genomics, 97.87
2fuk_A220 XC6422 protein; A/B hydrolase, structural genomics 97.87
3cn9_A226 Carboxylesterase; alpha/beta hydrolase fold super- 97.85
1auo_A218 Carboxylesterase; hydrolase; 1.80A {Pseudomonas fl 97.85
3og9_A209 Protein YAHD A copper inducible hydrolase; alpha/b 97.84
3i6y_A280 Esterase APC40077; lipase, structural genomics, PS 97.84
3fcy_A346 Xylan esterase 1; alpha/beta hydrolase, carbohydra 97.82
1b6g_A310 Haloalkane dehalogenase; hydrolase, alpha/beta-hyd 97.81
1m33_A258 BIOH protein; alpha-betta-alpha sandwich, structur 97.81
2vat_A444 Acetyl-COA--deacetylcephalosporin C acetyltransfer 97.8
3b12_A304 Fluoroacetate dehalogenase; dehalogease, hydrolase 96.99
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 97.79
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 97.78
3ls2_A280 S-formylglutathione hydrolase; psychrophilic organ 97.78
1pja_A302 Palmitoyl-protein thioesterase 2 precursor; hydrol 97.77
1vlq_A337 Acetyl xylan esterase; TM0077, structural genomics 97.76
2jbw_A386 Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine 97.76
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 97.75
2wj6_A276 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxid 97.74
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 97.71
3hxk_A276 Sugar hydrolase; alpha-beta protein., structural g 97.69
3trd_A208 Alpha/beta hydrolase; cellular processes; 1.50A {C 97.69
2b61_A377 Homoserine O-acetyltransferase; acyl-enzyme, aspar 97.68
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 97.68
4b6g_A283 Putative esterase; hydrolase, formaldehyde detoxif 97.67
3g02_A408 Epoxide hydrolase; alpha/beta hydrolase fold, enan 97.67
2wir_A313 Pesta, alpha/beta hydrolase fold-3 domain protein; 97.66
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 97.64
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 97.64
2xe4_A751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 97.61
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 97.61
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 97.6
3fcx_A282 FGH, esterase D, S-formylglutathione hydrolase; re 97.6
2pbl_A262 Putative esterase/lipase/thioesterase; alpha/beta- 97.59
3k6k_A322 Esterase/lipase; alpha/beta hydrolase fold; 2.20A 97.59
3h2g_A397 Esterase; xanthomonas oryzae PV. oryzae, cell WALL 97.59
1jji_A311 Carboxylesterase; alpha-beta hydrolase fold, hydro 97.59
2c7b_A311 Carboxylesterase, ESTE1; carboxyesterase, thermoph 97.59
3ain_A323 303AA long hypothetical esterase; carboxylesterase 97.59
3i1i_A377 Homoserine O-acetyltransferase; structural genomic 97.58
2dst_A131 Hypothetical protein TTHA1544; conserved hypotheti 97.56
3ds8_A254 LIN2722 protein; unkonwn function, structural geno 97.54
3fnb_A405 Acylaminoacyl peptidase SMU_737; alpha-beta-alpha 97.54
3d0k_A304 Putative poly(3-hydroxybutyrate) depolymerase LPQ; 97.51
4a5s_A740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 97.51
2hm7_A310 Carboxylesterase; alpha/beta hydrolase fold, hydro 97.5
1tqh_A247 Carboxylesterase precursor; tetrahedral intermedia 97.49
4hvt_A711 Ritya.17583.B, post-proline cleaving enzyme; ssgci 97.49
3k2i_A422 Acyl-coenzyme A thioesterase 4; alpha/beta hydrola 97.48
3h04_A275 Uncharacterized protein; protein with unknown func 97.47
3fak_A322 Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Unc 97.46
1jkm_A361 Brefeldin A esterase; serine hydrolase, degradatio 97.46
3bxp_A277 Putative lipase/esterase; putative carboxylesteras 97.43
2o7r_A338 CXE carboxylesterase; alpha/beta hydrolase; 1.40A 97.43
2zsh_A351 Probable gibberellin receptor GID1L1; plant hormon 97.42
1jjf_A268 Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-x 97.4
1lzl_A323 Heroin esterase; alpha/beta hydrolase; 1.30A {Rhod 97.39
1ys1_X320 Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor h 97.38
3d7r_A326 Esterase; alpha/beta fold, hydrolase; 2.01A {Staph 97.37
1bu8_A452 Protein (pancreatic lipase related protein 2); hyd 97.36
1qlw_A328 Esterase; anisotropic refinement, atomic resolutio 97.35
3hlk_A446 Acyl-coenzyme A thioesterase 2, mitochondrial; alp 97.35
3ebl_A365 Gibberellin receptor GID1; alpha/beta hydrolase, l 97.35
3ga7_A326 Acetyl esterase; phosphoserine, IDP00896, hydrolas 97.34
3d59_A383 Platelet-activating factor acetylhydrolase; secret 97.32
1isp_A181 Lipase; alpha/beta hydrolase fold, hydrolase; 1.30 97.32
3u0v_A239 Lysophospholipase-like protein 1; alpha, beta hydr 97.32
4e15_A303 Kynurenine formamidase; alpha/beta hydrolase fold, 97.3
1ex9_A285 Lactonizing lipase; alpha-beta hydrolase fold, pho 97.29
1vkh_A273 Putative serine hydrolase; structural genomics, jo 97.28
3doh_A380 Esterase; alpha-beta hydrolase, beta sheet; 2.60A 97.28
1uxo_A192 YDEN protein; hydrolase, A/B hydrolase, esterase, 97.28
1gpl_A432 RP2 lipase; serine esterase, hydrolase, lipid degr 97.27
1sfr_A304 Antigen 85-A; alpha/beta hydrolase, structural gen 97.25
1r88_A280 MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBP 97.24
2q0x_A335 Protein DUF1749, uncharacterized protein; alpha/be 97.24
2x5x_A342 PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE 97.21
1tht_A305 Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1. 97.19
3g8y_A391 SUSD/RAGB-associated esterase-like protein; struct 97.14
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 97.12
3qh4_A317 Esterase LIPW; structural genomics, ssgcid, seattl 97.12
4ezi_A377 Uncharacterized protein; alpha-beta hydrolases fol 97.11
3mve_A415 FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/ 97.11
1w52_X452 Pancreatic lipase related protein 2; detergent, cl 97.09
3bjr_A283 Putative carboxylesterase; structural genomics, jo 97.07
3ils_A265 PKS, aflatoxin biosynthesis polyketide synthase; A 97.02
2qm0_A275 BES; alpha-beta structure, structural genomics, PS 97.02
1jfr_A262 Lipase; serine hydrolase; 1.90A {Streptomyces exfo 97.02
1dqz_A280 85C, protein (antigen 85-C); fibronectin, structur 97.01
3vis_A306 Esterase; alpha/beta-hydrolase fold, polyethylene 96.98
2qru_A274 Uncharacterized protein; alpha/beta-hydrolase, str 96.97
3nuz_A398 Putative acetyl xylan esterase; structural genomic 96.87
1tca_A317 Lipase; hydrolase(carboxylic esterase); HET: NAG; 96.86
3i2k_A 587 Cocaine esterase; alpha/beta hydrolase, hydrolase; 96.78
2k2q_B242 Surfactin synthetase thioesterase subunit; A/B-hyd 96.75
3lcr_A319 Tautomycetin biosynthetic PKS; alpha-beta hydrolas 96.7
2qs9_A194 Retinoblastoma-binding protein 9; B5T overexpresse 96.69
4fle_A202 Esterase; structural genomics, PSI-biology, northe 96.68
1gkl_A297 Endo-1,4-beta-xylanase Y; hydrolase, esterase fami 96.64
2zyr_A484 Lipase, putative; fatty acid, hydrolase; HET: 1PE; 96.63
3lp5_A250 Putative cell surface hydrolase; structural genom 96.59
4ao6_A259 Esterase; hydrolase, thermo label; 1.60A {Unidenti 96.46
1qe3_A489 PNB esterase, para-nitrobenzyl esterase; alpha-bet 96.41
2b9v_A 652 Alpha-amino acid ester hydrolase; catalytic triad, 96.36
3iii_A 560 COCE/NOND family hydrolase; structural genomics, c 96.34
4h0c_A210 Phospholipase/carboxylesterase; PSI-biology, midwe 96.31
1kez_A300 Erythronolide synthase; polyketide synthase, modul 96.31
1mpx_A 615 Alpha-amino acid ester hydrolase; alpha/beta hydro 96.3
2gzs_A278 IROE protein; enterobactin, salmochelin, DFP, hydr 96.24
3bdv_A191 Uncharacterized protein DUF1234; DUF1234 family pr 96.2
3fle_A249 SE_1780 protein; structural genomics, APC61035.1, 96.17
2ogt_A498 Thermostable carboxylesterase EST50; alpha/beta hy 96.1
3icv_A316 Lipase B, CALB; circular permutation, cleavage on 96.06
1p0i_A529 Cholinesterase; serine hydrolase, butyrate, hydrol 95.97
2h7c_A542 Liver carboxylesterase 1; enzyme, cholesteryl este 95.96
2ha2_A543 ACHE, acetylcholinesterase; hydrolase fold, serine 95.95
1hpl_A449 Lipase; hydrolase(carboxylic esterase); 2.30A {Equ 95.8
3tej_A329 Enterobactin synthase component F; nonribosomal pe 95.78
1lns_A 763 X-prolyl dipeptidyl aminopetidase; alpha beta hydr 95.61
1ei9_A279 Palmitoyl protein thioesterase 1; alpha/beta hydro 95.56
1dx4_A585 ACHE, acetylcholinesterase; hydrolase, serine este 95.55
4fhz_A285 Phospholipase/carboxylesterase; alpha/beta hydrola 95.53
1rp1_A450 Pancreatic lipase related protein 1; hydrolase, li 95.53
3tjm_A283 Fatty acid synthase; thioesterase domain, fatty ac 95.4
2fj0_A551 JuvenIle hormone esterase; manduca sexta, alpha-be 94.87
1ea5_A537 ACHE, acetylcholinesterase; hydrolase, serine hydr 94.85
1thg_A544 Lipase; hydrolase(carboxylic esterase); HET: NAG N 94.52
1llf_A534 Lipase 3; candida cylindracea cholesterol esterase 94.38
2hfk_A319 Pikromycin, type I polyketide synthase pikaiv; alp 94.06
1ivy_A452 Human protective protein; carboxypeptidase, serine 93.93
1ycd_A243 Hypothetical 27.3 kDa protein in AAP1-SMF2 interge 93.77
3gff_A331 IROE-like serine hydrolase; NP_718593.1, structura 93.59
2bce_A579 Cholesterol esterase; hydrolase, serine esterase, 93.56
2fx5_A258 Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pse 93.45
1jmk_C230 SRFTE, surfactin synthetase; thioesterase, non-rib 93.27
3bix_A574 Neuroligin-1, neuroligin I; esterase domain, alpha 93.21
2cb9_A244 Fengycin synthetase; thioesterase, non-ribosomal p 93.11
1ukc_A522 ESTA, esterase; fungi, A/B hydrolase fold, acetylc 93.02
3c8d_A403 Enterochelin esterase; alpha-beta-alpha sandwich, 92.73
2hih_A431 Lipase 46 kDa form; A1 phospholipase, phospholipid 92.25
1tib_A269 Lipase; hydrolase(carboxylic esterase); 1.84A {The 91.93
4f21_A246 Carboxylesterase/phospholipase family protein; str 91.75
3guu_A462 Lipase A; protein structure, hydrolase; HET: 1PE; 91.49
4fol_A299 FGH, S-formylglutathione hydrolase; D-type esteras 90.66
1whs_A255 Serine carboxypeptidase II; HET: NAG FUC; 2.00A {T 90.59
1tgl_A269 Triacyl-glycerol acylhydrolase; carboxylic esteras 89.11
2px6_A316 Thioesterase domain; thioesaterse domain, orlistat 88.79
1tia_A279 Lipase; hydrolase(carboxylic esterase); 2.10A {Pen 88.0
1lgy_A269 Lipase, triacylglycerol lipase; hydrolase (carboxy 86.92
2d81_A318 PHB depolymerase; alpha/beta hydrolase fold, circu 86.67
3g7n_A258 Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A 84.98
2dsn_A387 Thermostable lipase; T1 lipase, hydrolase; 1.50A { 83.68
3uue_A279 LIP1, secretory lipase (family 3); LID-domain, hyd 83.67
1ac5_A483 KEX1(delta)P; carboxypeptidase, hydrolase, glycopr 82.91
>4ebb_A Dipeptidyl peptidase 2; hydrolase; HET: MSE NAG; 2.00A {Homo sapiens} PDB: 3jyh_A* 3n0t_A* Back     alignment and structure
Probab=100.00  E-value=2.7e-103  Score=835.85  Aligned_cols=398  Identities=40%  Similarity=0.731  Sum_probs=348.7

Q ss_pred             CcceeeeEEecCCCCCCCCCCCCeeeeEEEEeccccCCCCCCCcEEEEeCCCCCccccccccchhhchhhhcCceEEEEe
Q 011907           51 GLYKTKYHTQILDHFNYNPQSYQTFQQRYLINDTHWGGSKNNAPIFVYTGNEGDIEWFAQNTGFMYDVAPKFKALLVFIE  130 (475)
Q Consensus        51 ~~~~~~~f~Q~lDHF~~~~~~~~TF~QRY~vn~~~~~~~~~~gPIfly~GgEg~~~~~~~~~g~~~~lA~~~gA~vv~lE  130 (475)
                      ..++++||+|+|||||+++.+++||+||||+|++||++  ++||||||+||||+++.+..++|++++||+++||++|+||
T Consensus         3 P~~~~~~f~Q~lDHFn~~~~~~~TF~QRY~~n~~~~~~--~~gPIfl~~gGEg~~~~~~~~~g~~~~lA~~~~a~~v~lE   80 (472)
T 4ebb_A            3 PGFQERFFQQRLDHFNFERFGNKTFPQRFLVSDRFWVR--GEGPIFFYTGNEGDVWAFANNSAFVAELAAERGALLVFAE   80 (472)
T ss_dssp             CCCEEEEEEEESCSSCSSTTTTCEEEEEEEEECTTCCT--TTCCEEEEECCSSCHHHHHHHCHHHHHHHHHHTCEEEEEC
T ss_pred             CCCceeeEEeecCCCCCCCCCCCEEEEEEEEecceeCC--CCCcEEEEECCCccccccccCccHHHHHHHHhCCeEEEEe
Confidence            45899999999999998765568999999999999974  3699999999999999988899999999999999999999


Q ss_pred             eeeeecCccCCCCccccccCCC--CCCCCChhhHHHHHHHHHHHHhhhCCCCCCCEEEEccChhhHHHHHHHHhCCCeeE
Q 011907          131 HRYYGKSIPYGGNKEIAYKNAS--TTGYLSSTQALADYASLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVAI  208 (475)
Q Consensus       131 HRyYG~S~P~~~~~~~~~~st~--nL~yLts~QALaD~a~Fi~~~k~~~~~~~~pwI~fGGSY~G~LAAW~R~kYP~lv~  208 (475)
                      |||||+|+||+++      +++  ||||||+||||||+|+||+++|++++++++|||+||||||||||||||+||||+|+
T Consensus        81 HRyYG~S~P~~~~------st~~~nL~yLt~eQALaD~a~fi~~~k~~~~~~~~pwI~~GGSY~G~LaAW~R~kYP~lv~  154 (472)
T 4ebb_A           81 HRYYGKSLPFGAQ------STQRGHTELLTVEQALADFAELLRALRRDLGAQDAPAIAFGGSYGGMLSAYLRMKYPHLVA  154 (472)
T ss_dssp             CTTSTTCCTTGGG------GGSTTSCTTCSHHHHHHHHHHHHHHHHHHTTCTTCCEEEEEETHHHHHHHHHHHHCTTTCS
T ss_pred             cccccCCcCCCCC------CccccccccCCHHHHHHHHHHHHHHHHhhcCCCCCCEEEEccCccchhhHHHHhhCCCeEE
Confidence            9999999999997      655  99999999999999999999999999999999999999999999999999999999


Q ss_pred             EEEecccccccccCCcCchhhhHHHHHhhhcCChhhHHHHHHHHHHHHHHhcCCCcHHHHHHHhhhcCCC-ChHHH---H
Q 011907          209 GALASSAPILNFDNIVSPYSFSNIITQDFRSVSENCYKVIKGSWKQIEETAKKPGGLEKLQKAFRICKSE-KNLAI---E  284 (475)
Q Consensus       209 gavASSAPv~a~~~~~df~~y~~~V~~~~~~~~~~C~~~i~~a~~~i~~~~~~~~g~~~Lk~~F~lc~~l-~~~d~---~  284 (475)
                      |||||||||+++.++.||++|+++|++++...+++|+++|++++++|++++.+ ++.+++++.|++|.++ +..|+   .
T Consensus       155 ga~ASSApv~a~~df~~y~~~~~~v~~~~~~~~~~C~~~i~~a~~~i~~~~~~-~~~~~~~~~f~~c~~~~~~~d~~~~~  233 (472)
T 4ebb_A          155 GALAASAPVLAVAGLGDSNQFFRDVTADFEGQSPKCTQGVREAFRQIKDLFLQ-GAYDTVRWEFGTCQPLSDEKDLTQLF  233 (472)
T ss_dssp             EEEEETCCTTGGGTCSCTTHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHHHH-TCHHHHHHHHTBSSCCCSHHHHHHHH
T ss_pred             EEEecccceEEeccccccHHHHHHHHHHHhcCCHHHHHHHHHHHHHHHHHHhc-chHHHHHHHhcCCCCCCChHHHHHHH
Confidence            99999999999988889999999999998888999999999999999999875 5678899999999988 55554   4


Q ss_pred             HHHHHhhhhhhhccCCCCCCCCCCCCCCcHHHHhhhccCCCCCchHHHHHHHHhhhhhcccCCcccccCCC----CCCC-
Q 011907          285 SWLSTAFVYTAMTDYPTPSNFLNPLPAFPVKEMCKAIDDPKTGNDVFAKLYGAASVYYNYSGTAKCFDLNG----DSDP-  359 (475)
Q Consensus       285 ~~l~~~~~~~~~~~y~~~~~~~~~~p~~~v~~~C~~i~~~~~~~~~~~~l~~~~~~~~n~~~~~~C~d~~~----~~~~-  359 (475)
                      .++..++..++|++|+++.+++.++|+.+++.+|+.|.+..   +.+..+...++.+++.++...|+|...    ..++ 
T Consensus       234 ~~~~~~~~~~~~~~y~~~~~~~~~~~~~~~~~~c~~~~~~~---~~~~~~~~~~~~~~~~~~~~~c~~~~~~~~~~~~~~  310 (472)
T 4ebb_A          234 MFARNAFTVLAMMDYPYPTDFLGPLPANPVKVGCDRLLSEA---QRITGLRALAGLVYNASGSEHCYDIYRLYHSCADPT  310 (472)
T ss_dssp             HHHHHHHHHHHHTCCSSCEESSSEECSSHHHHHHHHHHTCS---SHHHHHHHHHHHHHCTTSCCSSBCHHHHCCCCSSTT
T ss_pred             HHHHHHHHHHhhhccccchhhcccCccchHHHHHHHhcccc---hHHHHHHHHHHHHhhccCCcchhhhhhhhhhccCCc
Confidence            56667788889999999999999999999999999987542   446677777788889988888987521    1111 


Q ss_pred             -----CCCCcceeeeecccccccCCCCCCCCCcCCCCChHHHHHHHHhhhCCCCChhHHH-HhhCCCCccccccCCCCeE
Q 011907          360 -----HGLSEWGWQACTEMIMLTGGDNKDSIFEESEEDYDARARYCKEAYGVDPRPNWIT-TEFGGHKIGLVLKRFASNI  433 (475)
Q Consensus       360 -----~~~r~W~wQtCtE~g~~~t~~~~~~~f~~~~~~~~~~~~~C~~~FGi~~~~~~~n-~~yGG~~~~~~~~~~~snI  433 (475)
                           .+.|+|.||+||||||+|++++..++|++++++++++.++|+++||+.+++++.+ ++|||.+++      ++||
T Consensus       311 ~~~~~~~~r~W~yQ~CtE~g~~~~~~~~~~~f~~~~~~~~~~~~~C~~~fg~~~~~~~~~~~~~Gg~~~~------~sni  384 (472)
T 4ebb_A          311 GCGTGPDARAWDYQACTEINLTFASNNVTDMFPDLPFTDELRQRYCLDTWGVWPRPDWLLTSFWGGDLRA------ASNI  384 (472)
T ss_dssp             CCCSSHHHHHHHHHHTTTCCCCCCBCSSSSSSCCBCCCHHHHHHHHHHHHSCCCCTTHHHHHHCTTCCTT------CCSE
T ss_pred             ccCCCCCcccccccccccccccccCCCCCCcCCCCCCcHHHHHHHHHHHhCCCCChhHHHHHhcCCcCCC------CCeE
Confidence                 1249999999999999999998889998888999999999999999999999865 456666655      7999


Q ss_pred             EEECCCCCCCCCCCcccCCccccccccccceeeeeeeecccC
Q 011907          434 IFFNGLRDPWSGGGYDLYPFAIQTSLSVEKIFITFCICICFH  475 (475)
Q Consensus       434 iFsNG~~DPW~~~gv~~~p~~~~~~~~~~~~~~~~~~~~~~~  475 (475)
                      ||+||++||||.+||++.       .+.+.  +.++|-||.|
T Consensus       385 iF~nG~~DPW~~~gv~~~-------~s~~~--~~~~I~g~~H  417 (472)
T 4ebb_A          385 IFSNGNLDPWAGGGIRRN-------LSASV--IAVTIQGGAH  417 (472)
T ss_dssp             EEEEETTCTTGGGSCCSC-------CSSSE--EEEEETTCCT
T ss_pred             EEECCCcCCCcCccCCCC-------CCCCc--eEEEeCcCee
Confidence            999999999999999863       22222  3456778877



>3n2z_B Lysosomal Pro-X carboxypeptidase; alpha/beta hydrolase, PRCP, serine carboxypeptidase, hydrola; HET: NAG; 2.79A {Homo sapiens} Back     alignment and structure
>3pe6_A Monoglyceride lipase; alpha-beta hydrolase fold, 2-arachidonyl-glycerol, M associated, hydrolase, hydrolase-hydrolase inhibitor comple; HET: ZYH; 1.35A {Homo sapiens} PDB: 3jw8_A 3jwe_A* Back     alignment and structure
>3nwo_A PIP, proline iminopeptidase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, mycobac smegmatis; 1.90A {Mycobacterium smegmatis} Back     alignment and structure
>4dnp_A DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petunia hybrida} PDB: 4dnq_A Back     alignment and structure
>3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A* Back     alignment and structure
>3hju_A Monoglyceride lipase; alpha/beta hydrolase, hydrolase, serine esterase; 2.20A {Homo sapiens} Back     alignment and structure
>3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica} Back     alignment and structure
>3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L} Back     alignment and structure
>2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis} Back     alignment and structure
>1mtz_A Proline iminopeptidase; alpha-beta hydrolase, CAP domain, caged active site, prolyl peptidase; 1.80A {Thermoplasma acidophilum} SCOP: c.69.1.7 PDB: 1mt3_A 1mu0_A* 1xrr_A 1xrq_A 1xro_A 1xrn_A 1xrm_A 1xrp_A 1xrl_A* 1xqw_A* 1xqx_A* 1xqy_A 1xqv_A Back     alignment and structure
>3dqz_A Alpha-hydroxynitrIle lyase-like protein; A/B-hydrloase fold, cyanogenesis; 2.50A {Arabidopsis thaliana} SCOP: c.69.1.0 Back     alignment and structure
>3r40_A Fluoroacetate dehalogenase; FACD, defluorinase, alpha/beta hydrolase, hydrolase; 1.05A {Rhodopseudomonas palustris} PDB: 3r3w_A 3r3x_A 3r3v_A 3r3u_A 3r3z_A 3r41_A 3r3y_A Back     alignment and structure
>4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} SCOP: c.69.1.0 PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A Back     alignment and structure
>1azw_A Proline iminopeptidase; aminopeptidase, serine protease, xanthomonas campestris; 2.70A {Xanthomonas citri} SCOP: c.69.1.7 Back     alignment and structure
>3om8_A Probable hydrolase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 2.25A {Pseudomonas aeruginosa} SCOP: c.69.1.0 Back     alignment and structure
>3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure
>3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni} Back     alignment and structure
>3u1t_A DMMA haloalkane dehalogenase; alpha/beta-hydrolase, hydrolase; 2.20A {Unidentified} Back     alignment and structure
>3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis} Back     alignment and structure
>3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} PDB: 3rli_A Back     alignment and structure
>3g9x_A Haloalkane dehalogenase; alpha/beta hydrolase, helical CAP domain, catalytic triad (A His272, Glu130), mutant, I135F, haloalkanes; 0.95A {Rhodococcus SP} SCOP: c.69.1.8 PDB: 3fwh_A 3fbw_A 3rlt_A 3rk4_A 1bn6_A 1bn7_A 4fwb_A 1cqw_A 3sk0_A 2v9z_A Back     alignment and structure
>2qvb_A Haloalkane dehalogenase 3; RV2579, alpha-beta hydrolase protei structural genomics consortium, TBSGC, hydrolase; 1.19A {Mycobacterium tuberculosis} PDB: 2o2i_A 2o2h_A Back     alignment and structure
>1wm1_A Proline iminopeptidase; complex with inhibitor, hydrolase; HET: PTB; 2.10A {Serratia marcescens} SCOP: c.69.1.7 PDB: 1qtr_A* 1x2b_A* 1x2e_A* Back     alignment and structure
>2h1i_A Carboxylesterase; structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics, MCSG, H; HET: MSE; 2.80A {Bacillus cereus} SCOP: c.69.1.14 Back     alignment and structure
>3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum} Back     alignment and structure
>2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus} Back     alignment and structure
>3ibt_A 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, oxidoreductase; 2.60A {Pseudomonas putida} Back     alignment and structure
>1mj5_A 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; LINB, haloalkane dehalogenase, 1, 3, 4, 4-cyclohexadiene dehalogenase; 0.95A {Sphingomonas paucimobilis} SCOP: c.69.1.8 PDB: 1cv2_A 1d07_A 2bfn_A 1g42_A* 1g4h_A* 1g5f_A* 1iz7_A 1iz8_A* 1k5p_A 1k63_A 1k6e_A Back     alignment and structure
>3kda_A CFTR inhibitory factor (CIF); alpha/beta hydrolase, hydrolase; 1.50A {Pseudomonas aeruginosa ucbpp-pa14} PDB: 3kd2_A 3pi6_A Back     alignment and structure
>3llc_A Putative hydrolase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE PG4; 1.80A {Agrobacterium vitis} Back     alignment and structure
>2yys_A Proline iminopeptidase-related protein; TTHA1809, structural genomics, unknown function; 2.20A {Thermus thermophilus} Back     alignment and structure
>1k8q_A Triacylglycerol lipase, gastric; APHA beta hydrolase fold, hydrolase; HET: NAG BOG C11; 2.70A {Canis lupus familiaris} SCOP: c.69.1.6 PDB: 1hlg_A* Back     alignment and structure
>2xua_A PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, catechol metabolism; 1.90A {Burkholderia xenovorans} Back     alignment and structure
>3bwx_A Alpha/beta hydrolase; YP_496220.1, joint center for structural genomics, protein structure initiative, PSI-2; HET: MSE; 1.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>1q0r_A RDMC, aclacinomycin methylesterase; anthracycline, hydrolase, polyketide, tailoring enzyme, structural proteomics in europe, spine; HET: AKT 1PE; 1.45A {Streptomyces purpurascens} SCOP: c.69.1.28 PDB: 1q0z_A* Back     alignment and structure
>3sty_A Methylketone synthase 1; alpha/beta hydrolase, decarboxylase, hydrolase; HET: DKA; 1.70A {Lycopersicon hirsutum F} PDB: 3stu_A* 3stt_A* 3stv_A* 3stw_A* 3stx_A* Back     alignment and structure
>2rau_A Putative esterase; NP_343859.1, putative lipase, structural genomics, joint CEN structural genomics, JCSG; HET: PG4 UNL; 1.85A {Sulfolobus solfataricus P2} Back     alignment and structure
>1wom_A RSBQ, sigma factor SIGB regulation protein RSBQ; alpha/beta hydrolase, signaling protein; 2.50A {Bacillus subtilis} PDB: 1wpr_A* Back     alignment and structure
>3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus} Back     alignment and structure
>1ehy_A Protein (soluble epoxide hydrolase); alpha/beta hydrolase fold, epoxide degradation, epichlorohydrin; 2.10A {Agrobacterium tumefaciens} SCOP: c.69.1.11 Back     alignment and structure
>1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27 Back     alignment and structure
>2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis} Back     alignment and structure
>1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12 Back     alignment and structure
>2psd_A Renilla-luciferin 2-monooxygenase; alpha/beta-hydrolase, luciferase, oxidoreductase; 1.40A {Renilla reniformis} PDB: 2pse_A 2psj_A* 2psh_A 2psf_A Back     alignment and structure
>1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12 Back     alignment and structure
>2wfl_A Polyneuridine-aldehyde esterase; alkaloid metabolism, monoterpenoid indole alkaloids, PNAE, hydrolase, serine esterase; HET: CME; 2.10A {Rauvolfia serpentina} PDB: 2wfm_A 3gzj_A* Back     alignment and structure
>2qmq_A Protein NDRG2, protein NDR2; alpha/beta-hydrolases fold, NDR family, developmental protei differentiation, neurogenesis, phosphorylation; HET: 2PE; 1.70A {Mus musculus} PDB: 2xmq_A 2xmr_A 2xms_A Back     alignment and structure
>2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A* Back     alignment and structure
>3v48_A Aminohydrolase, putative aminoacrylate hydrolase RUTD; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.10A {Escherichia coli SE11} Back     alignment and structure
>3bf7_A Esterase YBFF; thioesterase, helical CAP, hydrolase; 1.10A {Escherichia coli} PDB: 3bf8_A Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A* Back     alignment and structure
>1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A Back     alignment and structure
>1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A Back     alignment and structure
>3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A Back     alignment and structure
>3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} SCOP: c.69.1.0 Back     alignment and structure
>2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A Back     alignment and structure
>1c4x_A BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoat hydrolase); PCB degradation; 2.40A {Rhodococcus SP} SCOP: c.69.1.10 Back     alignment and structure
>3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} SCOP: c.69.1.12 PDB: 1va4_A 3t52_A* 3t4u_A* 3hi4_A 3hea_A Back     alignment and structure
>2xt0_A Haloalkane dehalogenase; hydrolase, alpha-beta hydrolase fold; 1.90A {Plesiocystis pacifica} Back     alignment and structure
>2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; C-C bond hydrolase, hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans} PDB: 2pu7_A* 3v1m_A* 3v1l_A* 2puh_A* 3v1n_A* 3v1k_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A Back     alignment and structure
>2i3d_A AGR_C_3351P, hypothetical protein ATU1826; structural genomics, APC5865, hydrolase, PSI-2, protein STRU initiative; HET: MSE; 1.50A {Agrobacterium tumefaciens str} SCOP: c.69.1.36 Back     alignment and structure
>3p2m_A Possible hydrolase; alpha/beta hydrolase superfamily; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12 Back     alignment and structure
>2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A* Back     alignment and structure
>1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A Back     alignment and structure
>4g9e_A AHL-lactonase, alpha/beta hydrolase fold protein; AHL-binding; HET: C4L; 1.09A {Ochrobactrum} PDB: 4g5x_A* 4g8b_A* 4g8d_A 4g8c_A* 4g9g_A Back     alignment and structure
>3c6x_A Hydroxynitrilase; atomic resolution, hydroxynitril lyase, catalysis, protonation state, AB initio calculations, substrate bindin; 1.05A {Hevea brasiliensis} SCOP: c.69.1.20 PDB: 1sc9_A 1yas_A* 2g4l_A* 2yas_A 1qj4_A 3c6y_A 3c6z_A 3c70_A 3yas_A 4yas_A 5yas_A* 6yas_A 7yas_A* 1yb6_A* 1yb7_A 1sck_A 1sci_A 1scq_A 1dwo_A 1dwp_A ... Back     alignment and structure
>3e4d_A Esterase D; S-formylglutathione hydrolase, hydrolase fold family, catalytic triad, kinetics, proposed reaction mechanism; HET: MSE; 2.01A {Agrobacterium tumefaciens} SCOP: c.69.1.0 Back     alignment and structure
>1j1i_A META cleavage compound hydrolase; carbazole degradation, META cleavage product hydrolase, histidine tagged protein, alpha/beta-hydrolase; 1.86A {Janthinobacterium} SCOP: c.69.1.10 Back     alignment and structure
>2pl5_A Homoserine O-acetyltransferase; alpha/beta hydrolase superfa transferase; 2.20A {Leptospira interrogans} SCOP: c.69.1.40 Back     alignment and structure
>2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A Back     alignment and structure
>3afi_E Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 1.75A {Bradyrhizobium japonicum} PDB: 3a2m_A* 3a2n_A 3a2l_A* Back     alignment and structure
>3c5v_A PME-1, protein phosphatase methylesterase 1; demethylase, PP2A, alternative splicing, hydrolase, phosphoprotein, serine esterase; 2.00A {Homo sapiens} PDB: 3c5w_P Back     alignment and structure
>4fbl_A LIPS lipolytic enzyme; thermostable, structural genomics, enzyme function initiativ structural proteomics in europe, spine; HET: SPD; 1.99A {Unidentified} PDB: 4fbm_A Back     alignment and structure
>2hdw_A Hypothetical protein PA2218; alpha/beta hydrolase fold, structural genomics, PSI, structure initiative; 2.00A {Pseudomonas aeruginosa} Back     alignment and structure
>2uz0_A Esterase, tributyrin esterase; alpha/beta hydrolase, hydrolase, A virulence facto LUNG infection; HET: MSE; 1.7A {Streptococcus pneumoniae} Back     alignment and structure
>3kxp_A Alpha-(N-acetylaminomethylene)succinic acid hydrolase; alpha/beta hydrolase, PLP degradation, E-2- (acetamidomethylene)succinate; 2.26A {Mesorhizobium loti} Back     alignment and structure
>3fla_A RIFR; alpha-beta hydrolase thioesterase, hydrolase; HET: MSE; 1.80A {Amycolatopsis mediterranei} PDB: 3flb_A* Back     alignment and structure
>1xkl_A SABP2, salicylic acid-binding protein 2; alpha-beta protein, structural genomics, protein structure initiative, PSI; HET: STH; 2.00A {Nicotiana tabacum} SCOP: c.69.1.20 PDB: 1y7i_A* 1y7h_A* Back     alignment and structure
>1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli} Back     alignment and structure
>2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A* Back     alignment and structure
>2r8b_A AGR_C_4453P, uncharacterized protein ATU2452; APC6088, agrobacterium tumefaciens STR. C58 structural genomics, PSI-2; 2.56A {Agrobacterium tumefaciens str} SCOP: c.69.1.14 Back     alignment and structure
>2qjw_A Uncharacterized protein XCC1541; putative hydrolase of the alpha/beta superfamily, structural genomics; HET: MSE TLA P6G; 1.35A {Xanthomonas campestris PV} Back     alignment and structure
>2e3j_A Epoxide hydrolase EPHB; epoxide hydrolase B, structural mycobacterium tuberculosis structural proteomics project, X hydrolase; 2.10A {Mycobacterium tuberculosis} PDB: 2zjf_A* Back     alignment and structure
>1fj2_A Protein (acyl protein thioesterase 1); alpha/beta hydrolase, serine hydrolase, SAD, anomalous diffr hydrolase; 1.50A {Homo sapiens} SCOP: c.69.1.14 Back     alignment and structure
>1zi8_A Carboxymethylenebutenolidase; alpha and beta proteins, 3-D structure, serine esterase, HYD aromatic hydrocarbons, catabolism; 1.40A {Pseudomonas putida} PDB: 1zj5_A* 1zi9_A 1zi6_A 1zj4_A* 1din_A 1ziy_A* 1zic_A 1zix_A 1ggv_A* Back     alignment and structure
>3qyj_A ALR0039 protein; alpha/beta fold, hydrolase; 1.78A {Nostoc SP} Back     alignment and structure
>3qmv_A Thioesterase, REDJ; alpha/beta hydrolase fold, hydrolase; 2.12A {Streptomyces coelicolor} PDB: 3qmw_A* Back     alignment and structure
>3b5e_A MLL8374 protein; NP_108484.1, carboxylesterase, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; 1.75A {Mesorhizobium loti} SCOP: c.69.1.14 Back     alignment and structure
>1imj_A CIB, CCG1-interacting factor B; alpha/beta hydrolase, CCG1 interactor; 2.20A {Homo sapiens} SCOP: c.69.1.23 Back     alignment and structure
>4i19_A Epoxide hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.15A {Streptomyces carzinostaticus subsp} Back     alignment and structure
>3vdx_A Designed 16NM tetrahedral protein CAGE containing bromoperoxidase BPO-A2 and matrix...; protein design, bionanotechnology; 3.00A {Streptomyces aureofaciens} PDB: 4d9j_A Back     alignment and structure
>1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35 Back     alignment and structure
>3ksr_A Putative serine hydrolase; catalytic triad, structural genomics, JOIN for structural genomics, JCSG; 2.69A {Xanthomonas campestris PV} Back     alignment and structure
>3f67_A Putative dienelactone hydrolase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 1.74A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1l7a_A Cephalosporin C deacetylase; structural genomics, alpha-beta-alpha sandwich, PSI, protein structure initiative; 1.50A {Bacillus subtilis} SCOP: c.69.1.25 PDB: 1odt_C 1ods_A 3fvt_A 3fvr_A 3fyu_A* 2xlb_A 2xlc_A 3fyt_A* 3fyu_B* Back     alignment and structure
>2fuk_A XC6422 protein; A/B hydrolase, structural genomics, X-RAY diffraction; 1.60A {Xanthomonas campestris} SCOP: c.69.1.36 Back     alignment and structure
>3cn9_A Carboxylesterase; alpha/beta hydrolase fold super-family, hydrolase; HET: 2PE; 2.09A {Pseudomonas aeruginosa} PDB: 3cn7_A* Back     alignment and structure
>1auo_A Carboxylesterase; hydrolase; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.14 PDB: 1aur_A* Back     alignment and structure
>3og9_A Protein YAHD A copper inducible hydrolase; alpha/beta hydrolase, copper homeostasis, malic acid; 1.88A {Lactococcus lactis subsp} SCOP: c.69.1.0 Back     alignment and structure
>3i6y_A Esterase APC40077; lipase, structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic hydrolase; HET: MSE; 1.75A {Oleispira antarctica} PDB: 3s8y_A Back     alignment and structure
>3fcy_A Xylan esterase 1; alpha/beta hydrolase, carbohydrate esterase, CE7; 2.10A {Thermoanaerobacterium SP} Back     alignment and structure
>1b6g_A Haloalkane dehalogenase; hydrolase, alpha/beta-hydrolase; 1.15A {Xanthobacter autotrophicus} SCOP: c.69.1.8 PDB: 1be0_A 1cij_A 2yxp_X 1edd_A 1edb_A 2dhc_A 2dhe_A 2eda_A 2edc_A 2had_A 1ede_A 2pky_X 1bez_A 1bee_A 2dhd_A* 1hde_A Back     alignment and structure
>1m33_A BIOH protein; alpha-betta-alpha sandwich, structural genomics, PSI, protei structure initiative; HET: MSE 3OH; 1.70A {Escherichia coli} SCOP: c.69.1.26 Back     alignment and structure
>2vat_A Acetyl-COA--deacetylcephalosporin C acetyltransferase; A/B- hydrolase fold, acyltransferase, acetyl coenzyme A, antibiotic biosynthesis; HET: COA; 2.2A {Acremonium chrysogenum} SCOP: c.69.1.40 PDB: 2vav_A* 2vax_A* Back     alignment and structure
>3b12_A Fluoroacetate dehalogenase; dehalogease, hydrolase; 1.20A {Burkholderia SP} PDB: 1y37_A Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>3ls2_A S-formylglutathione hydrolase; psychrophilic organism; 2.20A {Pseudoalteromonas haloplanktis} SCOP: c.69.1.0 Back     alignment and structure
>1pja_A Palmitoyl-protein thioesterase 2 precursor; hydrolase, glycoprotein, lysosome; HET: NAG; 2.70A {Homo sapiens} SCOP: c.69.1.13 Back     alignment and structure
>1vlq_A Acetyl xylan esterase; TM0077, structural genomics, JCSG, PR structure initiative, PSI, joint center for structural GENO hydrolase; 2.10A {Thermotoga maritima} SCOP: c.69.1.25 PDB: 3m81_A 3m83_A* 3m82_A* Back     alignment and structure
>2jbw_A Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine hydrolase; alpha/beta hydrolase, META-cleavage pathway; 2.1A {Arthrobacter nicotinovorans} SCOP: c.69.1.41 Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>2wj6_A 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxidoreductase, alpha/beta hydrolase; HET: ZZ8 SRT; 2.00A {Arthrobacter nitroguajacolicus} PDB: 2wj4_A* 2wj3_A* 2wm2_A* Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp} Back     alignment and structure
>3trd_A Alpha/beta hydrolase; cellular processes; 1.50A {Coxiella burnetii} Back     alignment and structure
>2b61_A Homoserine O-acetyltransferase; acyl-enzyme, aspartate pathway, coenzyme A, structure-functi studies, alpha-beta hydrolase fold; 1.65A {Haemophilus influenzae} SCOP: c.69.1.40 Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>4b6g_A Putative esterase; hydrolase, formaldehyde detoxification, alpha/beta serine HY; 1.40A {Neisseria meningitidis MC58} Back     alignment and structure
>3g02_A Epoxide hydrolase; alpha/beta hydrolase fold, enantioselective, mutant, directed evolution; 1.50A {Aspergillus niger} SCOP: c.69.1.11 PDB: 1qo7_A 3g0i_A* Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3fcx_A FGH, esterase D, S-formylglutathione hydrolase; retinoblastoma, genetic marker, cytoplasm, cytoplasmic vesicle, polymorphism, serine esterase; 1.50A {Homo sapiens} SCOP: c.69.1.0 Back     alignment and structure
>2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2 Back     alignment and structure
>3k6k_A Esterase/lipase; alpha/beta hydrolase fold; 2.20A {Uncultured bacterium} PDB: 3dnm_A Back     alignment and structure
>3h2g_A Esterase; xanthomonas oryzae PV. oryzae, cell WALL degrading enzyme, RICE, virulence, innate immune responses, pathogenesis; 1.86A {Xanthomonas oryzae PV} PDB: 3h2j_A 3h2k_A* 3h2h_A 3h2i_A Back     alignment and structure
>1jji_A Carboxylesterase; alpha-beta hydrolase fold, hydrolase; HET: EPE; 2.20A {Archaeoglobus fulgidus} SCOP: c.69.1.2 Back     alignment and structure
>2c7b_A Carboxylesterase, ESTE1; carboxyesterase, thermophilic enzyme, hydrolase, HSL, alpha/beta hydrolase fold; 2.3A {Uncultured archaeon} Back     alignment and structure
>3ain_A 303AA long hypothetical esterase; carboxylesterase, thermophilic, dimer, archaea, R267G, hydro; 1.65A {Sulfolobus tokodaii} PDB: 3aio_A 3ail_A 3aik_A 3aim_A Back     alignment and structure
>3i1i_A Homoserine O-acetyltransferase; structural genomics, IDP01610, O-acetyltransfera bacillus anthracis; HET: MSE; 2.44A {Bacillus anthracis str} Back     alignment and structure
>2dst_A Hypothetical protein TTHA1544; conserved hypothetical protein, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} SCOP: c.69.1.39 Back     alignment and structure
>3ds8_A LIN2722 protein; unkonwn function, structural genomics, PSI, MCSG, P structure initiative; 1.80A {Listeria innocua} Back     alignment and structure
>3fnb_A Acylaminoacyl peptidase SMU_737; alpha-beta-alpha sandwich, helix bundle, structural genomics protein structure initiative; HET: PGE; 2.12A {Streptococcus mutans} Back     alignment and structure
>3d0k_A Putative poly(3-hydroxybutyrate) depolymerase LPQ; alpha-beta-alpha sandwich, structural genomics, PSI-2; 1.83A {Bordetella parapertussis 12822} Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>2hm7_A Carboxylesterase; alpha/beta hydrolase fold, hydrolase; 2.00A {Alicyclobacillus acidocaldarius} PDB: 1evq_A* 1u4n_A 1qz3_A Back     alignment and structure
>1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A Back     alignment and structure
>4hvt_A Ritya.17583.B, post-proline cleaving enzyme; ssgcid, structural genomics, S structural genomics center for infectious disease; 1.70A {Rickettsia typhi} Back     alignment and structure
>3k2i_A Acyl-coenzyme A thioesterase 4; alpha/beta hydrolase fold seven-stranded beta-sandwich, structural genomics, structural genomics consortium, SGC; 2.40A {Homo sapiens} Back     alignment and structure
>3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp} Back     alignment and structure
>3fak_A Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Uncultured bacterium} PDB: 3g9t_A 3g9u_A 3g9z_A 3h17_A* 3h18_A* 3h19_A 3h1a_A 3h1b_A 3l1h_A 3l1i_A 3l1j_A 3v9a_A Back     alignment and structure
>1jkm_A Brefeldin A esterase; serine hydrolase, degradation of brefeldin A, alpha/beta hydrolase family; 1.85A {Bacillus subtilis} SCOP: c.69.1.2 Back     alignment and structure
>3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A* Back     alignment and structure
>2o7r_A CXE carboxylesterase; alpha/beta hydrolase; 1.40A {Actinidia eriantha} PDB: 2o7v_A Back     alignment and structure
>2zsh_A Probable gibberellin receptor GID1L1; plant hormone receptor, gibberellin, gibberellin signaling pathway, hydrolase, nucleus, receptor, developmental protein; HET: GA3; 1.80A {Arabidopsis thaliana} PDB: 2zsi_A* Back     alignment and structure
>1jjf_A Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-xylan; feruloyl esterase, ferulic acid esterase, FAE_XYNZ, XYNZ, structural genomics; 1.75A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1jt2_A* Back     alignment and structure
>1lzl_A Heroin esterase; alpha/beta hydrolase; 1.30A {Rhodococcus SP} SCOP: c.69.1.2 PDB: 1lzk_A Back     alignment and structure
>1ys1_X Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor hexylphosphonic acid (R) 2-methyl-3-phenylpropyl ester, hydrolase; HET: 2HR; 1.10A {Burkholderia cepacia} PDB: 1ys2_X* 4lip_D 1hqd_A 2lip_A 1oil_A* 3lip_A 2nw6_A 5lip_A* 1cvl_A 2es4_A 1tah_B 1qge_D 1qge_E Back     alignment and structure
>3d7r_A Esterase; alpha/beta fold, hydrolase; 2.01A {Staphylococcus aureus subsp} Back     alignment and structure
>1bu8_A Protein (pancreatic lipase related protein 2); hydrolase, lipid degradation; HET: NAG; 1.80A {Rattus norvegicus} SCOP: b.12.1.2 c.69.1.19 PDB: 2oxe_A* 2pvs_A 1eth_A* Back     alignment and structure
>1qlw_A Esterase; anisotropic refinement, atomic resolution, alpha/beta hydrolase; 1.09A {Alcaligenes SP} SCOP: c.69.1.15 PDB: 2wkw_A* Back     alignment and structure
>3hlk_A Acyl-coenzyme A thioesterase 2, mitochondrial; alpha/beta hydrolase, alternative splicing, hydrolase, mitochondrion, polymorphism, serine esterase; 2.10A {Homo sapiens} Back     alignment and structure
>3ebl_A Gibberellin receptor GID1; alpha/beta hydrolase, lipase, gibberellin signaling pathway, hydrolase, nucleus, hydrolase receptor; HET: GA4; 1.90A {Oryza sativa subsp} PDB: 3ed1_A* Back     alignment and structure
>3ga7_A Acetyl esterase; phosphoserine, IDP00896, hydrolase, serine structural genomics, center for structural genomics of INFE diseases, csgid; HET: SEP MSE; 1.55A {Salmonella typhimurium} Back     alignment and structure
>3d59_A Platelet-activating factor acetylhydrolase; secreted protein, alpha/beta-hydrolase-fold, LDL-bound, lipoprotein associated phospholipase A2, LP-PLA2; 1.50A {Homo sapiens} PDB: 3d5e_A 3f97_A* 3f98_A 3f9c_A* 3f96_A* Back     alignment and structure
>1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A Back     alignment and structure
>3u0v_A Lysophospholipase-like protein 1; alpha, beta hydrolase fold, hydrolase; 1.72A {Homo sapiens} Back     alignment and structure
>4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A Back     alignment and structure
>1ex9_A Lactonizing lipase; alpha-beta hydrolase fold, phosphonate inhibitor; HET: OCP; 2.54A {Pseudomonas aeruginosa} SCOP: c.69.1.18 Back     alignment and structure
>1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32 Back     alignment and structure
>3doh_A Esterase; alpha-beta hydrolase, beta sheet; 2.60A {Thermotoga maritima} PDB: 3doi_A Back     alignment and structure
>1uxo_A YDEN protein; hydrolase, A/B hydrolase, esterase, PSI, protein structure initiative, MCSG, midwest center for structural genomics; 1.8A {Bacillus subtilis} SCOP: c.69.1.31 Back     alignment and structure
>1gpl_A RP2 lipase; serine esterase, hydrolase, lipid degradation, pancreas, glycoprotein, chimeric; 2.01A {Cavia porcellus} SCOP: b.12.1.2 c.69.1.19 PDB: 1lpb_B* 1lpa_B* 1n8s_A Back     alignment and structure
>1sfr_A Antigen 85-A; alpha/beta hydrolase, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 2.70A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>1r88_A MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBPC1, immune system; 1.71A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>2q0x_A Protein DUF1749, uncharacterized protein; alpha/beta hydrolase fold, structural genomics, structural G of pathogenic protozoa consortium; 2.20A {Trypanosoma brucei} Back     alignment and structure
>2x5x_A PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE, hydrolase, biodegradation, catal; HET: PG4; 1.20A {Paucimonas lemoignei} PDB: 2vtv_A* 2x76_A Back     alignment and structure
>1tht_A Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.13 Back     alignment and structure
>3g8y_A SUSD/RAGB-associated esterase-like protein; structural genom joint center for structural genomics, JCSG; HET: MSE; 1.90A {Bacteroides vulgatus atcc 8482} Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>3qh4_A Esterase LIPW; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, tuberculosis, O LIPW, heroin esterase; 1.75A {Mycobacterium marinum} Back     alignment and structure
>4ezi_A Uncharacterized protein; alpha-beta hydrolases fold, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.15A {Legionella pneumophila subsp} Back     alignment and structure
>3mve_A FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/respiration switch protein, hydrolase ACTI lyase; 2.20A {Vibrio vulnificus} PDB: 3our_A Back     alignment and structure
>1w52_X Pancreatic lipase related protein 2; detergent, cleaved flap; HET: DDQ; 2.99A {Equus caballus} Back     alignment and structure
>3bjr_A Putative carboxylesterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.09A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3ils_A PKS, aflatoxin biosynthesis polyketide synthase; A/B hydrolase, thioesterase, norsolorinic acid, P polyketide, acyltransferase; 1.70A {Aspergillus parasiticus} Back     alignment and structure
>2qm0_A BES; alpha-beta structure, structural genomics, PSI-2, protein ST initiative, midwest center for structural genomics, MCSG; HET: SVY; 1.84A {Bacillus cereus atcc 14579} Back     alignment and structure
>1jfr_A Lipase; serine hydrolase; 1.90A {Streptomyces exfoliatus} SCOP: c.69.1.16 Back     alignment and structure
>1dqz_A 85C, protein (antigen 85-C); fibronectin, structural genomics, PSI, protein structure initiative, TB structural genomics consortium; 1.50A {Mycobacterium tuberculosis} SCOP: c.69.1.3 PDB: 3hrh_A 1dqy_A 1va5_A* 1f0n_A* 1f0p_A* Back     alignment and structure
>3vis_A Esterase; alpha/beta-hydrolase fold, polyethylene terephthal hydrolase; HET: PE4; 1.76A {Thermobifida alba} Back     alignment and structure
>2qru_A Uncharacterized protein; alpha/beta-hydrolase, structural GENO PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.65A {Enterococcus faecalis} Back     alignment and structure
>3nuz_A Putative acetyl xylan esterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology; 2.30A {Bacteroides fragilis} Back     alignment and structure
>1tca_A Lipase; hydrolase(carboxylic esterase); HET: NAG; 1.55A {Candida antarctica} SCOP: c.69.1.17 PDB: 1lbs_A* 1lbt_A* 1tcb_A* 1tcc_A* Back     alignment and structure
>3i2k_A Cocaine esterase; alpha/beta hydrolase, hydrolase; HET: DBC GOL; 1.51A {Rhodococcus SP} PDB: 3i2j_A* 3puh_A 3i2h_A* 3i2i_A* 3i2g_A* 3ida_A* 3i2f_A* 3pui_A 1ju3_A 1ju4_A 1l7q_A 1l7r_A Back     alignment and structure
>2k2q_B Surfactin synthetase thioesterase subunit; A/B-hydrolase, NRPS, non-ribosomal peptide synthetase, type II thioesterase, antibiotic biosynthesis; NMR {Bacillus subtilis} PDB: 2ron_A Back     alignment and structure
>3lcr_A Tautomycetin biosynthetic PKS; alpha-beta hydrolase, thioesterase, polyketide synthase, phosphopantetheine, transferase, hydrolase; 2.00A {Streptomyces SP} Back     alignment and structure
>2qs9_A Retinoblastoma-binding protein 9; B5T overexpressed gene protein, BOG, RBBP9, RBBP10, HR2978, NESG, structural genomics, PSI-2; 1.72A {Homo sapiens} Back     alignment and structure
>4fle_A Esterase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, alpha-beta protein, rossmann fold, HY; 2.10A {Yersinia enterocolitica subsp} Back     alignment and structure
>1gkl_A Endo-1,4-beta-xylanase Y; hydrolase, esterase family 1, inactive mutant; HET: FER; 1.4A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1wb4_A* 1wb5_A* 1wb6_A* 1gkk_A* Back     alignment and structure
>2zyr_A Lipase, putative; fatty acid, hydrolase; HET: 1PE; 1.77A {Archaeoglobus fulgidus} PDB: 2zys_A* 2zyi_A* 2zyh_A* Back     alignment and structure
>3lp5_A Putative cell surface hydrolase; structural genom PSI2, MCSG, protein structure initiative, midwest center FO structural genomics; 2.00A {Lactobacillus plantarum} Back     alignment and structure
>4ao6_A Esterase; hydrolase, thermo label; 1.60A {Unidentified} PDB: 4ao7_A 4ao8_A Back     alignment and structure
>1qe3_A PNB esterase, para-nitrobenzyl esterase; alpha-beta hydrolase directed evolution; 1.50A {Bacillus subtilis} SCOP: c.69.1.1 PDB: 1c7j_A 1c7i_A Back     alignment and structure
>2b9v_A Alpha-amino acid ester hydrolase; catalytic triad, alpha/beta-hydrolase; 2.00A {Acetobacter pasteurianus} SCOP: b.18.1.13 c.69.1.21 PDB: 2b4k_A 1nx9_A* 1ryy_A Back     alignment and structure
>3iii_A COCE/NOND family hydrolase; structural genomics, center for structural genomi infectious diseases, csgid; HET: MSE PLM; 1.95A {Staphylococcus aureus subsp} PDB: 3ib3_A* Back     alignment and structure
>4h0c_A Phospholipase/carboxylesterase; PSI-biology, midwest center for structural genomics, MCSG, hydrolase; HET: CIT; 1.62A {Dyadobacter fermentans} Back     alignment and structure
>1kez_A Erythronolide synthase; polyketide synthase, modular polyketide synthase, thioesterase, 6-DEB, TE, DEBS, alpha, beta-hydrolase; 2.80A {Saccharopolyspora erythraea} SCOP: c.69.1.22 PDB: 1mo2_A Back     alignment and structure
>1mpx_A Alpha-amino acid ester hydrolase; alpha/beta hydrolase, jellyroll, selenomethionine; 1.90A {Xanthomonas citri} SCOP: b.18.1.13 c.69.1.21 Back     alignment and structure
>2gzs_A IROE protein; enterobactin, salmochelin, DFP, hydrolase, catalytic DYAD; HET: DFP; 1.40A {Escherichia coli} SCOP: c.69.1.38 PDB: 2gzr_A* Back     alignment and structure
>3bdv_A Uncharacterized protein DUF1234; DUF1234 family protein, alpha/beta-hydrolases fold, structur genomics; HET: MSE; 1.66A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>3fle_A SE_1780 protein; structural genomics, APC61035.1, PSI-2, protein structure in midwest center for structural genomics, MCSG; 2.01A {Staphylococcus epidermidis} Back     alignment and structure
>2ogt_A Thermostable carboxylesterase EST50; alpha/beta hydrolase, hydrolase; 1.58A {Geobacillus stearothermophilus} PDB: 2ogs_A Back     alignment and structure
>3icv_A Lipase B, CALB; circular permutation, cleavage on PAIR of basic residues, glycoprotein, hydrolase, lipid degradation, zymogen, disulf; HET: NAG BTB; 1.49A {Candida antarctica} PDB: 3icw_A* Back     alignment and structure
>1p0i_A Cholinesterase; serine hydrolase, butyrate, hydrolase; HET: NAG FUC MES; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 1p0m_A* 1p0p_A* 1p0q_A* 1xlu_A* 1xlv_A* 1xlw_A* 2wsl_A* 2pm8_A* 3djy_A* 3dkk_A* 2wij_A* 2wif_A* 2wik_A* 2y1k_A* 2j4c_A* 2xmb_A* 2xmc_A* 2xmd_A* 2xmg_A* 2wig_A* ... Back     alignment and structure
>2h7c_A Liver carboxylesterase 1; enzyme, cholesteryl esterase, hydrolase; HET: NAG NDG SIA COA; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 2dqy_A* 2dr0_A* 2dqz_A* 1mx1_A* 1mx5_A* 1mx9_A* 4ab1_A* 1ya4_A* 1yah_A* 1yaj_A* 1ya8_A* 2hrr_A* 2hrq_A* 3k9b_A* 1k4y_A* Back     alignment and structure
>2ha2_A ACHE, acetylcholinesterase; hydrolase fold, serine esterase, homod glycosylated protein, hydrolase; HET: NAG FUC SCK SCU P6G; 2.05A {Mus musculus} SCOP: c.69.1.1 PDB: 1j07_A* 1mah_A* 1j06_A* 1n5r_A* 2gyv_A* 2gyw_A* 2h9y_A* 2ha0_A* 2gyu_A* 2ha3_A* 2wls_A* 4a23_A* 2c0q_A* 2jey_A* 2jgm_A* 2whr_A* 2c0p_A* 1ku6_A* 1q84_A* 1q83_A* ... Back     alignment and structure
>1hpl_A Lipase; hydrolase(carboxylic esterase); 2.30A {Equus caballus} SCOP: b.12.1.2 c.69.1.19 Back     alignment and structure
>3tej_A Enterobactin synthase component F; nonribosomal peptide, thioesterase, carrier domain, ATP- BIN enterobactin biosynthesis, ION transport, iron; HET: UF0; 1.90A {Escherichia coli} PDB: 2roq_A Back     alignment and structure
>1lns_A X-prolyl dipeptidyl aminopetidase; alpha beta hydrolase fold; 2.20A {Lactococcus lactis} SCOP: a.40.2.1 b.18.1.13 c.69.1.21 Back     alignment and structure
>1ei9_A Palmitoyl protein thioesterase 1; alpha/beta hydrolase, glycoprotein, hydrolase; HET: NDG NAG; 2.25A {Bos taurus} SCOP: c.69.1.13 PDB: 1eh5_A* 1exw_A* 3gro_A Back     alignment and structure
>1dx4_A ACHE, acetylcholinesterase; hydrolase, serine esterase, synapse, membrane, nerve, muscle neurotransmitter degradation, glycoprotein; HET: NAG MAN BMA 760; 2.70A {Drosophila melanogaster} SCOP: c.69.1.1 PDB: 1qo9_A* 1qon_A* Back     alignment and structure
>4fhz_A Phospholipase/carboxylesterase; alpha/beta hydrolase superfamily, central beta-STR sheet, flanked alpha helices, hydrolase; 2.01A {Rhodobacter sphaeroides} PDB: 4ftw_A* Back     alignment and structure
>1rp1_A Pancreatic lipase related protein 1; hydrolase, lipid degradation; HET: NAG; 2.10A {Canis lupus familiaris} SCOP: b.12.1.2 c.69.1.19 PDB: 2ppl_A Back     alignment and structure
>3tjm_A Fatty acid synthase; thioesterase domain, fatty acid synthesis, hydrolase-hydrola inhibitor complex; HET: 7FA; 1.48A {Homo sapiens} PDB: 1xkt_A Back     alignment and structure
>2fj0_A JuvenIle hormone esterase; manduca sexta, alpha-beta hydrolase; HET: TFC; 2.70A {Trichoplusia NI} Back     alignment and structure
>1ea5_A ACHE, acetylcholinesterase; hydrolase, serine hydrolase, neurotransmitter cleavage, catalytic triad, alpha/beta hydrolase; HET: NAG; 1.80A {Torpedo californica} SCOP: c.69.1.1 PDB: 1ax9_A* 1amn_A* 1cfj_A* 1fss_A* 1gpk_A* 1gpn_A* 1oce_A* 1qid_A 1qie_A 1qif_A 1qig_A 1qih_A 1qii_A 1qij_A 1qik_A 1qim_A 1qti_A* 1vot_A* 1vxo_A* 1vxr_A* ... Back     alignment and structure
>1thg_A Lipase; hydrolase(carboxylic esterase); HET: NAG NDG; 1.80A {Galactomyces geotrichum} SCOP: c.69.1.17 Back     alignment and structure
>1llf_A Lipase 3; candida cylindracea cholesterol esterase, sterol ester acylh hydrolase; HET: NAG F23; 1.40A {Candida cylindracea} SCOP: c.69.1.17 PDB: 1cle_A* 1lpm_A* 1lpn_A* 1lpo_A* 1lpp_A* 1lps_A* 1crl_A* 1trh_A* 3rar_A* 1gz7_A* Back     alignment and structure
>2hfk_A Pikromycin, type I polyketide synthase pikaiv; alpha/beta hydrolase, thioesterase; HET: E4H; 1.79A {Streptomyces venezuelae} PDB: 2h7x_A* 2h7y_A* 2hfj_A* 1mna_A 1mn6_A 1mnq_A Back     alignment and structure
>1ivy_A Human protective protein; carboxypeptidase, serine carboxypeptidase, protective protei glycoprotein, zymogen; HET: NAG NDG; 2.20A {Homo sapiens} SCOP: c.69.1.5 Back     alignment and structure
>1ycd_A Hypothetical 27.3 kDa protein in AAP1-SMF2 intergenic region; esterase, lipase, serine hydrolase, structural genomics; HET: LI5; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3gff_A IROE-like serine hydrolase; NP_718593.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.12A {Shewanella oneidensis} Back     alignment and structure
>2bce_A Cholesterol esterase; hydrolase, serine esterase, lipase; 1.60A {Bos taurus} SCOP: c.69.1.1 PDB: 1akn_A* 1aql_A* 1f6w_A 1jmy_A Back     alignment and structure
>2fx5_A Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pseudomonas mendocina} Back     alignment and structure
>1jmk_C SRFTE, surfactin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha-beta hydrolase, cyclic peptide; 1.71A {Bacillus subtilis} SCOP: c.69.1.22 Back     alignment and structure
>3bix_A Neuroligin-1, neuroligin I; esterase domain, alpha-beta hydrolase, cell adhesion, cell J glycoprotein, membrane, postsynaptic cell membrane; HET: NAG; 1.80A {Rattus norvegicus} PDB: 3biw_A* 3b3q_A* 3be8_A* 2wqz_A* 2xb6_A* 2vh8_A 3bl8_A* Back     alignment and structure
>2cb9_A Fengycin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha/beta- hydrolases, catalytic triade, hydrolase; 1.8A {Bacillus subtilis} PDB: 2cbg_A* Back     alignment and structure
>1ukc_A ESTA, esterase; fungi, A/B hydrolase fold, acetylcholinesterase, H; HET: NAG MAN; 2.10A {Aspergillus niger} SCOP: c.69.1.17 Back     alignment and structure
>3c8d_A Enterochelin esterase; alpha-beta-alpha sandwich, IROD, iron aquisition, structural genomics, PSI-2, protein structure initiative; HET: CIT; 1.80A {Shigella flexneri 2a str} SCOP: b.1.18.20 c.69.1.2 PDB: 2b20_A 3c87_A* 3c8h_A 3mga_A* Back     alignment and structure
>2hih_A Lipase 46 kDa form; A1 phospholipase, phospholipid binding, hydrolase; 2.86A {Staphylococcus hyicus} Back     alignment and structure
>1tib_A Lipase; hydrolase(carboxylic esterase); 1.84A {Thermomyces lanuginosus} SCOP: c.69.1.17 PDB: 1dt3_A 1dt5_A 1du4_A 1ein_A* 1dte_A 4dyh_A* 4ea6_A 1gt6_A* Back     alignment and structure
>4f21_A Carboxylesterase/phospholipase family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Francisella tularensis subsp} Back     alignment and structure
>3guu_A Lipase A; protein structure, hydrolase; HET: 1PE; 2.10A {Candida antarctica} PDB: 2veo_A* Back     alignment and structure
>4fol_A FGH, S-formylglutathione hydrolase; D-type esterase, oxidation sensor motif, esterase activity activation, esterase activity inhibition; 2.07A {Saccharomyces cerevisiae} PDB: 1pv1_A 3c6b_A* 4flm_A* Back     alignment and structure
>1whs_A Serine carboxypeptidase II; HET: NAG FUC; 2.00A {Triticum aestivum} SCOP: c.69.1.5 PDB: 1bcs_A* 1bcr_A* 1wht_A* 3sc2_A* Back     alignment and structure
>1tgl_A Triacyl-glycerol acylhydrolase; carboxylic esterase; 1.90A {Rhizomucor miehei} SCOP: c.69.1.17 PDB: 4tgl_A 5tgl_A* 3tgl_A Back     alignment and structure
>2px6_A Thioesterase domain; thioesaterse domain, orlistat, fatty acid synthase, drug complex, tetrahydrolipstatin, transferase; HET: DH9; 2.30A {Homo sapiens} Back     alignment and structure
>1tia_A Lipase; hydrolase(carboxylic esterase); 2.10A {Penicillium camemberti} SCOP: c.69.1.17 Back     alignment and structure
>1lgy_A Lipase, triacylglycerol lipase; hydrolase (carboxylic ester); 2.20A {Rhizopus niveus} SCOP: c.69.1.17 PDB: 1tic_A Back     alignment and structure
>2d81_A PHB depolymerase; alpha/beta hydrolase fold, circular permutation, hydrolase; HET: NAG RB3; 1.66A {Penicillium funiculosum} SCOP: c.69.1.37 PDB: 2d80_A* Back     alignment and structure
>3g7n_A Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A {Penicillium expansum} Back     alignment and structure
>2dsn_A Thermostable lipase; T1 lipase, hydrolase; 1.50A {Geobacillus zalihae} PDB: 3umj_A 2z5g_A 1ji3_A 3auk_A 2w22_A* 1ku0_A Back     alignment and structure
>3uue_A LIP1, secretory lipase (family 3); LID-domain, hydrolase; HET: NAG BMA MAN; 1.45A {Malassezia globosa} PDB: 3uuf_A* Back     alignment and structure
>1ac5_A KEX1(delta)P; carboxypeptidase, hydrolase, glycoprotein, transmembrane; HET: NAG; 2.40A {Saccharomyces cerevisiae} SCOP: c.69.1.5 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 475
d3b5ea1209 c.69.1.14 (A:7-215) Uncharacterized protein Mll837 0.004
>d3b5ea1 c.69.1.14 (A:7-215) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]} Length = 209 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Carboxylesterase/thioesterase 1
domain: Uncharacterized protein Mll8374
species: Mesorhizobium loti [TaxId: 381]
 Score = 36.2 bits (82), Expect = 0.004
 Identities = 18/130 (13%), Positives = 34/130 (26%), Gaps = 9/130 (6%)

Query: 88  GSKNNAPIFVYTGNEGDIEWFAQNTGFMYDVAPKFKALLVFIEHRYYGKSIPYGGNKEIA 147
           G ++   +F+  G+  D          +   A               G+     G +   
Sbjct: 19  GKESRECLFLLHGSGVDETTLVPLARRIAPTAT---------LVAARGRIPQEDGFRWFE 69

Query: 148 YKNASTTGYLSSTQALADYASLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVA 207
             + +     S     A +A+   +  K            G S G  L +   L +P + 
Sbjct: 70  RIDPTRFEQKSILAETAAFAAFTNEAAKRHGLNLDHATFLGYSNGANLVSSLMLLHPGIV 129

Query: 208 IGALASSAPI 217
             A       
Sbjct: 130 RLAALLRPMP 139


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query475
d1azwa_313 Proline iminopeptidase {Xanthomonas campestris, pv 98.56
d1mtza_290 Tricorn interacting factor F1 {Archaeon Thermoplas 98.51
d1c4xa_281 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 98.42
d1ehya_293 Bacterial epoxide hydrolase {Agrobacterium radioba 98.35
d1uk8a_271 Meta-cleavage product hydrolase CumD {Pseudomonas 98.32
d1q0ra_297 Aclacinomycin methylesterase RdmC {Streptomyces pu 98.27
d1brta_277 Bromoperoxidase A2 {Streptomyces aureofaciens [Tax 98.26
d1pjaa_268 Palmitoyl protein thioesterase 2 {Human (Homo sapi 98.25
d1zd3a2322 Mammalian epoxide hydrolase, C-terminal domain {Hu 98.22
d1bn7a_291 Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1 98.21
d1b6ga_310 Haloalkane dehalogenase {Xanthobacter autotrophicu 98.18
d1j1ia_268 Meta cleavage compound hydrolase CarC {Janthinobac 98.17
d2rhwa1283 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 98.17
d1k8qa_377 Gastric lipase {Dog (Canis familiaris) [TaxId: 961 98.12
d1a8qa_274 Bromoperoxidase A1 {Streptomyces aureofaciens [Tax 98.12
d1mj5a_298 Haloalkane dehalogenase {Sphingomonas paucimobilis 98.05
d1xkla_258 Salicylic acid-binding protein 2 (SABP2) {Common t 98.01
d1a8sa_273 Chloroperoxidase F {Pseudomonas fluorescens [TaxId 97.99
d1va4a_271 Arylesterase {Pseudomonas fluorescens [TaxId: 294] 97.96
d1hkha_279 Gamma-lactamase {Aureobacterium sp. [TaxId: 51671] 97.9
d1tqha_242 Carboxylesterase Est {Bacillus stearothermophilus 97.89
d3c70a1256 Hydroxynitrile lyase {Rubber tree (Hevea brasilien 97.88
d1wm1a_313 Proline aminopeptidase {Serratia marcescens [TaxId 97.87
d1r3da_264 Hypothetical protein VC1974 {Vibrio cholerae [TaxI 97.86
d1imja_208 Ccg1/TafII250-interacting factor B (Cib) {Human (H 97.86
d1a88a_275 Chloroperoxidase L {Streptomyces lividans [TaxId: 97.84
d1m33a_256 Biotin biosynthesis protein BioH {Escherichia coli 97.8
d1sfra_288 Antigen 85a {Mycobacterium tuberculosis [TaxId: 17 97.63
d2h1ia1202 Carboxylesterase {Bacillus cereus [TaxId: 1396]} 97.32
d1r88a_267 Antigen pt51/mpb51 {Mycobacterium tuberculosis [Ta 97.29
d1cvla_319 Lipase {Chromobacterium viscosum [TaxId: 42739]} 97.26
d2pbla1261 Uncharacterized protein TM1040_2492 {Silicibacter 97.26
d2r8ba1203 Uncharacterized protein Atu2452 {Agrobacterium tum 97.25
d2hu7a2260 Acylamino-acid-releasing enzyme, C-terminal donain 97.22
d1xkta_286 Fatty acid synthase {Human (Homo sapiens) [TaxId: 97.14
d1thta_302 Myristoyl-ACP-specific thioesterase {Vibrio harvey 97.12
d1xfda2258 Dipeptidyl aminopeptidase-like protein 6, DPP6, C- 97.12
d3b5ea1209 Uncharacterized protein Mll8374 {Mesorhizobium lot 97.05
d2jbwa1360 2,6-dihydropseudooxynicotine hydrolase {Arthrobact 96.96
d1vkha_263 Putative serine hydrolase Ydr428c {Baker's yeast ( 96.87
d2bgra2258 Dipeptidyl peptidase IV/CD26, C-terminal domain {P 96.82
d1dqza_280 Antigen 85c {Mycobacterium tuberculosis [TaxId: 17 96.78
d1qo7a_394 Bacterial epoxide hydrolase {Aspergillus niger [Ta 96.64
d1tcaa_317 Triacylglycerol lipase {Yeast (Candida antarctica) 96.56
d1ispa_179 Lipase A {Bacillus subtilis [TaxId: 1423]} 96.54
d1l7aa_318 Cephalosporin C deacetylase {Bacillus subtilis [Ta 96.49
d1mpxa2381 Alpha-amino acid ester hydrolase {Xanthomonas citr 96.41
d1jjia_311 Carboxylesterase {Archaeon Archaeoglobus fulgidus 96.4
d1vlqa_322 Acetyl xylan esterase TM0077 {Thermotoga maritima 96.38
d2dsta1122 Hypothetical protein TTHA1544 {Thermus thermophilu 96.22
d1uxoa_186 Hypothetical protein YdeN {Bacillus subtilis [TaxI 96.14
d1ufoa_238 Hypothetical protein TT1662 {Thermus thermophilus 96.05
d1jjfa_255 Feruloyl esterase domain of the cellulosomal xylan 95.93
d2fuka1218 XC6422 protein {Xanthomonas campestris [TaxId: 339 95.7
d1pv1a_299 Hypothetical esterase YJL068C {Baker's yeast (Sacc 95.41
d1ex9a_285 Lipase {Pseudomonas aeruginosa [TaxId: 287]} 95.4
d1lzla_317 Heroin esterase {Rhodococcus sp. [TaxId: 1831]} 95.08
d2h7xa1283 Picromycin polyketide synthase {Streptomyces venez 94.92
d1jmkc_230 Surfactin synthetase, SrfA {Bacillus subtilis [Tax 94.87
d1ju3a2347 Bacterial cocaine esterase N-terminal domain {Rhod 94.87
d1fj2a_229 Acyl protein thioesterase 1 {Human (Homo sapiens) 94.79
d1wb4a1273 Feruloyl esterase domain of the cellulosomal xylan 94.52
d3c8da2246 Enterochelin esterase, catalytic domain {Shigella 94.44
d2b9va2385 Alpha-amino acid ester hydrolase {Acetobacter past 94.39
d1mo2a_255 Erythromycin polyketide synthase {Saccharopolyspor 94.06
d1jkma_358 Carboxylesterase {Bacillus subtilis, brefeldin A e 93.79
d2i3da1218 Hypothetical protein Atu1826 {Agrobacterium tumefa 93.42
d1u4na_308 Carboxylesterase {Alicyclobacillus acidocaldarius 92.46
d2b61a1357 Homoserine O-acetyltransferase {Haemophilus influe 91.61
d1p0ia_526 Butyryl cholinesterase {Human (Homo sapiens) [TaxI 90.55
d1qfma2280 Prolyl oligopeptidase, C-terminal domain {Pig (Sus 90.32
d1jfra_260 Lipase {Streptomyces exfoliatus [TaxId: 1905]} 90.01
d1llfa_534 Type-B carboxylesterase/lipase {Candida cylindrace 89.36
d1thga_544 Type-B carboxylesterase/lipase {Fungus (Geotrichum 88.71
d2pl5a1362 Homoserine O-acetyltransferase {Leptospira interro 88.53
d2vata1376 Acetyl-CoA:deacetylcephalosporin C acetyltransfera 88.12
d2ha2a1542 Acetylcholinesterase {Mouse (Mus musculus) [TaxId: 87.93
d1qe3a_483 Thermophilic para-nitrobenzyl esterase (PNB estera 87.55
d2gzsa1265 Enterobactin and salmochelin hydrolase IroE {Esche 87.35
d1auoa_218 Carboxylesterase {Pseudomonas fluorescens [TaxId: 87.01
d1uwca_261 Feruloyl esterase A {Aspergillus niger [TaxId: 506 85.69
d1dina_233 Dienelactone hydrolase {Pseudomonas sp., B13 [TaxI 85.39
d1ukca_517 Esterase EstA {Aspergillus niger [TaxId: 5061]} 84.97
d1lnsa3405 X-Prolyl dipeptidyl aminopeptidase PepX, middle do 83.21
d1ivya_452 Human 'protective protein', HPP {Human (Homo sapie 82.72
d2d81a1318 Polyhydroxybutyrate depolymerase {Penicillium funi 80.06
>d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Proline iminopeptidase-like
domain: Proline iminopeptidase
species: Xanthomonas campestris, pv. citri [TaxId: 339]
Probab=98.56  E-value=1.3e-07  Score=89.79  Aligned_cols=105  Identities=21%  Similarity=0.213  Sum_probs=77.2

Q ss_pred             CCCcEEEEeCCCCCccccccccchhhchhhhcCceEEEEeeeeeecCccCCCCccccccCCCCCCCCChhhHHHHHHHHH
Q 011907           91 NNAPIFVYTGNEGDIEWFAQNTGFMYDVAPKFKALLVFIEHRYYGKSIPYGGNKEIAYKNASTTGYLSSTQALADYASLI  170 (475)
Q Consensus        91 ~~gPIfly~GgEg~~~~~~~~~g~~~~lA~~~gA~vv~lEHRyYG~S~P~~~~~~~~~~st~nL~yLts~QALaD~a~Fi  170 (475)
                      .|.||+|..|+-+....+..     ......-+--||++.+|-||+|.|-...           ...|.++..+|+..++
T Consensus        33 ~g~pvvllHG~~g~~~~~~~-----~~~~l~~~~~Vi~~D~rG~G~S~~~~~~-----------~~~~~~~~~~dl~~~~   96 (313)
T d1azwa_          33 HGKPVVMLHGGPGGGCNDKM-----RRFHDPAKYRIVLFDQRGSGRSTPHADL-----------VDNTTWDLVADIERLR   96 (313)
T ss_dssp             TSEEEEEECSTTTTCCCGGG-----GGGSCTTTEEEEEECCTTSTTSBSTTCC-----------TTCCHHHHHHHHHHHH
T ss_pred             CCCEEEEECCCCCCccchHH-----HhHHhhcCCEEEEEeccccCCCCccccc-----------cchhHHHHHHHHHHHH
Confidence            35568888887654322211     1122234678999999999999864332           2346778888988888


Q ss_pred             HHHhhhCCCCCCCEEEEccChhhHHHHHHHHhCCCeeEEEEeccccc
Q 011907          171 IDLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAPI  217 (475)
Q Consensus       171 ~~~k~~~~~~~~pwI~fGGSY~G~LAAW~R~kYP~lv~gavASSAPv  217 (475)
                      ++++.      .+++++|+|+||++|.++-.++|+.+.+.+..+++.
T Consensus        97 ~~l~~------~~~~lvGhS~Gg~ia~~~a~~~p~~v~~lv~~~~~~  137 (313)
T d1azwa_          97 THLGV------DRWQVFGGSWGSTLALAYAQTHPQQVTELVLRGIFL  137 (313)
T ss_dssp             HHTTC------SSEEEEEETHHHHHHHHHHHHCGGGEEEEEEESCCC
T ss_pred             Hhhcc------ccceeEEecCCcHHHHHHHHHhhhceeeeeEecccc
Confidence            87653      378999999999999999999999999888777654



>d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]} Back     information, alignment and structure
>d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]} Back     information, alignment and structure
>d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]} Back     information, alignment and structure
>d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]} Back     information, alignment and structure
>d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]} Back     information, alignment and structure
>d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1a8sa_ c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1va4a_ c.69.1.12 (A:) Arylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]} Back     information, alignment and structure
>d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]} Back     information, alignment and structure
>d1wm1a_ c.69.1.7 (A:) Proline aminopeptidase {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a88a_ c.69.1.12 (A:) Chloroperoxidase L {Streptomyces lividans [TaxId: 1916]} Back     information, alignment and structure
>d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sfra_ c.69.1.3 (A:) Antigen 85a {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2h1ia1 c.69.1.14 (A:1-202) Carboxylesterase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1r88a_ c.69.1.3 (A:) Antigen pt51/mpb51 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1cvla_ c.69.1.18 (A:) Lipase {Chromobacterium viscosum [TaxId: 42739]} Back     information, alignment and structure
>d2pbla1 c.69.1.2 (A:1-261) Uncharacterized protein TM1040_2492 {Silicibacter sp. tm1040 [TaxId: 292414]} Back     information, alignment and structure
>d2r8ba1 c.69.1.14 (A:44-246) Uncharacterized protein Atu2452 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2hu7a2 c.69.1.33 (A:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1xkta_ c.69.1.22 (A:) Fatty acid synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]} Back     information, alignment and structure
>d1xfda2 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3b5ea1 c.69.1.14 (A:7-215) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1vkha_ c.69.1.32 (A:) Putative serine hydrolase Ydr428c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bgra2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1dqza_ c.69.1.3 (A:) Antigen 85c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1qo7a_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1tcaa_ c.69.1.17 (A:) Triacylglycerol lipase {Yeast (Candida antarctica), form b [TaxId: 34362]} Back     information, alignment and structure
>d1ispa_ c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1l7aa_ c.69.1.25 (A:) Cephalosporin C deacetylase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1mpxa2 c.69.1.21 (A:24-404) Alpha-amino acid ester hydrolase {Xanthomonas citri [TaxId: 346]} Back     information, alignment and structure
>d1jjia_ c.69.1.2 (A:) Carboxylesterase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1vlqa_ c.69.1.25 (A:) Acetyl xylan esterase TM0077 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2dsta1 c.69.1.39 (A:2-123) Hypothetical protein TTHA1544 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1uxoa_ c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ufoa_ c.69.1.27 (A:) Hypothetical protein TT1662 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jjfa_ c.69.1.2 (A:) Feruloyl esterase domain of the cellulosomal xylanase z {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d2fuka1 c.69.1.36 (A:3-220) XC6422 protein {Xanthomonas campestris [TaxId: 339]} Back     information, alignment and structure
>d1pv1a_ c.69.1.34 (A:) Hypothetical esterase YJL068C {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ex9a_ c.69.1.18 (A:) Lipase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1lzla_ c.69.1.2 (A:) Heroin esterase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d2h7xa1 c.69.1.22 (A:9-291) Picromycin polyketide synthase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1jmkc_ c.69.1.22 (C:) Surfactin synthetase, SrfA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ju3a2 c.69.1.21 (A:5-351) Bacterial cocaine esterase N-terminal domain {Rhodococcus sp. mb1 [TaxId: 51612]} Back     information, alignment and structure
>d1fj2a_ c.69.1.14 (A:) Acyl protein thioesterase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wb4a1 c.69.1.2 (A:803-1075) Feruloyl esterase domain of the cellulosomal xylanase y {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d3c8da2 c.69.1.2 (A:151-396) Enterochelin esterase, catalytic domain {Shigella flexneri 2a str. 2457T [TaxId: 198215]} Back     information, alignment and structure
>d2b9va2 c.69.1.21 (A:50-434) Alpha-amino acid ester hydrolase {Acetobacter pasteurianus [TaxId: 438]} Back     information, alignment and structure
>d1mo2a_ c.69.1.22 (A:) Erythromycin polyketide synthase {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1jkma_ c.69.1.2 (A:) Carboxylesterase {Bacillus subtilis, brefeldin A esterase [TaxId: 1423]} Back     information, alignment and structure
>d2i3da1 c.69.1.36 (A:2-219) Hypothetical protein Atu1826 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1u4na_ c.69.1.2 (A:) Carboxylesterase {Alicyclobacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d2b61a1 c.69.1.40 (A:2-358) Homoserine O-acetyltransferase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1p0ia_ c.69.1.1 (A:) Butyryl cholinesterase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qfma2 c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1jfra_ c.69.1.16 (A:) Lipase {Streptomyces exfoliatus [TaxId: 1905]} Back     information, alignment and structure
>d1llfa_ c.69.1.17 (A:) Type-B carboxylesterase/lipase {Candida cylindracea, cholesterol esterase [TaxId: 44322]} Back     information, alignment and structure
>d1thga_ c.69.1.17 (A:) Type-B carboxylesterase/lipase {Fungus (Geotrichum candidum), ATCC 34614 [TaxId: 27317]} Back     information, alignment and structure
>d2pl5a1 c.69.1.40 (A:5-366) Homoserine O-acetyltransferase {Leptospira interrogans [TaxId: 173]} Back     information, alignment and structure
>d2vata1 c.69.1.40 (A:7-382) Acetyl-CoA:deacetylcephalosporin C acetyltransferase CefG {Acremonium chrysogenum [TaxId: 5044]} Back     information, alignment and structure
>d2ha2a1 c.69.1.1 (A:1-542) Acetylcholinesterase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qe3a_ c.69.1.1 (A:) Thermophilic para-nitrobenzyl esterase (PNB esterase) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2gzsa1 c.69.1.38 (A:41-305) Enterobactin and salmochelin hydrolase IroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1auoa_ c.69.1.14 (A:) Carboxylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1uwca_ c.69.1.17 (A:) Feruloyl esterase A {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1dina_ c.69.1.9 (A:) Dienelactone hydrolase {Pseudomonas sp., B13 [TaxId: 306]} Back     information, alignment and structure
>d1ukca_ c.69.1.17 (A:) Esterase EstA {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1lnsa3 c.69.1.21 (A:146-550) X-Prolyl dipeptidyl aminopeptidase PepX, middle domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1ivya_ c.69.1.5 (A:) Human 'protective protein', HPP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d81a1 c.69.1.37 (A:21-338) Polyhydroxybutyrate depolymerase {Penicillium funiculosum [TaxId: 28572]} Back     information, alignment and structure