Citrus Sinensis ID: 011921


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-----
MSWLNDVGKLINGLSLVAKEITKRSQALQTARTGDVETLISSSLKKALVSATEISGLTRGTVREFTNPKPKESIVYFNDSSDVAQSAPSTDKDGAVDQFAASVRDVSNDGGKLDGENEAKVLESSVEKESLVKEFESIDLGDRVDVDIEREATAKRRRPRERKVPSTPFSRLLGFAGLGAGLAWGTVQESTKRIMYGTPSSQDKQAAISPFLSDQNAERLAYALCRMRGAALKIGQMLSIQDESLVPAPILAALDIVRQGADVMPRWQLNQVLDAELGSDWQSKLTSFDYEPMAAASIGQVHRAVTKDGMQVAMKIQYPGVADSIESDIQNVKILLDYTNLIPKGLYLDSAMKVAREELSRECDYEMEAANQKRFRDVLSNAKGFYVPYVVDDTSSKRVLTTELVSGIPIDKVAQLSQETRNYVGKKLLELTLMELFVFRFMQRWLSFLPWIYILIEGRCSNLFPELNKGGRIQP
cccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHcccccccHHHHHHHHHHHHHcccHHHHHHHHHHccccccccHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHcccccccccccccHHHHHcEEcccccEEEEEEEcccHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHcccccEEEcccccccccccEEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHccccccccccccccccccccc
cccHHHHHHHHHHHHHHHHHHHHccccHHHHccccHHHHHHHHHHHHcEccHHccccccccEEEcccccccccEEEEEcccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccccHHHHHHcHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHccccccccHHHHHHHHHHHHHHcccEEEHcHHccccccccccHHHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHcccccEEEEEHHHHEEEEcccccEEEEEEEcccHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEcEEEEEcccccEEEEEEccccccccHHHHHHHcHHHHHHHHHHHHHHHHHHcccccccccccccccccEccccEEEEEEccccccccc
MSWLNDVGKLINGLSLVAKEITKRSQALQTARTGDVETLISSSLKKALVSATEisgltrgtvreftnpkpkesivyfndssdvaqsapstdkdgavDQFAASVRdvsndggkldgeNEAKVLESSVEKEslvkefesidlgdrvdvDIEREAtakrrrprerkvpstpfsrlLGFAGLGAglawgtvqestkrimygtpssqdkqaaispflsdQNAERLAYALCRMRGAALKIGQmlsiqdeslvpapiLAALDIVRQGadvmprwqLNQVLDAelgsdwqskltsfdyepmaaasIGQVHRAVTKDGMQVAMKIQYPGVADSIESDIQNVKILLDytnlipkglyLDSAMKVAREELSRECDYEMEAANQKRFRDVLSNakgfyvpyvvddtsskrvLTTELVsgipidkvaQLSQETRNYVGKKLLELTLMELFVFRFMQRWLSFLPWIYILIEGrcsnlfpelnkggriqp
mswlndvgKLINGLSLVAKEITKRSqalqtartgdvETLISSSLKKALVSateisgltrgtvreftnpkpKESIVYFNDSSDVAQSAPSTDKDGAVDQFAASVrdvsndggkldgeneakvlessvekeslvkefesidlgdrvdvdiereatakrrrprerkvpstpfsrllgFAGLGAGLAWGTVQESTKRIMYGTPSSQDKQAAISPFLSDQNAERLAYALCRMRGAALKIGQMLSIQDESLVPAPILAALDIVRQGADVMPRWQLNQVLDAELGSDWQSKLTSFDYEPMAAASIGQVHRAVTKDGMQVAMKIQYPGVADSIESDIQNVKILLDYTNLIPKGLYLDSAMKVAREELSRECDYEMEAANQKRFRDVLSNAKGFYVpyvvddtsskRVLTTElvsgipidkvaqlsqETRNYVGKKLLELTLMELFVFRFMQRWLSFLPWIYILIEGRCSnlfpelnkggriqp
MSWLNDVGKLINGLSLVAKEITKRSQALQTARTGDVETLISSSLKKALVSATEISGLTRGTVREFTNPKPKESIVYFNDSSDVAQSAPSTDKDGAVDQFAASVRDVSNDGGKLDGENEAkvlessvekeslvkeFESIDLGDRVDVDIEREATAKRRRPRERKVPSTPFSRllgfaglgaglaWGTVQESTKRIMYGTPSSQDKQAAISPFLSDQNAERLAYALCRMRGAALKIGQMLSIQDESLVPAPILAALDIVRQGADVMPRWQLNQVLDAELGSDWQSKLTSFDYEPMAAASIGQVHRAVTKDGMQVAMKIQYPGVADSIESDIQNVKILLDYTNLIPKGLYLDSAMKVAREELSRECDYEMEAANQKRFRDVLSNAKGFYVPYVVDDTSSKRVLTTELVSGIPIDKVAQLSQETRNYVGKKLLELTLMELFVFRFMQRWLSFLPWIYILIEGRCSNLFPELNKGGRIQP
**WLNDVGKLINGLSLVAKEITK************VETLI***LKKALVSATEISGLT**************************************************************************************************************FSRLLGFAGLGAGLAWGTVQESTKRIMY*******************NAERLAYALCRMRGAALKIGQMLSIQDESLVPAPILAALDIVRQGADVMPRWQLNQVLDAELGSDWQSKLTSFDYEPMAAASIGQVHRAVTKDGMQVAMKIQYPGVADSIESDIQNVKILLDYTNLIPKGLYLDSAMKVAREELSRECDYEMEAANQKRFRDVLSNAKGFYVPYVVDDTSSKRVLTTELVSGIPIDKVAQLSQETRNYVGKKLLELTLMELFVFRFMQRWLSFLPWIYILIEGRCSNLFP**********
*****DV*KLINGLSLVA*******************************************************************************************************************************************************SRLLGFAGLGAGLAWGTVQESTK**********************QNAERLAYALCRMRGAALKIGQMLSIQDESLVPAPILAALDIVRQGADVMPRWQLNQVLDAELGSDWQSKLTSFDYEPMAAASIGQVHRAVTKDGMQVAMKIQYPGVADSIESDIQNVKILLDYTNLIPKGLYLDSAMKVAREELSRECDYEMEAANQKRFRDVLSNAKGFYVPYVVDDTSSKRVLTTELVSGIPIDKVAQLSQETRNYVGKKLLELTLMELFVFRFMQRWLSFLPWIYILIEGRCSNLFPELNKGGRIQ*
MSWLNDVGKLINGLSLVAKEI***************ETLISSSLKKALVSATEISGLTRGTVREFTNPKPKESIVYFNDSS************GAVDQFAASVRDVSNDGGKLDGENEAKVLESSVEKESLVKEFESIDLGDRVDVDIEREAT************STPFSRLLGFAGLGAGLAWGTVQESTKRIMYGTPSSQDKQAAISPFLSDQNAERLAYALCRMRGAALKIGQMLSIQDESLVPAPILAALDIVRQGADVMPRWQLNQVLDAELGSDWQSKLTSFDYEPMAAASIGQVHRAVTKDGMQVAMKIQYPGVADSIESDIQNVKILLDYTNLIPKGLYLDSAMKVAREELSRECDYEMEAANQKRFRDVLSNAKGFYVPYVVDDTSSKRVLTTELVSGIPIDKVAQLSQETRNYVGKKLLELTLMELFVFRFMQRWLSFLPWIYILIEGRCSNLFPELNKGGRIQP
*SWLNDVGKLINGLSLVAKEITKRSQALQTARTGDVETLISSSLKKALVSATEISGLTRGTVREFTNPKPKESIVYFNDS*************************************************************DRVDVDIEREATAKRRRPRERKVPSTPFSRLLGFAGLGAGLAWGTVQESTKRIMYGTPSSQD**AAISPFLSDQNAERLAYALCRMRGAALKIGQMLSIQDESLVPAPILAALDIVRQGADVMPRWQLNQVLDAELGSDWQSKLTSFDYEPMAAASIGQVHRAVTKDGMQVAMKIQYPGVADSIESDIQNVKILLDYTNLIPKGLYLDSAMKVAREELSRECDYEMEAANQKRFRDVLSNAKGFYVPYVVDDTSSKRVLTTELVSGIPIDKVAQLSQETRNYVGKKLLELTLMELFVFRFMQRWLSFLPWIYILIEGRCSNLFPELNKGGRI**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSWLNDVGKLINGLSLVAKEITKRSQALQTARTGDVETLISSSLKKALVSATEISGLTRGTVREFTNPKPKESIVYFNDSSDVAQSAPSTDKDGAVDQFAASVRDVSNDGGKLDGENEAKVLESSVEKESLVKEFESIDLGDRVDVDIEREATAKRRRPRERKVPSTPFSRLLGFAGLGAGLAWGTVQESTKRIMYGTPSSQDKQAAISPFLSDQNAERLAYALCRMRGAALKIGQMLSIQDESLVPAPILAALDIVRQGADVMPRWQLNQVLDAELGSDWQSKLTSFDYEPMAAASIGQVHRAVTKDGMQVAMKIQYPGVADSIESDIQNVKILLDYTNLIPKGLYLDSAMKVAREELSRECDYEMEAANQKRFRDVLSNAKGFYVPYVVDDTSSKRVLTTELVSGIPIDKVAQLSQETRNYVGKKLLELTLMELFVFRFMQRWLSFLPWIYILIEGRCSNLFPELNKGGRIQP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query475 2.2.26 [Sep-21-2011]
Q60936 645 Chaperone activity of bc1 yes no 0.806 0.593 0.402 2e-77
Q8NI60 647 Chaperone activity of bc1 yes no 0.637 0.468 0.470 4e-76
Q29RI0 648 Chaperone activity of bc1 yes no 0.652 0.478 0.466 7e-76
Q5BJQ0 649 Chaperone activity of bc1 yes no 0.635 0.465 0.465 3e-75
Q18486 755 Ubiquinone biosynthesis p yes no 0.654 0.411 0.455 2e-74
Q6AY19 528 Uncharacterized aarF doma no no 0.608 0.547 0.498 3e-72
Q566J8 533 Uncharacterized aarF doma no no 0.637 0.568 0.476 5e-71
Q96D53 544 Uncharacterized aarF doma no no 0.637 0.556 0.466 1e-70
Q54IH6 565 Probable serine/threonine yes no 0.648 0.545 0.430 1e-65
Q5RGU1 602 Chaperone activity of bc1 no no 0.606 0.478 0.416 1e-64
>sp|Q60936|ADCK3_MOUSE Chaperone activity of bc1 complex-like, mitochondrial OS=Mus musculus GN=Adck3 PE=2 SV=2 Back     alignment and function desciption
 Score =  290 bits (741), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 167/415 (40%), Positives = 242/415 (58%), Gaps = 32/415 (7%)

Query: 64  EFTNPKPKESIVYFNDSSDVAQSAPSTDKDGAVDQFAAS--VRDVSNDG------GKLDG 115
           +F+ P+   + + F+ +S + QS   +   G    +A+S   R+    G      G+++G
Sbjct: 81  QFSTPQAAGTSLDFSAASSLDQSLSPSHSQGPAPAYASSGPFREAGLPGQATSPMGRVNG 140

Query: 116 ----ENEAKVLESSVEKESLVKEFESIDLGDRVDVDIEREATAKRR------------RP 159
               ++    L + +++ S  ++  S+  G     DIE+   AK R            R 
Sbjct: 141 RLFVDHRDLFLANGIQRRSFHQDQSSV--GGLTAEDIEKARQAKARPESKPHKQMLSERA 198

Query: 160 RERKVPSTPFSRLLGFAGLGAGLAWGTVQESTKRIMYGTPSSQDKQAAI--SPFLSDQNA 217
           RERKVP T   RL  F GL  GL  G + E  K+ +  + +S  K+A +  SPFLS+ NA
Sbjct: 199 RERKVPVTRIGRLANFGGLAVGLGIGALAEVAKKSLR-SENSTGKKAVLDSSPFLSEANA 257

Query: 218 ERLAYALCRMRGAALKIGQMLSIQDESLVPAPILAALDIVRQGADVMPRWQLNQVLDAEL 277
           ER+   LC++RGAALK+GQMLSIQD++ +   +    + VRQ AD MP  Q+ + L+++L
Sbjct: 258 ERIVSTLCKVRGAALKLGQMLSIQDDAFINPHLAKIFERVRQSADFMPLKQMTKTLNSDL 317

Query: 278 GSDWQSKLTSFDYEPMAAASIGQVHRAVTKDGMQVAMKIQYPGVADSIESDIQNVKILLD 337
           G  W+ KL  F+  P AAASIGQVH A  K G +VAMKIQYPGVA SI SD+ N+  +L+
Sbjct: 318 GPHWRDKLEYFEERPFAAASIGQVHLARMKGGREVAMKIQYPGVAQSINSDVNNLMAVLN 377

Query: 338 YTNLIPKGLYLDSAMKVAREELSRECDYEMEAANQKRFRDVLSNAKGFYVPYVVDDTSSK 397
            +N++P+GL+ +  + V R EL+ ECDY+ EAA  K+FR++L +   FYVP +VD+  S 
Sbjct: 378 MSNMLPEGLFPEHLIDVLRRELTLECDYQREAAYAKKFRELLKDHPFFYVPEIVDELCSP 437

Query: 398 RVLTTELVSGIPIDKVAQLSQETRNYVGKKLLELTLMELFVFRFMQ---RWLSFL 449
            VLTTEL+SG P+D+   LSQE RN +   +L L L ELF F  MQ    W +F 
Sbjct: 438 HVLTTELISGFPLDQAEGLSQEVRNEICYNILVLCLRELFEFHVMQTDPNWSNFF 492




May be a chaperone-like protein essential for the proper conformation and functioning of protein complexes in the respiratory chain.
Mus musculus (taxid: 10090)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: -
>sp|Q8NI60|ADCK3_HUMAN Chaperone activity of bc1 complex-like, mitochondrial OS=Homo sapiens GN=ADCK3 PE=1 SV=1 Back     alignment and function description
>sp|Q29RI0|ADCK3_BOVIN Chaperone activity of bc1 complex-like, mitochondrial OS=Bos taurus GN=ADCK3 PE=2 SV=1 Back     alignment and function description
>sp|Q5BJQ0|ADCK3_RAT Chaperone activity of bc1 complex-like, mitochondrial OS=Rattus norvegicus GN=Adck3 PE=2 SV=1 Back     alignment and function description
>sp|Q18486|COQ8_CAEEL Ubiquinone biosynthesis protein coq-8 OS=Caenorhabditis elegans GN=coq-8 PE=3 SV=2 Back     alignment and function description
>sp|Q6AY19|ADCK4_RAT Uncharacterized aarF domain-containing protein kinase 4 OS=Rattus norvegicus GN=Adck4 PE=2 SV=1 Back     alignment and function description
>sp|Q566J8|ADCK4_MOUSE Uncharacterized aarF domain-containing protein kinase 4 OS=Mus musculus GN=Adck4 PE=2 SV=1 Back     alignment and function description
>sp|Q96D53|ADCK4_HUMAN Uncharacterized aarF domain-containing protein kinase 4 OS=Homo sapiens GN=ADCK4 PE=1 SV=2 Back     alignment and function description
>sp|Q54IH6|ABKA_DICDI Probable serine/threonine-protein kinase abkA OS=Dictyostelium discoideum GN=abkA PE=3 SV=1 Back     alignment and function description
>sp|Q5RGU1|ADCK3_DANRE Chaperone activity of bc1 complex-like, mitochondrial OS=Danio rerio GN=adck3 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query475
255548205 620 Ubiquinone biosynthesis protein coq-8, p 0.909 0.696 0.652 1e-173
356501819 618 PREDICTED: chaperone activity of bc1 com 0.92 0.707 0.628 1e-158
225437742 583 PREDICTED: chaperone activity of bc1 com 0.871 0.710 0.677 1e-158
449487112 603 PREDICTED: chaperone activity of bc1 com 0.936 0.737 0.646 1e-154
449449246 603 PREDICTED: chaperone activity of bc1 com 0.936 0.737 0.646 1e-154
297814165 622 ABC1 protein [Arabidopsis lyrata subsp. 0.932 0.712 0.618 1e-150
15234260 623 ABC transporter 1 [Arabidopsis thaliana] 0.922 0.703 0.604 1e-149
3087737 623 ABC1 protein [Arabidopsis thaliana] 0.936 0.714 0.611 1e-149
356533503 611 PREDICTED: chaperone activity of bc1 com 0.903 0.702 0.606 1e-148
147800400 622 hypothetical protein VITISV_018909 [Viti 0.793 0.606 0.618 1e-143
>gi|255548205|ref|XP_002515159.1| Ubiquinone biosynthesis protein coq-8, putative [Ricinus communis] gi|223545639|gb|EEF47143.1| Ubiquinone biosynthesis protein coq-8, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  614 bits (1583), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 310/475 (65%), Positives = 373/475 (78%), Gaps = 43/475 (9%)

Query: 1   MSWLNDVGKLINGLSLVAKEITKRSQALQTARTGDVETLISSSLKKALVSATEISGLTRG 60
           M+   D+G+++NGLSLVAKE+ KRS++L  A TGD +TL +S+ KKA+VS T++SGLT+G
Sbjct: 1   MTSFKDIGRIVNGLSLVAKEVAKRSKSLDAAATGDFQTLFTSTAKKAIVSVTDLSGLTKG 60

Query: 61  TVREFTNPKPKESIVYFNDSSDVAQSAPSTDKDGAVDQFAASVRDVSNDGGKLDGENEAK 120
            VREFT PKPKES+V+F+ S DV + +P           ++S+  V N+       N AK
Sbjct: 61  NVREFTPPKPKESVVFFDHSDDVPEPSPVQ---------SSSINVVENN-------NTAK 104

Query: 121 VLESSVEKESLVKEFESIDLGDRVDV-DIEREAT----------------------AKRR 157
           + +++V +E ++ + ++I+   + +V D+E+E                         KRR
Sbjct: 105 I-DTAVVEEKVLYDHDNINQDSKDEVADLEKECEDRSNPGGEEMAAAAVAAAPMTEVKRR 163

Query: 158 RPRERKVPSTPFSRLLGFAGLGAGLAWGTVQESTKRIMYGTPSSQDKQAAISPFLSDQNA 217
           +PRER+VPSTPF+R LGFAGLGAGLAWGT QES +R++YG P+SQDKQ+A+SPFLS++NA
Sbjct: 164 KPRERRVPSTPFTRALGFAGLGAGLAWGTFQESARRLVYGAPNSQDKQSALSPFLSERNA 223

Query: 218 ERLAYALCRMRGAALKIGQMLSIQDESLVPAPILAALDIVRQGADVMPRWQLNQVLDAEL 277
           ERLA ALCRMRGAALK+GQMLSIQDESLVPAPILAALDIVRQGADVMPR QLNQVLDAEL
Sbjct: 224 ERLALALCRMRGAALKLGQMLSIQDESLVPAPILAALDIVRQGADVMPRSQLNQVLDAEL 283

Query: 278 GSDWQSKLTSFDYEPMAAASIGQVHRAVTKDGMQVAMKIQYPGVADSIESDIQNVKILLD 337
           G DW +KLTSFDYEP+AAASIGQVHRAVTKDGMQVAMKIQYPGVA+SI SD+ NVK+LLD
Sbjct: 284 GPDWSTKLTSFDYEPLAAASIGQVHRAVTKDGMQVAMKIQYPGVANSINSDVDNVKLLLD 343

Query: 338 YTNLIPKGLYLDSAMKVAREELSRECDYEMEAANQKRFRDVLSNAKGFYVPYVVDDTSSK 397
           YTNLIPKGL+LD AMKVA+EELSRECDYE+EA NQK+F  +LS  KGFYVP VVD  S  
Sbjct: 344 YTNLIPKGLFLDRAMKVAKEELSRECDYELEAINQKQFCKLLSGVKGFYVPMVVDKLSCN 403

Query: 398 RVLTTELVSGIPIDKVAQLSQETRNYVGKKLLELTLMELFVFRFMQ---RWLSFL 449
           RVLTTELVSGIPIDKVA L+QETRNYVG KLLELTLMELFVFRFMQ    W +FL
Sbjct: 404 RVLTTELVSGIPIDKVALLNQETRNYVGTKLLELTLMELFVFRFMQTDPNWSNFL 458




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|356501819|ref|XP_003519721.1| PREDICTED: chaperone activity of bc1 complex-like, mitochondrial-like [Glycine max] Back     alignment and taxonomy information
>gi|225437742|ref|XP_002273486.1| PREDICTED: chaperone activity of bc1 complex-like, mitochondrial [Vitis vinifera] gi|297744068|emb|CBI37038.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449487112|ref|XP_004157500.1| PREDICTED: chaperone activity of bc1 complex-like, mitochondrial-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449449246|ref|XP_004142376.1| PREDICTED: chaperone activity of bc1 complex-like, mitochondrial-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|297814165|ref|XP_002874966.1| ABC1 protein [Arabidopsis lyrata subsp. lyrata] gi|297320803|gb|EFH51225.1| ABC1 protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15234260|ref|NP_192075.1| ABC transporter 1 [Arabidopsis thaliana] gi|3859609|gb|AAC72875.1| Arabidopsis thaliana ABC1 protein (GB:AJ001158) [Arabidopsis thaliana] gi|7268209|emb|CAB77736.1| putative ABC transporter [Arabidopsis thaliana] gi|332656658|gb|AEE82058.1| ABC transporter 1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|3087737|emb|CAA04557.1| ABC1 protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356533503|ref|XP_003535303.1| PREDICTED: chaperone activity of bc1 complex-like, mitochondrial-like [Glycine max] Back     alignment and taxonomy information
>gi|147800400|emb|CAN70923.1| hypothetical protein VITISV_018909 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query475
TAIR|locus:2133357 623 ABC1 "AT4G01660" [Arabidopsis 0.943 0.719 0.585 2.2e-130
ZFIN|ZDB-GENE-060503-803 624 adck4 "aarF domain containing 0.694 0.528 0.451 1e-68
UNIPROTKB|F1NGM2 651 ADCK3 "Uncharacterized protein 0.804 0.586 0.400 1.8e-68
WB|WBGene00000767 755 coq-8 [Caenorhabditis elegans 0.652 0.410 0.440 2.6e-67
RGD|1311356 528 Adck4 "aarF domain containing 0.608 0.547 0.477 4.5e-66
UNIPROTKB|D4A760 533 Adck4 "Uncharacterized aarF do 0.614 0.547 0.474 3.2e-65
UNIPROTKB|J9NW80 486 ADCK4 "Uncharacterized protein 0.614 0.600 0.461 4.1e-65
MGI|MGI:1924139 533 Adck4 "aarF domain containing 0.614 0.547 0.471 4.1e-65
UNIPROTKB|Q96D53 544 ADCK4 "Uncharacterized aarF do 0.650 0.568 0.447 8.5e-65
UNIPROTKB|Q29RI0 648 ADCK3 "Chaperone activity of b 0.608 0.445 0.474 2.9e-64
TAIR|locus:2133357 ABC1 "AT4G01660" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1279 (455.3 bits), Expect = 2.2e-130, P = 2.2e-130
 Identities = 268/458 (58%), Positives = 331/458 (72%)

Query:     2 SWLNDVGKLINGLSLVAKEITKRSQALQTARTGDVETLISSSLKKALVSATEISGLTRGT 61
             SW     +L+NG+SLVAKEI  +S  LQ AR GD+E LI+SS KKALV+AT++ GLT G 
Sbjct:     3 SWSKSFTRLVNGVSLVAKEIYNQSPELQRARNGDLEGLITSSGKKALVAATDLVGLTSGK 62

Query:    62 VREFTNPKPKE-SIVYFN--DSSDVAQSAPSTDK-DGAVDQFAASVRDVSND-GGKLDGE 116
             +RE +  + KE S+VYF+  D+ D   + P     +    +     + + N+   ++   
Sbjct:    63 LRELSIRRSKEPSVVYFDEGDNKDNVVATPEVRSVNTKPSEKIVDSKVLRNEFSDEVKNS 122

Query:   117 NEAXXXXXXXXXXXXXXXFESIDLGDRVDVDIEREAT--AKRRRPRERKVPSTPFSRXXX 174
             N                   +++ G   +     E     KRRRPRERKVPSTP +R   
Sbjct:   123 NREGEIKVSGVEAGEIIGVRAVESGTVTEASSPSEVVPPVKRRRPRERKVPSTPMARAYG 182

Query:   175 XXXXXXXXXWGTVQESTKRIMYGTPSSQDKQAAISPFLSDQNAERLAYALCRMRGAALKI 234
                      WG V+EST R++ GTP + D Q A+S  +S +NAERLA  LC MRGAALK+
Sbjct:   183 FFNLGAALAWGAVKESTYRMVNGTPMTPDNQPALSSLMSKENAERLALGLCEMRGAALKV 242

Query:   235 GQMLSIQDESLVPAPILAALDIVRQGADVMPRWQLNQVLDAELGSDWQSKLTSFDYEPMA 294
             GQMLSIQDESLVPAPIL AL+ VRQGADVMPR QLN VLDAELGS+WQSKLTSFDYEP+A
Sbjct:   243 GQMLSIQDESLVPAPILNALEYVRQGADVMPRSQLNPVLDAELGSNWQSKLTSFDYEPLA 302

Query:   295 AASIGQVHRAVTKDGMQVAMKIQYPGVADSIESDIQNVKILLDYTNLIPKGLYLDSAMKV 354
             AASIGQVHRAVTKDG++VAMKIQYPGVA+SIESDI+NV+ LL+YTNLIPKGL+LD A+KV
Sbjct:   303 AASIGQVHRAVTKDGLEVAMKIQYPGVANSIESDIENVRRLLNYTNLIPKGLFLDRAIKV 362

Query:   355 AREELSRECDYEMEAANQKRFRDVLSNAKGFYVPYVVDDTSSKRVLTTELVSGIPIDKVA 414
             A+EEL++ECDYE+EA +QKRFRD+LS+  GFYVP VVD+TSSK++LTTEL+SGIPIDKVA
Sbjct:   363 AKEELAQECDYEIEAVSQKRFRDLLSDTPGFYVPLVVDETSSKKILTTELISGIPIDKVA 422

Query:   415 QLSQETRNYVGKKLLELTLMELFVFRFMQ---RWLSFL 449
              L Q+TR+YVG+K+LELTL ELFVFRFMQ    W +FL
Sbjct:   423 LLDQKTRDYVGRKMLELTLKELFVFRFMQTDPNWGNFL 460




GO:0005215 "transporter activity" evidence=ISS
GO:0005739 "mitochondrion" evidence=ISM
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
GO:0015996 "chlorophyll catabolic process" evidence=IMP
GO:0005746 "mitochondrial respiratory chain" evidence=IGI
GO:0017004 "cytochrome complex assembly" evidence=IGI
ZFIN|ZDB-GENE-060503-803 adck4 "aarF domain containing kinase 4" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1NGM2 ADCK3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
WB|WBGene00000767 coq-8 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
RGD|1311356 Adck4 "aarF domain containing kinase 4" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|D4A760 Adck4 "Uncharacterized aarF domain-containing protein kinase 4" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|J9NW80 ADCK4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:1924139 Adck4 "aarF domain containing kinase 4" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q96D53 ADCK4 "Uncharacterized aarF domain-containing protein kinase 4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q29RI0 ADCK3 "Chaperone activity of bc1 complex-like, mitochondrial" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00028218001
SubName- Full=Chromosome chr7 scaffold_42, whole genome shotgun sequence; (583 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00013978001
SubName- Full=Chromosome chr16 scaffold_10, whole genome shotgun sequence; (274 aa)
      0.644
GSVIVG00033429001
SubName- Full=Chromosome chr19 scaffold_66, whole genome shotgun sequence; (341 aa)
       0.455
GSVIVG00030753001
SubName- Full=Chromosome chr1 scaffold_5, whole genome shotgun sequence; (227 aa)
      0.443
GSVIVG00030213001
SubName- Full=Chromosome chr1 scaffold_5, whole genome shotgun sequence; (412 aa)
       0.416

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query475
COG0661 517 COG0661, AarF, Predicted unusual protein kinase [G 5e-55
pfam03109117 pfam03109, ABC1, ABC1 family 4e-43
TIGR01982 437 TIGR01982, UbiB, 2-polyprenylphenol 6-hydroxylase 9e-30
PRK04750 537 PRK04750, ubiB, putative ubiquinone biosynthesis p 9e-15
>gnl|CDD|223733 COG0661, AarF, Predicted unusual protein kinase [General function prediction only] Back     alignment and domain information
 Score =  191 bits (487), Expect = 5e-55
 Identities = 90/299 (30%), Positives = 137/299 (45%), Gaps = 24/299 (8%)

Query: 150 REATAKRRRPRERKVPSTPFSRLLGFAGLGAGLAWGTVQESTKRIMYGTPSSQDKQAAIS 209
           R     R R R          RLL   G  A L              G  S         
Sbjct: 9   RLPRIIRVRLRYL------LGRLLRLTGRLALL-------LRLLSWLG-KSKLASSEE-- 52

Query: 210 PFLSDQNAERLAYALCRMRGAALKIGQMLSIQDESLVPAPILAALDIVRQGADVMPRWQL 269
             L ++ AERL  AL  +    +K+GQ+LS + + LVP      L  ++      P  + 
Sbjct: 53  --LREKRAERLRLALEELGPTFIKLGQILSTRPD-LVPPEYAEELAKLQDRVPPFPFEEA 109

Query: 270 NQVLDAELGSDWQSKLTSFDYEPMAAASIGQVHRAVTKDGMQVAMKIQYPGVADSIESDI 329
            ++++ ELG   +   + F+ EP+A+ASI QVHRAV K G +VA+K+Q PG+ + IE+D+
Sbjct: 110 ERIIEEELGRPIEELFSEFEPEPIASASIAQVHRAVLKSGEEVAVKVQRPGIRERIEADL 169

Query: 330 QNVKILLDYTNLIPKGLYLDSAMKVARE---ELSRECDYEMEAANQKRFRDVLSNAKGFY 386
           + ++ L      +P G      ++V  E    L  E DY  EAAN +RFR+   +    Y
Sbjct: 170 KLLRRLARLIKRLPPGGRRLDLVEVVDEFEKRLREELDYRREAANAERFRENFKDDPDVY 229

Query: 387 VPYVVDDTSSKRVLTTELVSGIPIDKVAQLSQETRN--YVGKKLLELTLMELFVFRFMQ 443
           VP V  + +++RVLT E + GI I  +A L     +   + + L+   L +L    F  
Sbjct: 230 VPKVYWEYTTRRVLTMEWIDGIKISDIAALKSAGIDRKELAELLVRAFLRQLLRDGFFH 288


Length = 517

>gnl|CDD|111949 pfam03109, ABC1, ABC1 family Back     alignment and domain information
>gnl|CDD|233667 TIGR01982, UbiB, 2-polyprenylphenol 6-hydroxylase Back     alignment and domain information
>gnl|CDD|235310 PRK04750, ubiB, putative ubiquinone biosynthesis protein UbiB; Reviewed Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 475
COG0661 517 AarF Predicted unusual protein kinase [General fun 100.0
KOG1235 538 consensus Predicted unusual protein kinase [Genera 100.0
PRK04750 537 ubiB putative ubiquinone biosynthesis protein UbiB 100.0
TIGR01982 437 UbiB 2-polyprenylphenol 6-hydroxylase. This model 100.0
KOG1234 363 consensus ABC (ATP binding cassette) 1 protein [Ge 100.0
KOG1236 565 consensus Predicted unusual protein kinase [Genera 100.0
PF03109119 ABC1: ABC1 family; InterPro: IPR004147 This entry 99.98
cd05145190 RIO1_like RIO kinase family; RIO1, RIO3 and simila 99.75
cd05147190 RIO1_euk RIO kinase family; eukaryotic RIO1, catal 99.71
cd05119187 RIO RIO kinase family, catalytic domain. The RIO k 99.54
smart00090237 RIO RIO-like kinase. 99.51
cd05144198 RIO2_C RIO kinase family; RIO2, C-terminal catalyt 99.51
PRK14879211 serine/threonine protein kinase; Provisional 99.51
PF01163188 RIO1: RIO1 family; InterPro: IPR018934 Protein pho 99.46
PRK10359232 lipopolysaccharide core biosynthesis protein; Prov 99.46
KOG0595 429 consensus Serine/threonine-protein kinase involved 99.42
TIGR03724199 arch_bud32 Kae1-associated kinase Bud32. Members o 99.41
cd05146197 RIO3_euk RIO kinase family; eukaryotic RIO3, catal 99.39
COG1718268 RIO1 Serine/threonine protein kinase involved in c 99.32
KOG0574 502 consensus STE20-like serine/threonine kinase MST [ 99.3
KOG0581 364 consensus Mitogen-activated protein kinase kinase 99.27
PRK09188 365 serine/threonine protein kinase; Provisional 99.26
cd05151170 ChoK Choline Kinase (ChoK). The ChoK subfamily is 99.26
cd05085250 PTKc_Fer Catalytic domain of the Protein Tyrosine 99.24
PLN00034 353 mitogen-activated protein kinase kinase; Provision 99.23
cd05096 304 PTKc_DDR1 Catalytic domain of the Protein Tyrosine 99.22
cd05600 333 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- 99.21
cd05084252 PTKc_Fes Catalytic domain of the Protein Tyrosine 99.21
KOG0661 538 consensus MAPK related serine/threonine protein ki 99.2
KOG0605 550 consensus NDR and related serine/threonine kinases 99.19
KOG1163 341 consensus Casein kinase (serine/threonine/tyrosine 99.19
cd05593 328 STKc_PKB_gamma Catalytic domain of the Protein Ser 99.17
cd05571 323 STKc_PKB Catalytic domain of the Protein Serine/Th 99.17
cd05626 381 STKc_LATS2 Catalytic domain of the Protein Serine/ 99.16
PRK09605535 bifunctional UGMP family protein/serine/threonine 99.16
cd05591 321 STKc_nPKC_epsilon Catalytic domain of the Protein 99.15
cd05595 323 STKc_PKB_beta Catalytic domain of the Protein Seri 99.15
cd05594 325 STKc_PKB_alpha Catalytic domain of the Protein Ser 99.15
PTZ00263 329 protein kinase A catalytic subunit; Provisional 99.14
cd06629 272 STKc_MAPKKK_Bck1_like Catalytic domain of fungal B 99.14
cd05590 320 STKc_nPKC_eta Catalytic domain of the Protein Seri 99.14
cd05627 360 STKc_NDR2 Catalytic domain of the Protein Serine/T 99.13
cd05628 363 STKc_NDR1 Catalytic domain of the Protein Serine/T 99.13
cd05598 376 STKc_LATS Catalytic domain of the Protein Serine/T 99.13
cd05614 332 STKc_MSK2_N N-terminal catalytic domain of the Pro 99.12
cd05592 316 STKc_nPKC_theta_delta Catalytic domain of the Prot 99.12
KOG0192 362 consensus Tyrosine kinase specific for activated ( 99.12
cd05612 291 STKc_PRKX_like Catalytic domain of PRKX-like Prote 99.12
cd06657 292 STKc_PAK4 Catalytic domain of the Protein Serine/T 99.11
cd05573 350 STKc_ROCK_NDR_like Catalytic domain of ROCK- and N 99.11
cd05631 285 STKc_GRK4 Catalytic domain of the Protein Serine/T 99.11
cd05102 338 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi 99.11
cd05599 364 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel 99.11
cd05617 327 STKc_aPKC_zeta Catalytic domain of the Protein Ser 99.11
COG0478304 RIO-like serine/threonine protein kinase fused to 99.11
cd05584 323 STKc_p70S6K Catalytic domain of the Protein Serine 99.11
cd05588 329 STKc_aPKC Catalytic domain of the Protein Serine/T 99.1
cd05618 329 STKc_aPKC_iota Catalytic domain of the Protein Ser 99.1
cd05585 312 STKc_YPK1_like Catalytic domain of Yeast Protein K 99.1
cd06646267 STKc_MAP4K5 Catalytic domain of the Protein Serine 99.1
cd05604 325 STKc_SGK3 Catalytic domain of the Protein Serine/T 99.1
cd06917 277 STKc_NAK1_like Catalytic domain of Fungal Nak1-lik 99.09
cd05615 323 STKc_cPKC_alpha Catalytic domain of the Protein Se 99.08
cd05608 280 STKc_GRK1 Catalytic domain of the Protein Serine/T 99.08
KOG0615 475 consensus Serine/threonine protein kinase Chk2 and 99.08
cd05629 377 STKc_NDR_like_fungal Catalytic domain of Fungal Nu 99.08
cd06619 279 PKc_MKK5 Catalytic domain of the dual-specificity 99.08
cd05601 330 STKc_CRIK Catalytic domain of the Protein Serine/T 99.08
cd05616 323 STKc_cPKC_beta Catalytic domain of the Protein Ser 99.08
cd06635 317 STKc_TAO1 Catalytic domain of the Protein Serine/T 99.08
KOG0667 586 consensus Dual-specificity tyrosine-phosphorylatio 99.08
cd05112256 PTKc_Itk Catalytic domain of the Protein Tyrosine 99.08
cd05587 324 STKc_cPKC Catalytic domain of the Protein Serine/T 99.07
cd05602 325 STKc_SGK1 Catalytic domain of the Protein Serine/T 99.07
cd05624 331 STKc_MRCK_beta Catalytic domain of the Protein Ser 99.07
cd05625 382 STKc_LATS1 Catalytic domain of the Protein Serine/ 99.07
cd05575 323 STKc_SGK Catalytic domain of the Protein Serine/Th 99.07
cd05597 331 STKc_DMPK_like Catalytic domain of Myotonic Dystro 99.07
cd06649 331 PKc_MEK2 Catalytic domain of the dual-specificity 99.06
cd07878 343 STKc_p38beta_MAPK11 Catalytic domain of the Serine 99.06
cd06625263 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase 99.06
cd05603 321 STKc_SGK2 Catalytic domain of the Protein Serine/T 99.06
COG3642204 Mn2+-dependent serine/threonine protein kinase [Si 99.06
cd05586 330 STKc_Sck1_like Catalytic domain of Suppressor of l 99.06
cd05070260 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyros 99.06
cd05122253 PKc_STE Catalytic domain of STE family Protein Kin 99.06
KOG4250 732 consensus TANK binding protein kinase TBK1 [Signal 99.06
KOG1187 361 consensus Serine/threonine protein kinase [Signal 99.06
cd05114256 PTKc_Tec_Rlk Catalytic domain of the Protein Tyros 99.06
cd05589 324 STKc_PKN Catalytic domain of the Protein Serine/Th 99.06
cd00180215 PKc Catalytic domain of Protein Kinases. Protein K 99.05
cd06642 277 STKc_STK25-YSK1 Catalytic domain of the Protein Se 99.05
cd05620 316 STKc_nPKC_delta Catalytic domain of the Protein Se 99.05
cd07848 287 STKc_CDKL5 Catalytic domain of the Serine/Threonin 99.05
cd05104375 PTKc_Kit Catalytic domain of the Protein Tyrosine 99.04
cd06631 265 STKc_YSK4 Catalytic domain of the Protein Serine/T 99.04
cd05621 370 STKc_ROCK2 Catalytic domain of the Protein Serine/ 99.04
cd05034261 PTKc_Src_like Catalytic domain of Src kinase-like 99.04
cd05609 305 STKc_MAST Catalytic domain of the Protein Serine/T 99.04
KOG0600 560 consensus Cdc2-related protein kinase [Cell cycle 99.04
cd05120155 APH_ChoK_like Aminoglycoside 3'-phosphotransferase 99.03
cd06640 277 STKc_MST4 Catalytic domain of the Protein Serine/T 99.03
cd07869 303 STKc_PFTAIRE1 Catalytic domain of the Serine/Threo 99.03
cd05068261 PTKc_Frk_like Catalytic domain of Fyn-related kina 99.03
cd06641 277 STKc_MST3 Catalytic domain of the Protein Serine/T 99.02
cd05582 318 STKc_RSK_N N-terminal catalytic domain of the Prot 99.02
cd06656 297 STKc_PAK3 Catalytic domain of the Protein Serine/T 99.02
cd05069260 PTKc_Yes Catalytic domain of the Protein Tyrosine 99.02
cd05596 370 STKc_ROCK Catalytic domain of the Protein Serine/T 99.02
cd05049280 PTKc_Trk Catalytic domain of the Protein Tyrosine 99.02
cd05072261 PTKc_Lyn Catalytic domain of the Protein Tyrosine 99.01
cd05632 285 STKc_GRK5 Catalytic domain of the Protein Serine/T 99.01
cd05064266 PTKc_EphR_A10 Catalytic domain of the Protein Tyro 99.01
cd05607 277 STKc_GRK7 Catalytic domain of the Protein Serine/T 99.01
cd05605 285 STKc_GRK4_like Catalytic domain of G protein-coupl 99.01
cd07871 288 STKc_PCTAIRE3 Catalytic domain of the Serine/Threo 99.01
cd05041251 PTKc_Fes_like Catalytic domain of Fes-like Protein 99.01
cd05633 279 STKc_GRK3 Catalytic domain of the Protein Serine/T 99.01
cd05087 269 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein 99.0
cd05059256 PTKc_Tec_like Catalytic domain of Tec-like Protein 99.0
cd06650 333 PKc_MEK1 Catalytic domain of the dual-specificity 99.0
PTZ00426 340 cAMP-dependent protein kinase catalytic subunit; P 99.0
smart00219258 TyrKc Tyrosine kinase, catalytic domain. Phosphotr 99.0
cd05622 371 STKc_ROCK1 Catalytic domain of the Protein Serine/ 99.0
cd05570 318 STKc_PKC Catalytic domain of the Protein Serine/Th 99.0
KOG0583 370 consensus Serine/threonine protein kinase [Signal 99.0
cd07872 309 STKc_PCTAIRE2 Catalytic domain of the Serine/Threo 99.0
cd05606 278 STKc_beta_ARK Catalytic domain of the Protein Seri 98.99
cd05097 295 PTKc_DDR_like Catalytic domain of Discoidin Domain 98.99
cd05115257 PTKc_Zap-70 Catalytic domain of the Protein Tyrosi 98.99
cd07847 286 STKc_CDKL1_4 Catalytic domain of the Serine/Threon 98.99
cd00192262 PTKc Catalytic domain of Protein Tyrosine Kinases. 98.99
cd05033266 PTKc_EphR Catalytic domain of Ephrin Receptor Prot 98.99
cd05090283 PTKc_Ror1 Catalytic domain of the Protein Tyrosine 98.99
cd06637272 STKc_TNIK Catalytic domain of the Protein Serine/T 98.98
cd05067260 PTKc_Lck_Blk Catalytic domain of the Protein Tyros 98.98
cd05081 284 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of 98.98
cd06627254 STKc_Cdc7_like Catalytic domain of Cell division c 98.98
cd05610 669 STKc_MASTL Catalytic domain of the Protein Serine/ 98.98
cd06645267 STKc_MAP4K3 Catalytic domain of the Protein Serine 98.98
KOG0578 550 consensus p21-activated serine/threonine protein k 98.98
cd05063268 PTKc_EphR_A2 Catalytic domain of the Protein Tyros 98.98
cd08224267 STKc_Nek6_Nek7 Catalytic domain of the Protein Ser 98.97
cd05039256 PTKc_Csk_like Catalytic domain of C-terminal Src k 98.97
PRK12274218 serine/threonine protein kinase; Provisional 98.97
cd05061 288 PTKc_InsR Catalytic domain of the Protein Tyrosine 98.97
cd05623 332 STKc_MRCK_alpha Catalytic domain of the Protein Se 98.97
cd07859 338 STKc_TDY_MAPK_plant Catalytic domain of the Serine 98.97
cd06632258 STKc_MEKK1_plant Catalytic domain of the Protein S 98.97
cd05581 280 STKc_PDK1 Catalytic domain of the Protein Serine/T 98.97
cd05619 316 STKc_nPKC_theta Catalytic domain of the Protein Se 98.96
cd07874 355 STKc_JNK3 Catalytic domain of the Serine/Threonine 98.96
cd06654 296 STKc_PAK1 Catalytic domain of the Protein Serine/T 98.96
cd05080 283 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the 98.96
cd07876 359 STKc_JNK2 Catalytic domain of the Serine/Threonine 98.95
cd05040257 PTKc_Ack_like Catalytic domain of the Protein Tyro 98.95
cd06644 292 STKc_STK10_LOK Catalytic domain of the Protein Ser 98.95
cd05103 343 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosi 98.95
KOG4236 888 consensus Serine/threonine protein kinase PKC mu/P 98.95
PTZ00267 478 NIMA-related protein kinase; Provisional 98.95
cd06630 268 STKc_MEKK1 Catalytic domain of the Protein Serine/ 98.95
cd05088 303 PTKc_Tie2 Catalytic domain of the Protein Tyrosine 98.95
cd05071262 PTKc_Src Catalytic domain of the Protein Tyrosine 98.95
cd05579 265 STKc_MAST_like Catalytic domain of Microtubule-ass 98.95
cd06628267 STKc_MAPKKK_Byr2_like Catalytic domain of fungal B 98.94
PF00069260 Pkinase: Protein kinase domain Protein kinase; unc 98.94
KOG0193 678 consensus Serine/threonine protein kinase RAF [Sig 98.94
cd05113256 PTKc_Btk_Bmx Catalytic domain of the Protein Tyros 98.94
cd05109 279 PTKc_HER2 Catalytic domain of the Protein Tyrosine 98.93
cd05611 260 STKc_Rim15_like Catalytic domain of fungal Rim15-l 98.93
cd07880 343 STKc_p38gamma_MAPK12 Catalytic domain of the Serin 98.93
cd06611 280 STKc_SLK_like Catalytic domain of Ste20-like kinas 98.93
cd06638286 STKc_myosinIIIA Catalytic domain of the Protein Se 98.93
cd05036277 PTKc_ALK_LTK Catalytic domain of the Protein Tyros 98.93
cd05630 285 STKc_GRK6 Catalytic domain of the Protein Serine/T 98.93
cd05105 400 PTKc_PDGFR_alpha Catalytic domain of the Protein T 98.93
cd05580 290 STKc_PKA Catalytic domain of the Protein Serine/Th 98.92
cd06659 297 STKc_PAK6 Catalytic domain of the Protein Serine/T 98.92
cd08529256 STKc_FA2-like Catalytic domain of the Protein Seri 98.92
cd05077262 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of th 98.92
cd06658 292 STKc_PAK5 Catalytic domain of the Protein Serine/T 98.91
cd05062277 PTKc_IGF-1R Catalytic domain of the Protein Tyrosi 98.91
cd07862 290 STKc_CDK6 Catalytic domain of the Serine/Threonine 98.91
cd05079 284 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the 98.91
cd05075272 PTKc_Axl Catalytic domain of the Protein Tyrosine 98.91
cd06626 264 STKc_MEKK4 Catalytic domain of the Protein Serine/ 98.91
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 98.9
PTZ00283 496 serine/threonine protein kinase; Provisional 98.9
cd05066267 PTKc_EphR_A Catalytic domain of the Protein Tyrosi 98.9
cd06606260 STKc_MAPKKK Catalytic domain of the Protein Serine 98.9
PTZ00036 440 glycogen synthase kinase; Provisional 98.9
cd05042 269 PTKc_Aatyk Catalytic domain of the Protein Tyrosin 98.9
cd05076274 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of th 98.9
PF07714259 Pkinase_Tyr: Protein tyrosine kinase Protein kinas 98.9
smart00221225 STYKc Protein kinase; unclassified specificity. Ph 98.9
cd05108 316 PTKc_EGFR Catalytic domain of the Protein Tyrosine 98.9
cd05057 279 PTKc_EGFR_like Catalytic domain of Epidermal Growt 98.89
cd05038 284 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the P 98.89
cd06620 284 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr 98.89
cd05098 307 PTKc_FGFR1 Catalytic domain of the Protein Tyrosin 98.89
cd05035273 PTKc_Axl_like Catalytic Domain of Axl-like Protein 98.89
cd06643 282 STKc_SLK Catalytic domain of the Protein Serine/Th 98.89
cd08228267 STKc_Nek6 Catalytic domain of the Protein Serine/T 98.89
cd05073260 PTKc_Hck Catalytic domain of the Protein Tyrosine 98.89
PHA02988283 hypothetical protein; Provisional 98.89
cd05065 269 PTKc_EphR_B Catalytic domain of the Protein Tyrosi 98.89
cd05613 290 STKc_MSK1_N N-terminal catalytic domain of the Pro 98.89
cd05583 288 STKc_MSK_N N-terminal catalytic domain of the Prot 98.89
cd07875 364 STKc_JNK1 Catalytic domain of the Serine/Threonine 98.89
KOG0577 948 consensus Serine/threonine protein kinase [Signal 98.88
cd05148261 PTKc_Srm_Brk Catalytic domain of the Protein Tyros 98.88
cd07836 284 STKc_Pho85 Catalytic domain of the Serine/Threonin 98.88
cd05095 296 PTKc_DDR2 Catalytic domain of the Protein Tyrosine 98.88
cd05048283 PTKc_Ror Catalytic Domain of the Protein Tyrosine 98.88
cd05047270 PTKc_Tie Catalytic domain of Tie Protein Tyrosine 98.88
KOG0663 419 consensus Protein kinase PITSLRE and related kinas 98.88
cd08229267 STKc_Nek7 Catalytic domain of the Protein Serine/T 98.88
cd06623 264 PKc_MAPKK_plant_like Catalytic domain of Plant dua 98.87
KOG0597 808 consensus Serine-threonine protein kinase FUSED [G 98.87
cd07863 288 STKc_CDK4 Catalytic domain of the Serine/Threonine 98.87
cd05037259 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the 98.87
cd06624268 STKc_ASK Catalytic domain of the Protein Serine/Th 98.87
cd05577 277 STKc_GRK Catalytic domain of the Protein Serine/Th 98.87
cd05050288 PTKc_Musk Catalytic domain of the Protein Tyrosine 98.87
cd05101 304 PTKc_FGFR2 Catalytic domain of the Protein Tyrosin 98.87
cd07861 285 STKc_CDK1_euk Catalytic domain of the Serine/Threo 98.87
PHA03209 357 serine/threonine kinase US3; Provisional 98.87
cd06615 308 PKc_MEK Catalytic domain of the dual-specificity P 98.87
cd05083254 PTKc_Chk Catalytic domain of the Protein Tyrosine 98.87
cd06605 265 PKc_MAPKK Catalytic domain of the dual-specificity 98.86
cd07853 372 STKc_NLK Catalytic domain of the Serine/Threonine 98.86
cd06612256 STKc_MST1_2 Catalytic domain of the Protein Serine 98.86
cd07841 298 STKc_CDK7 Catalytic domain of the Serine/Threonine 98.86
cd06636282 STKc_MAP4K4_6 Catalytic domain of the Protein Seri 98.86
cd07868 317 STKc_CDK8 Catalytic domain of the Serine/Threonine 98.85
cd05052263 PTKc_Abl Catalytic domain of the Protein Tyrosine 98.85
cd07870 291 STKc_PFTAIRE2 Catalytic domain of the Serine/Threo 98.85
cd06648 285 STKc_PAK_II Catalytic domain of the Protein Serine 98.85
cd07832 286 STKc_CCRK Catalytic domain of the Serine/Threonine 98.85
cd06655 296 STKc_PAK2 Catalytic domain of the Protein Serine/T 98.85
cd05051 296 PTKc_DDR Catalytic domain of the Protein Tyrosine 98.85
cd06609 274 STKc_MST3_like Catalytic domain of Mammalian Ste20 98.85
KOG0593 396 consensus Predicted protein kinase KKIAMRE [Genera 98.85
cd07833 288 STKc_CDKL Catalytic domain of Cyclin-Dependent pro 98.85
cd05572 262 STKc_cGK_PKG Catalytic domain of the Protein Serin 98.85
cd05106374 PTKc_CSF-1R Catalytic domain of the Protein Tyrosi 98.84
cd07844 291 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like 98.84
cd06617 283 PKc_MKK3_6 Catalytic domain of the dual-specificit 98.84
KOG0575 592 consensus Polo-like serine/threonine protein kinas 98.84
cd07846 286 STKc_CDKL2_3 Catalytic domain of the Serine/Threon 98.84
cd07873 301 STKc_PCTAIRE1 Catalytic domain of the Serine/Threo 98.84
cd05116257 PTKc_Syk Catalytic domain of the Protein Tyrosine 98.84
cd05082256 PTKc_Csk Catalytic domain of the Protein Tyrosine 98.84
cd05574 316 STKc_phototropin_like Catalytic domain of Phototro 98.84
cd06608275 STKc_myosinIII_like Catalytic domain of Class III 98.84
cd06607 307 STKc_TAO Catalytic domain of the Protein Serine/Th 98.84
cd07860 284 STKc_CDK2_3 Catalytic domain of the Serine/Threoni 98.84
cd08223257 STKc_Nek4 Catalytic domain of the Protein Serine/T 98.83
cd06610 267 STKc_OSR1_SPAK Catalytic domain of the Protein Ser 98.83
cd06613262 STKc_MAP4K3_like Catalytic domain of Mitogen-activ 98.83
cd06621 287 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek 98.83
cd05054 337 PTKc_VEGFR Catalytic domain of the Protein Tyrosin 98.82
KOG0032 382 consensus Ca2+/calmodulin-dependent protein kinase 98.82
cd05032277 PTKc_InsR_like Catalytic domain of Insulin Recepto 98.82
cd06614 286 STKc_PAK Catalytic domain of the Protein Serine/Th 98.82
cd05045 290 PTKc_RET Catalytic domain of the Protein Tyrosine 98.82
cd06647 293 STKc_PAK_I Catalytic domain of the Protein Serine/ 98.82
cd05060257 PTKc_Syk_like Catalytic domain of Spleen Tyrosine 98.81
PRK10345210 hypothetical protein; Provisional 98.81
cd08219255 STKc_Nek3 Catalytic domain of the Protein Serine/T 98.81
cd05091283 PTKc_Ror2 Catalytic domain of the Protein Tyrosine 98.81
cd06639 291 STKc_myosinIIIB Catalytic domain of the Protein Se 98.81
KOG1164 322 consensus Casein kinase (serine/threonine/tyrosine 98.81
cd05578258 STKc_Yank1 Catalytic domain of the Protein Serine/ 98.81
cd06652265 STKc_MEKK2 Catalytic domain of the Protein Serine/ 98.81
cd06653264 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kina 98.8
PHA03212 391 serine/threonine kinase US3; Provisional 98.8
cd07867 317 STKc_CDC2L6 Catalytic domain of Serine/Threonine K 98.8
cd05053293 PTKc_FGFR Catalytic domain of the Protein Tyrosine 98.8
cd06633 313 STKc_TAO3 Catalytic domain of the Protein Serine/T 98.8
cd05094 291 PTKc_TrkC Catalytic domain of the Protein Tyrosine 98.8
cd05089 297 PTKc_Tie1 Catalytic domain of the Protein Tyrosine 98.79
cd05044269 PTKc_c-ros Catalytic domain of the Protein Tyrosin 98.79
cd05055302 PTKc_PDGFR Catalytic domain of the Protein Tyrosin 98.79
cd07850 353 STKc_JNK Catalytic domain of the Serine/Threonine 98.79
cd07879 342 STKc_p38delta_MAPK13 Catalytic domain of the Serin 98.79
cd06651266 STKc_MEKK3 Catalytic domain of the Protein Serine/ 98.79
smart00220244 S_TKc Serine/Threonine protein kinases, catalytic 98.79
cd05046275 PTK_CCK4 Pseudokinase domain of the Protein Tyrosi 98.79
PTZ00284 467 protein kinase; Provisional 98.79
KOG0197 468 consensus Tyrosine kinases [Signal transduction me 98.79
PHA03211 461 serine/threonine kinase US3; Provisional 98.78
PTZ00024 335 cyclin-dependent protein kinase; Provisional 98.78
cd07840 287 STKc_CDK9_like Catalytic domain of Cyclin-Dependen 98.78
cd05056 270 PTKc_FAK Catalytic domain of the Protein Tyrosine 98.78
cd05123250 STKc_AGC Catalytic domain of AGC family Protein Se 98.77
cd07864 302 STKc_CDK12 Catalytic domain of the Serine/Threonin 98.77
cd08220256 STKc_Nek8 Catalytic domain of the Protein Serine/T 98.76
cd05099 314 PTKc_FGFR4 Catalytic domain of the Protein Tyrosin 98.76
cd06622 286 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS 98.76
cd05093 288 PTKc_TrkB Catalytic domain of the Protein Tyrosine 98.76
KOG0592 604 consensus 3-phosphoinositide-dependent protein kin 98.76
cd05100 334 PTKc_FGFR3 Catalytic domain of the Protein Tyrosin 98.76
KOG0198 313 consensus MEKK and related serine/threonine protei 98.75
PLN00009 294 cyclin-dependent kinase A; Provisional 98.75
KOG0616 355 consensus cAMP-dependent protein kinase catalytic 98.74
cd08221256 STKc_Nek9 Catalytic domain of the Protein Serine/T 98.74
cd07845 309 STKc_CDK10 Catalytic domain of the Serine/Threonin 98.74
cd07839 284 STKc_CDK5 Catalytic domain of the Serine/Threonine 98.74
KOG0594 323 consensus Protein kinase PCTAIRE and related kinas 98.74
cd07831 282 STKc_MOK Catalytic domain of the Serine/Threonine 98.73
PHA03207 392 serine/threonine kinase US3; Provisional 98.73
cd08217265 STKc_Nek2 Catalytic domain of the Protein Serine/T 98.73
KOG0610 459 consensus Putative serine/threonine protein kinase 98.73
cd05058 262 PTKc_Met_Ron Catalytic domain of the Protein Tyros 98.73
KOG1166 974 consensus Mitotic checkpoint serine/threonine prot 98.73
cd07877 345 STKc_p38alpha_MAPK14 Catalytic domain of the Serin 98.73
cd06634 308 STKc_TAO2 Catalytic domain of the Protein Serine/T 98.72
cd07837 295 STKc_CdkB_plant Catalytic domain of the Serine/Thr 98.72
cd07835 283 STKc_CDK1_like Catalytic domain of Cyclin-Dependen 98.72
cd05107401 PTKc_PDGFR_beta Catalytic domain of the Protein Ty 98.72
cd05074273 PTKc_Tyro3 Catalytic domain of the Protein Tyrosin 98.71
cd07843 293 STKc_CDC2L1 Catalytic domain of the Serine/Threoni 98.71
PHA03390267 pk1 serine/threonine-protein kinase 1; Provisional 98.71
cd05086 268 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosi 98.71
PLN03225 566 Serine/threonine-protein kinase SNT7; Provisional 98.71
cd08225257 STKc_Nek5 Catalytic domain of the Protein Serine/T 98.7
cd08215258 STKc_Nek Catalytic domain of the Protein Serine/Th 98.7
cd05092280 PTKc_TrkA Catalytic domain of the Protein Tyrosine 98.7
cd05111 279 PTK_HER3 Pseudokinase domain of the Protein Tyrosi 98.7
PRK01723239 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed 98.69
cd05078258 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain 98.69
cd07854 342 STKc_MAPK4_6 Catalytic domain of the Serine/Threon 98.69
KOG1095 1025 consensus Protein tyrosine kinase [Signal transduc 98.69
PF06176229 WaaY: Lipopolysaccharide core biosynthesis protein 98.69
KOG0658 364 consensus Glycogen synthase kinase-3 [Carbohydrate 98.68
cd05154223 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 an 98.68
KOG0660 359 consensus Mitogen-activated protein kinase [Signal 98.68
cd07866 311 STKc_BUR1 Catalytic domain of the Serine/Threonine 98.68
cd05110 303 PTKc_HER4 Catalytic domain of the Protein Tyrosine 98.68
KOG0659 318 consensus Cdk activating kinase (CAK)/RNA polymera 98.68
cd07851 343 STKc_p38 Catalytic domain of the Serine/Threonine 98.67
cd08528269 STKc_Nek10 Catalytic domain of the Protein Serine/ 98.67
cd07830 283 STKc_MAK_like Catalytic domain of Male germ cell-A 98.66
cd08218256 STKc_Nek1 Catalytic domain of the Protein Serine/T 98.66
cd07865 310 STKc_CDK9 Catalytic domain of the Serine/Threonine 98.66
cd05043 280 PTK_Ryk Pseudokinase domain of Ryk (Receptor relat 98.66
cd07857 332 STKc_MPK1 Catalytic domain of the Serine/Threonine 98.65
KOG0587 953 consensus Traf2- and Nck-interacting kinase and re 98.64
cd07838 287 STKc_CDK4_6_like Catalytic domain of Cyclin-Depend 98.64
cd08227 327 PK_STRAD_alpha Pseudokinase domain of STE20-relate 98.63
cd07858 337 STKc_TEY_MAPK_plant Catalytic domain of the Serine 98.63
PLN03224 507 probable serine/threonine protein kinase; Provisio 98.62
KOG0582 516 consensus Ste20-like serine/threonine protein kina 98.62
KOG0196 996 consensus Tyrosine kinase, EPH (ephrin) receptor f 98.62
cd08222260 STKc_Nek11 Catalytic domain of the Protein Serine/ 98.61
cd05118 283 STKc_CMGC Catalytic domain of CMGC family Serine/T 98.61
cd07856 328 STKc_Sty1_Hog1 Catalytic domain of the Serine/Thre 98.61
KOG0611 668 consensus Predicted serine/threonine protein kinas 98.6
cd07842 316 STKc_CDK8_like Catalytic domain of Cyclin-Dependen 98.6
cd07852 337 STKc_MAPK15 Catalytic domain of the Serine/Threoni 98.59
KOG0194 474 consensus Protein tyrosine kinase [Signal transduc 98.59
cd08530256 STKc_CNK2-like Catalytic domain of the Protein Ser 98.59
KOG0585 576 consensus Ca2+/calmodulin-dependent protein kinase 98.59
cd07855 334 STKc_ERK5 Catalytic domain of the Serine/Threonine 98.58
cd07849 336 STKc_ERK1_2_like Catalytic domain of Extracellular 98.58
cd05576237 STKc_RPK118_like Catalytic domain of the Protein S 98.57
cd07834 330 STKc_MAPK Catalytic domain of the Serine/Threonine 98.57
KOG0598 357 consensus Ribosomal protein S6 kinase and related 98.57
KOG0199 1039 consensus ACK and related non-receptor tyrosine ki 98.56
PHA02882 294 putative serine/threonine kinase; Provisional 98.56
cd07829 282 STKc_CDK_like Catalytic domain of Cyclin-Dependent 98.55
cd06616 288 PKc_MKK4 Catalytic domain of the dual-specificity 98.55
cd08226 328 PK_STRAD_beta Pseudokinase domain of STE20-related 98.55
KOG3087229 consensus Serine/threonine protein kinase [General 98.55
KOG2270 520 consensus Serine/threonine protein kinase involved 98.54
PTZ00266 1021 NIMA-related protein kinase; Provisional 98.53
cd06618 296 PKc_MKK7 Catalytic domain of the dual-specificity 98.51
KOG0201 467 consensus Serine/threonine protein kinase [Signal 98.51
cd08216 314 PK_STRAD Pseudokinase domain of STE20-related kina 98.51
KOG0608 1034 consensus Warts/lats-like serine threonine kinases 98.49
KOG1167 418 consensus Serine/threonine protein kinase of the C 98.48
KOG0591 375 consensus NIMA (never in mitosis)-related G2-speci 98.47
KOG1165 449 consensus Casein kinase (serine/threonine/tyrosine 98.47
KOG1989 738 consensus ARK protein kinase family [Signal transd 98.46
KOG0694 694 consensus Serine/threonine protein kinase [Signal 98.46
PHA03210 501 serine/threonine kinase US3; Provisional 98.43
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 98.39
KOG1094 807 consensus Discoidin domain receptor DDR1 [Signal t 98.36
KOG3653 534 consensus Transforming growth factor beta/activin 98.33
PRK15123268 lipopolysaccharide core heptose(I) kinase RfaP; Pr 98.31
KOG0588 786 consensus Serine/threonine protein kinase [Cell cy 98.29
KOG0612 1317 consensus Rho-associated, coiled-coil containing p 98.27
KOG2268 465 consensus Serine/threonine protein kinase [Signal 98.23
KOG4721 904 consensus Serine/threonine protein kinase, contain 98.22
KOG0589 426 consensus Serine/threonine protein kinase [General 98.18
PF06293206 Kdo: Lipopolysaccharide kinase (Kdo/WaaP) family; 98.17
PRK10593 297 hypothetical protein; Provisional 98.15
KOG4645 1509 consensus MAPKKK (MAP kinase kinase kinase) SSK2 a 98.08
KOG1026 774 consensus Nerve growth factor receptor TRKA and re 98.06
KOG0664 449 consensus Nemo-like MAPK-related serine/threonine 98.05
TIGR02172226 Fb_sc_TIGR02172 Fibrobacter succinogenes paralogou 98.05
KOG0576 829 consensus Mitogen-activated protein kinase kinase 98.03
KOG0670 752 consensus U4/U6-associated splicing factor PRP4 [R 98.03
KOG0983 391 consensus Mitogen-activated protein kinase (MAPK) 98.02
KOG0668 338 consensus Casein kinase II, alpha subunit [Signal 98.0
KOG0596 677 consensus Dual specificity; serine/threonine and t 97.95
KOG1035 1351 consensus eIF-2alpha kinase GCN2 [Translation, rib 97.94
KOG0580281 consensus Serine/threonine protein kinase [Cell cy 97.93
KOG1006 361 consensus Mitogen-activated protein kinase (MAPK) 97.92
COG0515 384 SPS1 Serine/threonine protein kinase [General func 97.91
KOG1027 903 consensus Serine/threonine protein kinase and endo 97.91
COG2112201 Predicted Ser/Thr protein kinase [Signal transduct 97.9
KOG1025 1177 consensus Epidermal growth factor receptor EGFR an 97.88
KOG0579 1187 consensus Ste20-like serine/threonine protein kina 97.87
TIGR02721 256 ycfN_thiK thiamine kinase. Members of this family 97.85
KOG0586 596 consensus Serine/threonine protein kinase [General 97.81
cd05150244 APH Aminoglycoside 3'-phosphotransferase (APH). Th 97.8
KOG0984282 consensus Mitogen-activated protein kinase (MAPK) 97.75
KOG4279 1226 consensus Serine/threonine protein kinase [Signal 97.74
KOG4257 974 consensus Focal adhesion tyrosine kinase FAK, cont 97.73
PRK05231 319 homoserine kinase; Provisional 97.73
KOG4717 864 consensus Serine/threonine protein kinase [Signal 97.72
KOG0603 612 consensus Ribosomal protein S6 kinase [Signal tran 97.69
KOG0599 411 consensus Phosphorylase kinase gamma subunit [Carb 97.65
KOG1151 775 consensus Tousled-like protein kinase [Signal tran 97.65
KOG0662 292 consensus Cyclin-dependent kinase CDK5 [Intracellu 97.56
cd05157235 ETNK_euk Ethanolamine kinase (ETNK) in eukaryotes. 97.53
KOG0671 415 consensus LAMMER dual specificity kinases [Signal 97.53
cd05155235 APH_ChoK_like_1 Uncharacterized bacterial proteins 97.5
KOG0200 609 consensus Fibroblast/platelet-derived growth facto 97.49
KOG0607 463 consensus MAP kinase-interacting kinase and relate 97.46
KOG0604 400 consensus MAP kinase-activated protein kinase 2 [S 97.41
cd05153 296 HomoserineK_II Homoserine Kinase, type II. Homoser 97.39
KOG1152772 consensus Signal transduction serine/threonine kin 97.37
KOG4278 1157 consensus Protein tyrosine kinase [Signal transduc 97.28
KOG0669 376 consensus Cyclin T-dependent kinase CDK9 [Cell cyc 97.26
KOG2052 513 consensus Activin A type IB receptor, serine/threo 97.2
KOG0696 683 consensus Serine/threonine protein kinase [Signal 97.03
KOG0666 438 consensus Cyclin C-dependent kinase CDK8 [Transcri 97.01
PF03881 288 Fructosamin_kin: Fructosamine kinase; InterPro: IP 96.97
KOG0033 355 consensus Ca2+/calmodulin-dependent protein kinase 96.94
PF01636239 APH: Phosphotransferase enzyme family This family 96.93
PRK09550 401 mtnK methylthioribose kinase; Reviewed 96.91
PRK06148 1013 hypothetical protein; Provisional 96.91
TIGR00938307 thrB_alt homoserine kinase, Neisseria type. Homose 96.85
PRK09902216 hypothetical protein; Provisional 96.66
KOG1345 378 consensus Serine/threonine kinase [Signal transduc 96.66
KOG0690 516 consensus Serine/threonine protein kinase [Signal 96.63
PLN02236 344 choline kinase 96.53
KOG1290 590 consensus Serine/threonine protein kinase [Signal 96.48
PLN00181 793 protein SPA1-RELATED; Provisional 96.38
KOG0614 732 consensus cGMP-dependent protein kinase [Signal tr 96.33
KOG0695 593 consensus Serine/threonine protein kinase [Signal 96.31
KOG0584 632 consensus Serine/threonine protein kinase [General 96.29
KOG2345 302 consensus Serine/threonine protein kinase/TGF-beta 96.25
PF14531288 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_ 96.24
PLN02756 418 S-methyl-5-thioribose kinase 96.22
PRK06149 972 hypothetical protein; Provisional 96.21
PLN02876 822 acyl-CoA dehydrogenase 96.14
KOG0665 369 consensus Jun-N-terminal kinase (JNK) [Signal tran 95.93
KOG2269531 consensus Serine/threonine protein kinase [Signal 95.87
PRK11768 325 serine/threonine protein kinase; Provisional 95.82
COG2334 331 Putative homoserine kinase type II (protein kinase 95.04
TIGR01767 370 MTRK 5-methylthioribose kinase. This enzyme is inv 94.73
PF10707199 YrbL-PhoP_reg: PhoP regulatory network protein Yrb 94.73
KOG0986 591 consensus G protein-coupled receptor kinase [Signa 94.65
PLN02421 330 phosphotransferase, alcohol group as acceptor/kina 94.6
cd05152 276 MPH2' Macrolide 2'-Phosphotransferase (MPH2'). MPH 93.56
PF12260188 PIP49_C: Protein-kinase domain of FAM69; InterPro: 93.49
COG3001 286 Uncharacterized protein conserved in bacteria [Fun 93.2
TIGR02906313 spore_CotS spore coat protein, CotS family. Member 93.19
cd05156 302 ChoK_euk Choline Kinase (ChoK) in eukaryotes. The 92.88
PTZ00384 383 choline kinase; Provisional 92.57
COG3173321 Predicted aminoglycoside phosphotransferase [Gener 90.97
KOG0590 601 consensus Checkpoint kinase and related serine/thr 90.88
PRK12396 409 5-methylribose kinase; Reviewed 90.16
PF13095207 FTA2: Kinetochore Sim4 complex subunit FTA2 89.72
PF07914 414 DUF1679: Protein of unknown function (DUF1679); In 89.1
PF04655253 APH_6_hur: Aminoglycoside/hydroxyurea antibiotic r 88.31
PF01633211 Choline_kinase: Choline/ethanolamine kinase; Inter 86.35
KOG4158 598 consensus BRPK/PTEN-induced protein kinase [Signal 85.22
PTZ00296 442 choline kinase; Provisional 83.56
KOG1240 1431 consensus Protein kinase containing WD40 repeats [ 81.27
COG5072 488 ALK1 Serine/threonine kinase of the haspin family 80.22
>COG0661 AarF Predicted unusual protein kinase [General function prediction only] Back     alignment and domain information
Probab=100.00  E-value=6.2e-69  Score=575.14  Aligned_cols=259  Identities=33%  Similarity=0.477  Sum_probs=248.6

Q ss_pred             CcHHHHHHHHHHHHhcCchHHHHHHHHhcCCCCCCcHHHHHHHHHhhcCCCCCChHhHHHHHHHHhCCChHhhccccCcc
Q 011921          212 LSDQNAERLAYALCRMRGAALKIGQMLSIQDESLVPAPILAALDIVRQGADVMPRWQLNQVLDAELGSDWQSKLTSFDYE  291 (475)
Q Consensus       212 ~~~~~a~rl~~~L~~LGg~~IKlGQ~LStr~~dllP~e~~~~L~~Lqd~app~p~~~v~~vle~eLG~~~~e~F~~fd~~  291 (475)
                      ...+.+++|+.+|++|||+|||+||+||||+ |++|++|+++|++|||++||+|+++++++|+++||.+|+++|++||++
T Consensus        53 ~~~~~~~rL~~~L~~LGPtfIK~GQ~LStR~-Dl~p~e~~~eL~~LQD~vpp~~~~~~~~iie~eLG~~iee~F~eF~~~  131 (517)
T COG0661          53 LREKRAERLRLALEELGPTFIKLGQILSTRP-DLVPPEYAEELAKLQDRVPPFPFEEAERIIEEELGRPIEELFSEFEPE  131 (517)
T ss_pred             HhHhHHHHHHHHHHHhCCchhhhhhHHhcCc-cccCHHHHHHHHHhhcCCCCCCHHHHHHHHHHHhCCCHHHHHHHcCCC
Confidence            4567899999999999999999999999998 999999999999999999999999999999999999999999999999


Q ss_pred             cccccccceEEEeeecCCCEEEEEEecCCcccchhhHHHHHHHHHHHhccccCc---cCHHHHHHHHHHHhHHHhhHHHH
Q 011921          292 PMAAASIGQVHRAVTKDGMQVAMKIQYPGVADSIESDIQNVKILLDYTNLIPKG---LYLDSAMKVAREELSRECDYEME  368 (475)
Q Consensus       292 PIAaASIGQVHrA~L~dG~~VAVKVqrPgI~~~i~~DL~~l~~l~~~~~~~p~~---~~l~~iv~e~~~~L~~ELDf~~E  368 (475)
                      |||||||||||+|++++|++||||||||||++.|..||.+|++++++++.++++   +++.++++|+.+.|..||||++|
T Consensus       132 PiAsASIaQVH~A~L~sG~~VAVKVqrPgi~~~i~~DL~il~~~a~~~~~~~~~~~~l~~~~vv~e~~~~l~~ElDy~~E  211 (517)
T COG0661         132 PIASASIAQVHRAVLKSGEEVAVKVQRPGIRERIEADLKLLRRLARLIKRLPPGGRRLDLVEVVDEFEKRLREELDYRRE  211 (517)
T ss_pred             chhhhhHhhheeEEecCCCEEEEEecCCChHHHHHHHHHHHHHHHHHHHHcCCccccCChHHHHHHHHHHHHHHhCHHHH
Confidence            999999999999999999999999999999999999999999999999987776   78999999999999999999999


Q ss_pred             HHHHHHHHHhhcCCCCeeeceeecCCCCCceEEeecccCCCchhhhccCHH--HHHHHHHHHHHHHHHHHHHCCcccC--
Q 011921          369 AANQKRFRDVLSNAKGFYVPYVVDDTSSKRVLTTELVSGIPIDKVAQLSQE--TRNYVGKKLLELTLMELFVFRFMQR--  444 (475)
Q Consensus       369 A~N~~rf~~~~~~~~~V~VP~Vy~elst~rVLVMEyIeG~~L~d~~~l~~~--~r~~ia~~ll~~~L~~lf~~G~~H~--  444 (475)
                      |+|+++|+++|++++.++||+|||+||+++||||||++|++++|+..+...  +++.++..++++|++|+|++||||+  
T Consensus       212 A~n~~~~~~nf~~~~~v~VP~V~we~t~~~VLtmE~i~Gi~i~d~~~l~~~g~d~k~ia~~~~~~f~~q~~~dgffHaDp  291 (517)
T COG0661         212 AANAERFRENFKDDPDVYVPKVYWEYTTRRVLTMEWIDGIKISDIAALKSAGIDRKELAELLVRAFLRQLLRDGFFHADP  291 (517)
T ss_pred             HHHHHHHHHHcCCCCCeEeceeehhccCCcEEEEEeeCCEecccHHHHHhcCCCHHHHHHHHHHHHHHHHHhcCccccCC
Confidence            999999999999999999999999999999999999999999999876554  5779999999999999999999999  


Q ss_pred             -Ccccccc----cceEEecccccCCcccccCC
Q 011921          445 -WLSFLPW----IYILIEGRCSNLFPELNKGG  471 (475)
Q Consensus       445 -PGNILl~----l~LiDFG~~~~l~pe~~~~~  471 (475)
                       ||||+++    ++++|||++..++++++..+
T Consensus       292 HpGNi~v~~~g~i~~lDfGi~g~l~~~~r~~l  323 (517)
T COG0661         292 HPGNILVRSDGRIVLLDFGIVGRLDPKFRRYL  323 (517)
T ss_pred             CccceEEecCCcEEEEcCcceecCCHHHHHHH
Confidence             9999998    89999999999999987654



>KOG1235 consensus Predicted unusual protein kinase [General function prediction only] Back     alignment and domain information
>PRK04750 ubiB putative ubiquinone biosynthesis protein UbiB; Reviewed Back     alignment and domain information
>TIGR01982 UbiB 2-polyprenylphenol 6-hydroxylase Back     alignment and domain information
>KOG1234 consensus ABC (ATP binding cassette) 1 protein [General function prediction only] Back     alignment and domain information
>KOG1236 consensus Predicted unusual protein kinase [General function prediction only] Back     alignment and domain information
>PF03109 ABC1: ABC1 family; InterPro: IPR004147 This entry includes ABC1 from yeast [] and AarF from Escherichia coli [] Back     alignment and domain information
>cd05145 RIO1_like RIO kinase family; RIO1, RIO3 and similar proteins, catalytic domain Back     alignment and domain information
>cd05147 RIO1_euk RIO kinase family; eukaryotic RIO1, catalytic domain Back     alignment and domain information
>cd05119 RIO RIO kinase family, catalytic domain Back     alignment and domain information
>smart00090 RIO RIO-like kinase Back     alignment and domain information
>cd05144 RIO2_C RIO kinase family; RIO2, C-terminal catalytic domain Back     alignment and domain information
>PRK14879 serine/threonine protein kinase; Provisional Back     alignment and domain information
>PF01163 RIO1: RIO1 family; InterPro: IPR018934 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>PRK10359 lipopolysaccharide core biosynthesis protein; Provisional Back     alignment and domain information
>KOG0595 consensus Serine/threonine-protein kinase involved in autophagy [Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>TIGR03724 arch_bud32 Kae1-associated kinase Bud32 Back     alignment and domain information
>cd05146 RIO3_euk RIO kinase family; eukaryotic RIO3, catalytic domain Back     alignment and domain information
>COG1718 RIO1 Serine/threonine protein kinase involved in cell cycle control [Signal transduction mechanisms / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0574 consensus STE20-like serine/threonine kinase MST [Signal transduction mechanisms] Back     alignment and domain information
>KOG0581 consensus Mitogen-activated protein kinase kinase (MAP2K) [Signal transduction mechanisms] Back     alignment and domain information
>PRK09188 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd05151 ChoK Choline Kinase (ChoK) Back     alignment and domain information
>cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>PLN00034 mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information
>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>KOG0661 consensus MAPK related serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0605 consensus NDR and related serine/threonine kinases [General function prediction only] Back     alignment and domain information
>KOG1163 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>PRK09605 bifunctional UGMP family protein/serine/threonine protein kinase; Validated Back     alignment and domain information
>cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>PTZ00263 protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>KOG0192 consensus Tyrosine kinase specific for activated (GTP-bound) p21cdc42Hs [Signal transduction mechanisms] Back     alignment and domain information
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>COG0478 RIO-like serine/threonine protein kinase fused to N-terminal HTH domain [Signal transduction mechanisms] Back     alignment and domain information
>cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>KOG0615 consensus Serine/threonine protein kinase Chk2 and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 Back     alignment and domain information
>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>KOG0667 consensus Dual-specificity tyrosine-phosphorylation regulated kinase [General function prediction only] Back     alignment and domain information
>cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>COG3642 Mn2+-dependent serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>cd05122 PKc_STE Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>KOG4250 consensus TANK binding protein kinase TBK1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG1187 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>cd00180 PKc Catalytic domain of Protein Kinases Back     alignment and domain information
>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit Back     alignment and domain information
>cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>KOG0600 consensus Cdc2-related protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05120 APH_ChoK_like Aminoglycoside 3'-phosphotransferase (APH) and Choline Kinase (ChoK) family Back     alignment and domain information
>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 Back     alignment and domain information
>cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 Back     alignment and domain information
>cd05087 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3 Back     alignment and domain information
>cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 Back     alignment and domain information
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>smart00219 TyrKc Tyrosine kinase, catalytic domain Back     alignment and domain information
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>KOG0583 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>cd05606 STKc_beta_ARK Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase Back     alignment and domain information
>cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05115 PTKc_Zap-70 Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa Back     alignment and domain information
>cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 Back     alignment and domain information
>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd06627 STKc_Cdc7_like Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>KOG0578 consensus p21-activated serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>PRK12274 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
>cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd05581 STKc_PDK1 Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 Back     alignment and domain information
>KOG4236 consensus Serine/threonine protein kinase PKC mu/PKD and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00267 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd06630 STKc_MEKK1 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2 Back     alignment and domain information
>cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>cd05579 STKc_MAST_like Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>PF00069 Pkinase: Protein kinase domain Protein kinase; unclassified specificity Back     alignment and domain information
>KOG0193 consensus Serine/threonine protein kinase RAF [Signal transduction mechanisms] Back     alignment and domain information
>cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2 Back     alignment and domain information
>cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha Back     alignment and domain information
>cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>cd05077 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl Back     alignment and domain information
>cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>PTZ00283 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>PTZ00036 glycogen synthase kinase; Provisional Back     alignment and domain information
>cd05042 PTKc_Aatyk Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases Back     alignment and domain information
>cd05076 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>PF07714 Pkinase_Tyr: Protein tyrosine kinase Protein kinase; unclassified specificity Back     alignment and domain information
>smart00221 STYKc Protein kinase; unclassified specificity Back     alignment and domain information
>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor Back     alignment and domain information
>cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases Back     alignment and domain information
>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>PHA02988 hypothetical protein; Provisional Back     alignment and domain information
>cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>cd05613 STKc_MSK1_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>KOG0577 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 Back     alignment and domain information
>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>cd05047 PTKc_Tie Catalytic domain of Tie Protein Tyrosine Kinases Back     alignment and domain information
>KOG0663 consensus Protein kinase PITSLRE and related kinases [General function prediction only] Back     alignment and domain information
>cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>KOG0597 consensus Serine-threonine protein kinase FUSED [General function prediction only] Back     alignment and domain information
>cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>cd05037 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>PHA03209 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase Back     alignment and domain information
>cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase Back     alignment and domain information
>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 Back     alignment and domain information
>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase Back     alignment and domain information
>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0593 consensus Predicted protein kinase KKIAMRE [General function prediction only] Back     alignment and domain information
>cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information
>cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>KOG0575 consensus Polo-like serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase Back     alignment and domain information
>cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors Back     alignment and domain information
>KOG0032 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>PRK10345 hypothetical protein; Provisional Back     alignment and domain information
>cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 Back     alignment and domain information
>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>KOG1164 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PHA03212 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 Back     alignment and domain information
>cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1 Back     alignment and domain information
>cd05044 PTKc_c-ros Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase Back     alignment and domain information
>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>smart00220 S_TKc Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 Back     alignment and domain information
>PTZ00284 protein kinase; Provisional Back     alignment and domain information
>KOG0197 consensus Tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>PHA03211 serine/threonine kinase US3; Provisional Back     alignment and domain information
>PTZ00024 cyclin-dependent protein kinase; Provisional Back     alignment and domain information
>cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>cd05123 STKc_AGC Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>KOG0592 consensus 3-phosphoinositide-dependent protein kinase (PDK1) [Signal transduction mechanisms] Back     alignment and domain information
>cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>KOG0198 consensus MEKK and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>PLN00009 cyclin-dependent kinase A; Provisional Back     alignment and domain information
>KOG0616 consensus cAMP-dependent protein kinase catalytic subunit (PKA) [Signal transduction mechanisms] Back     alignment and domain information
>cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>KOG0594 consensus Protein kinase PCTAIRE and related kinases [General function prediction only] Back     alignment and domain information
>cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>PHA03207 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>KOG0610 consensus Putative serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd05058 PTKc_Met_Ron Catalytic domain of the Protein Tyrosine Kinases, Met and Ron Back     alignment and domain information
>KOG1166 consensus Mitotic checkpoint serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta Back     alignment and domain information
>cd05074 PTKc_Tyro3 Catalytic domain of the Protein Tyrosine Kinase, Tyro3 Back     alignment and domain information
>cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>PHA03390 pk1 serine/threonine-protein kinase 1; Provisional Back     alignment and domain information
>cd05086 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2 Back     alignment and domain information
>PLN03225 Serine/threonine-protein kinase SNT7; Provisional Back     alignment and domain information
>cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>cd08215 STKc_Nek Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3 Back     alignment and domain information
>PRK01723 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed Back     alignment and domain information
>cd05078 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>KOG1095 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF06176 WaaY: Lipopolysaccharide core biosynthesis protein (WaaY); InterPro: IPR009330 This family consists of several bacterial lipopolysaccharide core biosynthesis proteins (WaaY or RfaY) Back     alignment and domain information
>KOG0658 consensus Glycogen synthase kinase-3 [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd05154 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 and 11, N-terminal domain, and similar proteins Back     alignment and domain information
>KOG0660 consensus Mitogen-activated protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information
>KOG0659 consensus Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH/TFIIK, kinase subunit CDK7 [Cell cycle control, cell division, chromosome partitioning; Transcription; Replication, recombination and repair] Back     alignment and domain information
>cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 Back     alignment and domain information
>cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) Back     alignment and domain information
>cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 Back     alignment and domain information
>KOG0587 consensus Traf2- and Nck-interacting kinase and related germinal center kinase (GCK) family protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd07838 STKc_CDK4_6_like Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha Back     alignment and domain information
>cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>PLN03224 probable serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG0582 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0196 consensus Tyrosine kinase, EPH (ephrin) receptor family [Signal transduction mechanisms] Back     alignment and domain information
>cd08222 STKc_Nek11 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 Back     alignment and domain information
>cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>KOG0611 consensus Predicted serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases Back     alignment and domain information
>cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>KOG0194 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd08530 STKc_CNK2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>KOG0585 consensus Ca2+/calmodulin-dependent protein kinase kinase beta and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>cd05576 STKc_RPK118_like Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins Back     alignment and domain information
>cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>KOG0598 consensus Ribosomal protein S6 kinase and related proteins [General function prediction only; Signal transduction mechanisms] Back     alignment and domain information
>KOG0199 consensus ACK and related non-receptor tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>PHA02882 putative serine/threonine kinase; Provisional Back     alignment and domain information
>cd07829 STKc_CDK_like Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta Back     alignment and domain information
>KOG3087 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>KOG2270 consensus Serine/threonine protein kinase involved in cell cycle control [Signal transduction mechanisms; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PTZ00266 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 Back     alignment and domain information
>KOG0201 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein Back     alignment and domain information
>KOG0608 consensus Warts/lats-like serine threonine kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1167 consensus Serine/threonine protein kinase of the CDC7 subfamily involved in DNA synthesis, repair and recombination [Replication, recombination and repair] Back     alignment and domain information
>KOG0591 consensus NIMA (never in mitosis)-related G2-specific serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1165 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1989 consensus ARK protein kinase family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0694 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PHA03210 serine/threonine kinase US3; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG1094 consensus Discoidin domain receptor DDR1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG3653 consensus Transforming growth factor beta/activin receptor subfamily of serine/threonine kinases [Signal transduction mechanisms] Back     alignment and domain information
>PRK15123 lipopolysaccharide core heptose(I) kinase RfaP; Provisional Back     alignment and domain information
>KOG0588 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2268 consensus Serine/threonine protein kinase [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>KOG4721 consensus Serine/threonine protein kinase, contains leucine zipper domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0589 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>PF06293 Kdo: Lipopolysaccharide kinase (Kdo/WaaP) family; InterPro: IPR010440 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>PRK10593 hypothetical protein; Provisional Back     alignment and domain information
>KOG4645 consensus MAPKKK (MAP kinase kinase kinase) SSK2 and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG1026 consensus Nerve growth factor receptor TRKA and related tyrosine kinases [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0664 consensus Nemo-like MAPK-related serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>TIGR02172 Fb_sc_TIGR02172 Fibrobacter succinogenes paralogous family TIGR02172 Back     alignment and domain information
>KOG0576 consensus Mitogen-activated protein kinase kinase kinase kinase (MAP4K), germinal center kinase family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0670 consensus U4/U6-associated splicing factor PRP4 [RNA processing and modification] Back     alignment and domain information
>KOG0983 consensus Mitogen-activated protein kinase (MAPK) kinase MKK7/JNKK2 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0668 consensus Casein kinase II, alpha subunit [Signal transduction mechanisms; Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG0596 consensus Dual specificity; serine/threonine and tyrosine kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1035 consensus eIF-2alpha kinase GCN2 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0580 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1006 consensus Mitogen-activated protein kinase (MAPK) kinase MKK4 [Signal transduction mechanisms] Back     alignment and domain information
>COG0515 SPS1 Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1027 consensus Serine/threonine protein kinase and endoribonuclease ERN1/IRE1, sensor of the unfolded protein response pathway [Signal transduction mechanisms] Back     alignment and domain information
>COG2112 Predicted Ser/Thr protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1025 consensus Epidermal growth factor receptor EGFR and related tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0579 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>TIGR02721 ycfN_thiK thiamine kinase Back     alignment and domain information
>KOG0586 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd05150 APH Aminoglycoside 3'-phosphotransferase (APH) Back     alignment and domain information
>KOG0984 consensus Mitogen-activated protein kinase (MAPK) kinase MKK3/MKK6 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4279 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4257 consensus Focal adhesion tyrosine kinase FAK, contains FERM domain [Signal transduction mechanisms] Back     alignment and domain information
>PRK05231 homoserine kinase; Provisional Back     alignment and domain information
>KOG4717 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0603 consensus Ribosomal protein S6 kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0599 consensus Phosphorylase kinase gamma subunit [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1151 consensus Tousled-like protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0662 consensus Cyclin-dependent kinase CDK5 [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>cd05157 ETNK_euk Ethanolamine kinase (ETNK) in eukaryotes Back     alignment and domain information
>KOG0671 consensus LAMMER dual specificity kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05155 APH_ChoK_like_1 Uncharacterized bacterial proteins with similarity to Aminoglycoside 3'-phosphotransferase (APH) and Choline kinase (ChoK) family members Back     alignment and domain information
>KOG0200 consensus Fibroblast/platelet-derived growth factor receptor and related receptor tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0607 consensus MAP kinase-interacting kinase and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0604 consensus MAP kinase-activated protein kinase 2 [Signal transduction mechanisms] Back     alignment and domain information
>cd05153 HomoserineK_II Homoserine Kinase, type II Back     alignment and domain information
>KOG1152 consensus Signal transduction serine/threonine kinase with PAS/PAC sensor domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG4278 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0669 consensus Cyclin T-dependent kinase CDK9 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2052 consensus Activin A type IB receptor, serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0696 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0666 consensus Cyclin C-dependent kinase CDK8 [Transcription] Back     alignment and domain information
>PF03881 Fructosamin_kin: Fructosamine kinase; InterPro: IPR016477 Ketosamines derive from a non-enzymatic reaction between a sugar and a protein [] Back     alignment and domain information
>KOG0033 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>PF01636 APH: Phosphotransferase enzyme family This family is part of the larger protein kinase superfamily Back     alignment and domain information
>PRK09550 mtnK methylthioribose kinase; Reviewed Back     alignment and domain information
>PRK06148 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00938 thrB_alt homoserine kinase, Neisseria type Back     alignment and domain information
>PRK09902 hypothetical protein; Provisional Back     alignment and domain information
>KOG1345 consensus Serine/threonine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0690 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PLN02236 choline kinase Back     alignment and domain information
>KOG1290 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0614 consensus cGMP-dependent protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0695 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0584 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>KOG2345 consensus Serine/threonine protein kinase/TGF-beta stimulated factor [Transcription; Lipid transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PF14531 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_A 3Q5Z_A 3Q60_A Back     alignment and domain information
>PLN02756 S-methyl-5-thioribose kinase Back     alignment and domain information
>PRK06149 hypothetical protein; Provisional Back     alignment and domain information
>PLN02876 acyl-CoA dehydrogenase Back     alignment and domain information
>KOG0665 consensus Jun-N-terminal kinase (JNK) [Signal transduction mechanisms] Back     alignment and domain information
>KOG2269 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK11768 serine/threonine protein kinase; Provisional Back     alignment and domain information
>COG2334 Putative homoserine kinase type II (protein kinase fold) [General function prediction only] Back     alignment and domain information
>TIGR01767 MTRK 5-methylthioribose kinase Back     alignment and domain information
>PF10707 YrbL-PhoP_reg: PhoP regulatory network protein YrbL; InterPro: IPR019647 This entry represents proteins that are activated by the protein PhoP Back     alignment and domain information
>KOG0986 consensus G protein-coupled receptor kinase [Signal transduction mechanisms] Back     alignment and domain information
>PLN02421 phosphotransferase, alcohol group as acceptor/kinase Back     alignment and domain information
>cd05152 MPH2' Macrolide 2'-Phosphotransferase (MPH2') Back     alignment and domain information
>PF12260 PIP49_C: Protein-kinase domain of FAM69; InterPro: IPR022049 Family with sequence similarity 69 has three members (A, B and C) Back     alignment and domain information
>COG3001 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR02906 spore_CotS spore coat protein, CotS family Back     alignment and domain information
>cd05156 ChoK_euk Choline Kinase (ChoK) in eukaryotes Back     alignment and domain information
>PTZ00384 choline kinase; Provisional Back     alignment and domain information
>COG3173 Predicted aminoglycoside phosphotransferase [General function prediction only] Back     alignment and domain information
>KOG0590 consensus Checkpoint kinase and related serine/threonine protein kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK12396 5-methylribose kinase; Reviewed Back     alignment and domain information
>PF13095 FTA2: Kinetochore Sim4 complex subunit FTA2 Back     alignment and domain information
>PF07914 DUF1679: Protein of unknown function (DUF1679); InterPro: IPR012877 This region is found in a number of Caenorhabditis elegans and Caenorhabditis briggsae proteins, in one case (Q19034 from SWISSPROT) as a repeat Back     alignment and domain information
>PF04655 APH_6_hur: Aminoglycoside/hydroxyurea antibiotic resistance kinase; InterPro: IPR006748 The aminoglycosides are a large group of biologically active bacterial secondary metabolites, best known for their antibiotic properties [] Back     alignment and domain information
>PF01633 Choline_kinase: Choline/ethanolamine kinase; InterPro: IPR002573 Choline kinase, (ATP:choline phosphotransferase, 2 Back     alignment and domain information
>KOG4158 consensus BRPK/PTEN-induced protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00296 choline kinase; Provisional Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>COG5072 ALK1 Serine/threonine kinase of the haspin family [Cell division and chromosome partitioning] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query475
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 51.8 bits (123), Expect = 4e-07
 Identities = 55/402 (13%), Positives = 122/402 (30%), Gaps = 111/402 (27%)

Query: 4   LNDV--GKLINGLSLVAKEITKRSQALQTARTGDVETLISSSLKKALVSATEISGLTRGT 61
           L +V   K  N  +L         + L T R   V   +S++    +        LT   
Sbjct: 250 LLNVQNAKAWNAFNL-------SCKILLTTRFKQVTDFLSAATTTHISLDHHSMTLT--- 299

Query: 62  VREFTNPKPKESIVYFNDSSDV-AQSAPSTDKDG---AVDQFAASVRDVSN--DGGK-LD 114
                   P E         D   Q  P          +   A S+RD     D  K ++
Sbjct: 300 --------PDEVKSLLLKYLDCRPQDLPREVLTTNPRRLSIIAESIRDGLATWDNWKHVN 351

Query: 115 GENEAKVLESSVE--KESLVKE-FESIDLGD-RVDVDIEREATAKRRRPRERKVPSTPFS 170
            +    ++ESS+   + +  ++ F+   L        I                P+   S
Sbjct: 352 CDKLTTIIESSLNVLEPAEYRKMFD--RLSVFPPSAHI----------------PTILLS 393

Query: 171 RLLGFAGLGAGLAWGTVQESTKRIMYGTPSSQDKQAAISPFLSDQNAERLAYAL----CR 226
            +           W  V +S   ++       +K    S  L ++  +    ++      
Sbjct: 394 LI-----------WFDVIKSDVMVV------VNKLHKYS--LVEKQPKESTISIPSIYLE 434

Query: 227 MRGAALKIGQM-----------LSIQDESLVPAPI-------LAA-LDIVRQG--ADVMP 265
           ++        +            +   + L+P  +       +   L  +       +  
Sbjct: 435 LKVKLENEYALHRSIVDHYNIPKTFDSDDLIPPYLDQYFYSHIGHHLKNIEHPERMTLFR 494

Query: 266 RWQLN-QVLDAEL---GSDWQSKLTSFD-------YEPMAAASIGQVHRAVTKDGMQVAM 314
              L+ + L+ ++    + W +  +  +       Y+P    +  +  R V    +    
Sbjct: 495 MVFLDFRFLEQKIRHDSTAWNASGSILNTLQQLKFYKPYICDNDPKYERLV-NAILDFLP 553

Query: 315 KIQYPGVADSIESDIQNVKILLDYTNLIPKGLYLDSAMKVAR 356
           KI+   +  S  +D+  ++I L   +   + ++ ++  +V R
Sbjct: 554 KIE-ENLICSKYTDL--LRIALMAED---EAIFEEAHKQVQR 589


>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query475
2y7j_A 365 Phosphorylase B kinase gamma catalytic chain, test 99.89
3c4z_A 543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 99.68
2c30_A 321 Serine/threonine-protein kinase PAK 6; CRIB domain 99.65
4fih_A 346 Serine/threonine-protein kinase PAK 4; kinase doma 99.57
4fie_A 423 Serine/threonine-protein kinase PAK 4; kinase doma 99.56
4gt4_A 308 Tyrosine-protein kinase transmembrane receptor RO; 99.56
1zth_A258 RIO1 serine protein kinase; ribosome biogenesis, r 99.55
4asz_A 299 BDNF/NT-3 growth factors receptor; transferase, TR 99.55
4gyi_A 397 RIO2 kinase; protein kinase, ADP complex, phosphoa 99.55
3fpq_A290 Serine/threonine-protein kinase WNK1; protein seri 99.54
4b9d_A 350 Serine/threonine-protein kinase NEK1; transferase, 99.53
4aoj_A 329 High affinity nerve growth factor receptor; transf 99.53
4g3f_A 336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 99.49
3byv_A 377 Rhoptry kinase; malaria, transferase, structural g 99.49
3omv_A 307 RAF proto-oncogene serine/threonine-protein kinas; 99.48
4aw0_A 311 HPDK1, 3-phosphoinositide-dependent protein kinase 99.48
3hyh_A 275 Carbon catabolite-derepressing protein kinase; kin 99.47
1mqb_A 333 Ephrin type-A receptor 2; tyrosine protein kinase, 99.46
4g31_A 299 Eukaryotic translation initiation factor 2-alpha; 99.46
4ase_A 353 Vascular endothelial growth factor receptor 2; tra 99.45
3hmm_A 303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 99.44
1zar_A282 RIO2 kinase; serine kinase, winged-helix, RIO doma 99.43
3ubd_A 304 Ribosomal protein S6 kinase alpha-3; kinase-inhibi 99.42
4f9c_A 361 Cell division cycle 7-related protein kinase; Ser/ 99.42
3com_A 314 Serine/threonine-protein kinase 4; MST1, STE20-lik 99.42
3fxz_A 297 Serine/threonine-protein kinase PAK 1; transferase 99.39
2x4f_A 373 Myosin light chain kinase family member 4; LUNG, b 99.38
2qkw_B 321 Protein kinase; three-helix bundle motif, AVRPTO-P 99.37
3qd2_B 332 Eukaryotic translation initiation factor 2-alpha; 99.36
2qol_A 373 Ephrin receptor; receptor tyrosine kinase, juxtame 99.36
4hcu_A 269 Tyrosine-protein kinase ITK/TSK; transferase-trans 99.35
4b99_A 398 Mitogen-activated protein kinase 7; transferase, i 99.35
4eqm_A 294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 99.35
2nru_A 307 Interleukin-1 receptor-associated kinase 4; inhibi 99.34
3s95_A 310 LIMK-1, LIM domain kinase 1; structural genomics, 99.33
3gen_A 283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 99.33
3sxs_A 268 Cytoplasmic tyrosine-protein kinase BMX; transfera 99.33
2zv2_A298 Calcium/calmodulin-dependent protein kinase kinas; 99.31
3v5w_A 689 G-protein coupled receptor kinase 2; inhibitor com 99.31
3kul_A 325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 99.31
3nsz_A 330 CK II alpha, casein kinase II subunit alpha; inhib 99.31
3uim_A 326 Brassinosteroid insensitive 1-associated receptor; 99.3
3ork_A 311 Serine/threonine protein kinase; structural genomi 99.3
3kn6_A 325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 99.3
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 99.3
3e7e_A 365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 99.3
3en9_A540 Glycoprotease, O-sialoglycoprotein endopeptidase/p 99.29
3cbl_A 377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 99.29
3fe3_A 328 MAP/microtubule affinity-regulating kinase 3; seri 99.29
3t9t_A 267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 99.29
3txo_A 353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 99.29
1t46_A 313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 99.28
3a7i_A 303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 99.28
2wqm_A 310 Serine/threonine-protein kinase NEK7; ATP-binding, 99.27
1luf_A 343 Muscle-specific tyrosine kinase receptor MUSK; pho 99.27
3a62_A 327 Ribosomal protein S6 kinase beta-1; kinase domain, 99.27
3tki_A 323 Serine/threonine-protein kinase CHK1; cell checkpo 99.26
1qpc_A 279 LCK kinase; alpha beta fold, transferase; HET: PTR 99.26
3f3z_A 277 Calcium/calmodulin-dependent protein kinase with d 99.26
1x8b_A289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 99.26
2ivs_A 314 Proto-oncogene tyrosine-protein kinase receptor RE 99.26
1fmk_A 452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 99.25
3op5_A 364 Serine/threonine-protein kinase VRK1; adenosine tr 99.25
1qcf_A 454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 99.25
4euu_A 319 Serine/threonine-protein kinase TBK1; ATP binding, 99.25
2y0a_A 326 Death-associated protein kinase 1; transferase, ca 99.25
3p86_A 309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 99.25
1phk_A 298 Phosphorylase kinase; glycogen metabolism, transfe 99.25
1vzo_A 355 Ribosomal protein S6 kinase alpha 5; protein kinas 99.25
3zgw_A 347 Maternal embryonic leucine zipper kinase; transfer 99.25
2h6d_A 276 5'-AMP-activated protein kinase catalytic subunit 99.25
2psq_A 370 Fibroblast growth factor receptor 2; kinase domain 99.25
1o6l_A 337 RAC-beta serine/threonine protein kinase; protein 99.25
3vhe_A 359 Vascular endothelial growth factor receptor 2; kin 99.24
3ugc_A 295 Tyrosine-protein kinase JAK2; small molecule inhib 99.24
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 99.24
3kfa_A 288 Tyrosine-protein kinase ABL1; CML, drug resistance 99.24
2ac3_A 316 MAP kinase-interacting serine/threonine kinase 2; 99.24
4e5w_A 302 Tyrosine-protein kinase JAK1; kinase domain, trans 99.24
3niz_A 311 Rhodanese family protein; structural genomics, str 99.24
2jii_A 352 Serine/threonine-protein kinase VRK3 molecule: VA 99.24
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 99.24
3tt0_A 382 Basic fibroblast growth factor receptor 1; kinase 99.24
3a8x_A 345 Protein kinase C IOTA type; transferase; HET: TPO; 99.24
2a19_B284 Interferon-induced, double-stranded RNA-activated 99.23
2h8h_A 535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 99.23
1xjd_A 345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 99.23
1opk_A 495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 99.23
1rdq_E 350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 99.23
3l9p_A 367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 99.23
2vuw_A336 Serine/threonine-protein kinase haspin; cell cycle 99.22
3kk8_A 284 Calcium/calmodulin dependent protein kinase II; AT 99.22
3uc3_A 361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 99.22
2bdw_A 362 Hypothetical protein K11E8.1D; kinase, calmodulin 99.22
1rjb_A 344 FL cytokine receptor; kinase, structure, autoinhib 99.22
2j7t_A 302 Serine/threonine-protein kinase 10; transferase, A 99.22
2i0e_A 353 Protein kinase C-beta II; serine/threonine protein 99.22
3fdn_A 279 Serine/threonine-protein kinase 6; aurora kinase i 99.22
3qup_A 323 Tyrosine-protein kinase receptor TYRO3; protein ki 99.22
2yex_A 276 Serine/threonine-protein kinase CHK1; transferase, 99.22
2w1i_A 326 JAK2; chromosomal rearrangement, nucleotide-bindin 99.22
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 99.22
1tki_A 321 Titin; serine kinase, muscle, autoinhibition; 2.00 99.22
4agu_A 311 Cyclin-dependent kinase-like 1; transferase, phosp 99.22
3lxl_A 327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 99.22
2a2a_A 321 Death-associated protein kinase 2; autoinhibition, 99.21
2pvf_A 334 Fibroblast growth factor receptor 2; kinase domain 99.21
1fot_A 318 TPK1 delta, CAMP-dependent protein kinase type 1; 99.21
1u59_A 287 Tyrosine-protein kinase ZAP-70; transferase; HET: 99.21
3dbq_A 343 Dual specificity protein kinase TTK; MPS1 structur 99.21
2xir_A 316 Vascular endothelial growth factor receptor 2; ang 99.21
2qr7_A 342 Ribosomal protein S6 kinase alpha-3; kinase domain 99.21
1u5q_A 348 Serine/threonine protein kinase TAO2; transferase; 99.21
3o0g_A 292 Cell division protein kinase 5; kinase activator c 99.21
4aaa_A 331 Cyclin-dependent kinase-like 2; transferase, phosp 99.21
3cok_A 278 Serine/threonine-protein kinase PLK4; POLO-like ki 99.21
2izr_A 330 Casein kinase I isoform gamma-3; serine/threonine- 99.2
3uqc_A286 Probable conserved transmembrane protein; structur 99.2
2eue_A 275 Carbon catabolite derepressing protein kinase; kin 99.2
4eut_A 396 Serine/threonine-protein kinase TBK1; ATP binding, 99.2
1kob_A 387 Twitchin; kinase, intrasteric regulation; 2.30A {A 99.2
4azs_A 569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 99.2
2iwi_A 312 Serine/threonine-protein kinase PIM-2; nucleotide- 99.2
1cm8_A 367 Phosphorylated MAP kinase P38-gamma; phosphorylati 99.2
3an0_A 340 Dual specificity mitogen-activated protein kinase; 99.2
3eqc_A 360 Dual specificity mitogen-activated protein kinase; 99.2
4dc2_A 396 Protein kinase C IOTA type; kinase, substrate, cel 99.19
2owb_A 335 Serine/threonine-protein kinase PLK1; catalytic do 99.19
2rku_A 294 Serine/threonine-protein kinase PLK1; structure of 99.19
2yab_A 361 Death-associated protein kinase 2; apoptosis, tran 99.19
3bhy_A 283 Death-associated protein kinase 3; death associate 99.19
1p4o_A 322 Insulin-like growth factor I receptor protein; IGF 99.19
3v8s_A 410 RHO-associated protein kinase 1; dimerization, myo 99.19
4fvq_A 289 Tyrosine-protein kinase JAK2; janus protein kinase 99.19
1ob3_A 288 PFPK5, cell division control protein 2 homolog; tr 99.19
3uzp_A 296 CKI-delta, CKID, casein kinase I isoform delta; CK 99.19
4aw2_A 437 Serine/threonine-protein kinase MRCK alpha; transf 99.19
2zmd_A 390 Dual specificity protein kinase TTK; MPS1, T686A, 99.19
3c0i_A 351 Peripheral plasma membrane protein CASK; neurexin, 99.18
2vd5_A 412 DMPK protein; serine/threonine-protein kinase, kin 99.18
2ycf_A 322 Serine/threonine-protein kinase CHK2; transferase, 99.18
2y94_A 476 5'-AMP-activated protein kinase catalytic subunit; 99.18
2jam_A 304 Calcium/calmodulin-dependent protein kinase type 1 99.18
2w4o_A 349 Calcium/calmodulin-dependent protein kinase type I 99.18
3cc6_A 281 Protein tyrosine kinase 2 beta; focal adhesion kin 99.18
1k9a_A450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 99.18
2h34_A 309 Serine/threonine-protein kinase PKNE; apoenzyme, t 99.18
2yfx_A 327 Tyrosine-protein kinase receptor; nucleotide-bindi 99.18
3g33_A 308 Cell division protein kinase 4; Ser/Thr protein ki 99.18
1mp8_A 281 Focal adhesion kinase 1; tyrosine protein kinase, 99.18
4hgt_A 296 Casein kinase I isoform delta; CK1D, inhibitor, tr 99.18
3lxp_A 318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 99.17
4ejn_A 446 RAC-alpha serine/threonine-protein kinase; AKT1, a 99.17
1csn_A 298 Casein kinase-1; phosphotransferase; HET: ATP; 2.0 99.17
3soa_A 444 Calcium/calmodulin-dependent protein kinase type a 99.17
2x7f_A 326 TRAF2 and NCK-interacting protein kinase; serine/t 99.17
2vgo_A 284 Serine/threonine-protein kinase 12-A; nucleotide-b 99.17
3lm5_A 327 Serine/threonine-protein kinase 17B; STK17B, serin 99.17
3q60_A 371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 99.17
2i6l_A 320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 99.17
3is5_A285 Calcium-dependent protein kinase; CDPK, structural 99.17
3rp9_A 458 Mitogen-activated protein kinase; structural genom 99.17
2i1m_A 333 Macrophage colony-stimulating factor 1 receptor; k 99.16
3oz6_A 388 Mitogen-activated protein kinase 1, serine/threon 99.16
2pmi_A 317 Negative RE, cyclin-dependent protein kinase PHO85 99.16
3q4u_A 301 Activin receptor type-1; structural genomics conso 99.16
2r5t_A 373 Serine/threonine-protein kinase SGK1; AGC protein 99.16
4fr4_A 384 YANK1, serine/threonine-protein kinase 32A; struct 99.16
1ua2_A 346 CAK, cell division protein kinase 7; cell cycle, p 99.16
3coi_A 353 Mitogen-activated protein kinase 13; P38D, P38delt 99.16
3i6u_A 419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 99.15
3n9x_A 432 Phosphotransferase; malaria kinase, structural gen 99.15
1xbb_A 291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 99.15
3h4j_B 336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 99.15
2clq_A 295 Mitogen-activated protein kinase kinase kinase 5; 99.15
2acx_A 576 G protein-coupled receptor kinase 6; GRK, G transf 99.15
3f66_A 298 Hepatocyte growth factor receptor; C-Met, protein 99.15
2ozo_A 613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 99.15
2pml_X 348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 99.15
3sv0_A 483 Casein kinase I-like; typical kinase domain fold, 99.15
3mwu_A 486 Calmodulin-domain protein kinase 1; serine/threoni 99.15
3pfq_A 674 PKC-B, PKC-beta, protein kinase C beta type; phosp 99.15
3soc_A 322 Activin receptor type-2A; structural genomics cons 99.15
3rgf_A 405 Cyclin-dependent kinase 8; protein kinase complex, 99.14
2eva_A 307 TAK1 kinase - TAB1 chimera fusion protein; transfe 99.14
3lij_A 494 Calcium/calmodulin dependent protein kinase with A 99.14
3hko_A 345 Calcium/calmodulin-dependent protein kinase with d 99.14
2b9h_A 353 MAP kinase FUS3, mitogen-activated protein kinase 99.14
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 99.14
2wei_A 287 Calmodulin-domain protein kinase 1, putative; nucl 99.13
3g2f_A 336 Bone morphogenetic protein receptor type-2; kinase 99.13
1byg_A278 CSK, protein (C-terminal SRC kinase); protein kina 99.13
2w5a_A 279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 99.13
3gni_B 389 Strad alpha; kinase fold, pseudokinase, alpha heli 99.13
2vwi_A 303 Serine/threonine-protein kinase OSR1; STE kinase, 99.13
3cek_A 313 Dual specificity protein kinase TTK; HMPS1, PYT, E 99.13
3fme_A 290 Dual specificity mitogen-activated protein kinase; 99.13
3nyv_A 484 Calmodulin-domain protein kinase 1; serine/threoni 99.12
3fhr_A 336 MAP kinase-activated protein kinase 3; kinase-inhi 99.12
3og7_A 289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 99.12
3ttj_A 464 Mitogen-activated protein kinase 10; JNK3, protein 99.12
1u46_A 291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 99.12
2xrw_A 371 Mitogen-activated protein kinase 8; transcription, 99.12
3llt_A 360 Serine/threonine kinase-1, pflammer; lammer kinase 99.11
4exu_A 371 Mitogen-activated protein kinase 13; P38 kinase, t 99.11
4fl3_A 635 Tyrosine-protein kinase SYK; transferase; HET: ANP 99.11
2v62_A 345 Serine/threonine-protein kinase VRK2; transferase, 99.11
3pg1_A 362 Mitogen-activated protein kinase, putative (MAP K 99.11
3kex_A 325 Receptor tyrosine-protein kinase ERBB-3; kinase do 99.11
3mdy_A 337 Bone morphogenetic protein receptor type-1B; compl 99.11
2buj_A 317 Serine/threonine-protein kinase 16; transferase, A 99.11
1blx_A 326 Cyclin-dependent kinase 6; inhibitor protein, cycl 99.11
3lb7_A 307 RAF proto-oncogene serine/threonine-protein kinas; 99.11
3q5i_A 504 Protein kinase; CDPK, malaria, phosphotransferase, 99.1
1nd4_A264 Aminoglycoside 3'-phosphotransferase; protein kina 99.1
3brb_A 313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 99.1
1nxk_A 400 MAP kinase-activated protein kinase 2; MK2, phosph 99.1
3c1x_A 373 Hepatocyte growth factor receptor; receptor tyrosi 99.1
1b6c_B 342 TGF-B superfamily receptor type I; complex (isomer 99.09
3mtl_A 324 Cell division protein kinase 16; pctaire1, indirub 99.09
1wak_A 397 Serine/threonine-protein kinase SPRK1; SRPK, trans 99.09
2r3i_A 299 Cell division protein kinase 2; serine/threonine-p 99.09
3ll6_A 337 Cyclin G-associated kinase; transferase, protein k 99.08
3a99_A 320 Proto-oncogene serine/threonine-protein kinase PI; 99.08
1zy4_A 303 Serine/threonine-protein kinase GCN2; translation 99.08
3eb0_A 383 Putative uncharacterized protein; kinase cryptospo 99.08
2fst_X 367 Mitogen-activated protein kinase 14; active mutant 99.08
3qyz_A 364 Mitogen-activated protein kinase 1; transferase, s 99.08
3dls_A 335 PAS domain-containing serine/threonine-protein KI; 99.08
2eu9_A 355 Dual specificity protein kinase CLK3; kinase domai 99.08
2wtk_C 305 Serine/threonine-protein kinase 11; transferase-me 99.07
3gbz_A 329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 99.07
3mi9_A 351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 99.07
3m2w_A 299 MAP kinase-activated protein kinase 2; small molec 99.06
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 99.06
3gxj_A 303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 99.05
3pls_A 298 Macrophage-stimulating protein receptor; protein k 99.05
1fvr_A 327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 99.05
1z57_A 339 Dual specificity protein kinase CLK1; protein tyro 99.04
3kvw_A 429 DYRK2, dual specificity tyrosine-phosphorylation-r 99.04
2vx3_A 382 Dual specificity tyrosine-phosphorylation- regula 99.03
1q8y_A 373 SR protein kinase; transferase; HET: ADP ADE; 2.05 99.03
3aln_A 327 Dual specificity mitogen-activated protein kinase; 99.01
3e3p_A 360 Protein kinase, putative glycogen synthase kinase; 98.99
2j0j_A 656 Focal adhesion kinase 1; cell migration, FERM, tra 98.98
3kmu_A271 ILK, integrin-linked kinase; cell adhesion, ANK re 98.98
2dyl_A 318 Dual specificity mitogen-activated protein kinase 98.98
2rio_A 434 Serine/threonine-protein kinase/endoribonuclease I 98.98
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 98.98
1j1b_A 420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 98.97
3poz_A 327 Epidermal growth factor receptor; kinase domain, a 98.96
3p23_A 432 Serine/threonine-protein kinase/endoribonuclease; 98.94
3lzb_A 327 Epidermal growth factor receptor; epidermal growth 98.93
2y4i_B 319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 98.92
4e7w_A 394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 98.91
3dzo_A 413 Rhoptry kinase domain; parasitic disease, transfer 98.91
3tm0_A263 Aminoglycoside 3'-phosphotransferase; protein kina 98.73
3dxp_A359 Putative acyl-COA dehydrogenase; protein kinase-li 98.73
3r70_A 320 Aminoglycoside phosphotransferase; structural geno 98.47
4gkh_A272 Aminoglycoside 3'-phosphotransferase APHA1-IAB; py 98.42
3ovc_A 362 Hygromycin-B 4-O-kinase; aminoglycoside phosphotra 98.39
3d1u_A 288 Putative fructosamine-3-kinase; YP_290396.1, struc 98.38
3sg8_A 304 APH(2'')-ID; antibiotic resistance enzyme, transfe 98.34
2olc_A 397 MTR kinase, methylthioribose kinase; kinase ADP-2H 98.27
3ats_A 357 Putative uncharacterized protein; hypothetical pro 98.26
3tdw_A 306 Gentamicin resistance protein; kinase, phosphoryl 98.04
2q83_A 346 YTAA protein; 2635576, structural genomics, joint 98.01
3f7w_A 288 Putative fructosamine-3-kinase; YP_290396.1, struc 97.96
1zyl_A 328 Hypothetical protein YIHE; putative protein kinase 97.64
3i1a_A 339 Spectinomycin phosphotransferase; protein kinase, 97.62
2ppq_A 322 HSK, HK, homoserine kinase; structural genomics, M 97.6
3c5i_A 369 Choline kinase; choline, kinase, malaria, transfer 97.35
3dxq_A 301 Choline/ethanolamine kinase family protein; NP_106 97.34
3jr1_A 312 Putative fructosamine-3-kinase; YP_719053.1, struc 97.29
3feg_A 379 Choline/ethanolamine kinase; non-protein kinase, c 97.26
3csv_A 333 Aminoglycoside phosphotransferase; YP_614837.1, ph 97.23
2pyw_A 420 Uncharacterized protein; 5-methylthioribose kinase 97.1
3f2s_A 401 CK, chetk-alpha, choline kinase alpha; non-protein 96.42
1nw1_A 429 Choline kinase (49.2 KD); phospholipid synthesis, 95.77
3mes_A 424 Choline kinase; malaria, structural genomics, stru 95.16
2qg7_A 458 Ethanolamine kinase PV091845; malaria, SGC, struct 91.97
3g15_A 401 CK, chetk-alpha, choline kinase alpha; non-protein 90.96
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Back     alignment and structure
Probab=99.89  E-value=5.2e-23  Score=208.56  Aligned_cols=219  Identities=17%  Similarity=0.079  Sum_probs=122.3

Q ss_pred             CcHHHHHHHHHHHHhcCchHH-HHHHHHhcCCCCCCcHHHHHHHHHhhcCCCCCChHhHHHHHHHHhCCChHhhccccCc
Q 011921          212 LSDQNAERLAYALCRMRGAAL-KIGQMLSIQDESLVPAPILAALDIVRQGADVMPRWQLNQVLDAELGSDWQSKLTSFDY  290 (475)
Q Consensus       212 ~~~~~a~rl~~~L~~LGg~~I-KlGQ~LStr~~dllP~e~~~~L~~Lqd~app~p~~~v~~vle~eLG~~~~e~F~~fd~  290 (475)
                      .+.++|+++.+.+..+++.++ +++|.++..+ +.. ++++.++++||+.+|+.++..+.+.++.+++.+....|..|+.
T Consensus        17 ~~~~r~~~~~~~~~~l~~~~~~~~~~~~~~~~-~~~-~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   94 (365)
T 2y7j_A           17 KERRRARREIRHLPNLNREQRRAFIRSLRDDP-SQS-ANLLAEAKKLNDAQPKGTENLYFQSMGPEDELPDWAAAKEFYQ   94 (365)
T ss_dssp             -------------------------------------------------------------------CBCHHHHHHHHHH
T ss_pred             HHHHHHHHHHhcCccchhcccccccccccCCC-chh-HHHHHHHHhhhhcCCCCccccccccCCchhhcccchhhhhhhh
Confidence            356789999999999999987 9999998875 444 4577889999999999999999999999999999888888877


Q ss_pred             -----ccccccccceEEEeeec-CCCEEEEEEecCCcccchhhHHHHHHHHHHHhccccCccCHHHHHHHHHHHhHHHhh
Q 011921          291 -----EPMAAASIGQVHRAVTK-DGMQVAMKIQYPGVADSIESDIQNVKILLDYTNLIPKGLYLDSAMKVAREELSRECD  364 (475)
Q Consensus       291 -----~PIAaASIGQVHrA~L~-dG~~VAVKVqrPgI~~~i~~DL~~l~~l~~~~~~~p~~~~l~~iv~e~~~~L~~ELD  364 (475)
                           ++||+||+|+||+|+++ +|+.||||+++++.......|+.                       ++.+.+..|++
T Consensus        95 ~y~~~~~lg~G~~g~Vy~a~~~~~g~~vavK~~~~~~~~~~~~~~~-----------------------~~~~~~~~E~~  151 (365)
T 2y7j_A           95 KYDPKDVIGRGVSSVVRRCVHRATGHEFAVKIMEVTAERLSPEQLE-----------------------EVREATRRETH  151 (365)
T ss_dssp             HEEEEEEEEECSSEEEEEEEETTTCCEEEEEEEETTSSCCCHHHHH-----------------------HHHHHHHHHHH
T ss_pred             hcccceEEecCCCEEEEEEEECCCCcEEEEEEEEccccccCHHHHH-----------------------HHHHHHHHHHH
Confidence                 89999999999999986 79999999999987654444432                       22233334443


Q ss_pred             HHHHHHHHHHHHHhhcCCCCeeeceeecCCCCCceEEeecccCCCchhhhc----cCHHHHHHHHHHHHHHHHHHHHHCC
Q 011921          365 YEMEAANQKRFRDVLSNAKGFYVPYVVDDTSSKRVLTTELVSGIPIDKVAQ----LSQETRNYVGKKLLELTLMELFVFR  440 (475)
Q Consensus       365 f~~EA~N~~rf~~~~~~~~~V~VP~Vy~elst~rVLVMEyIeG~~L~d~~~----l~~~~r~~ia~~ll~~~L~~lf~~G  440 (475)
                            .+.++    .+++++..+..+.+.++..+|||||++|.+|.++..    ++......++.+++. .+..+|..|
T Consensus       152 ------~l~~l----~~hp~iv~~~~~~~~~~~~~lv~e~~~g~~L~~~l~~~~~l~~~~~~~i~~qi~~-~L~~LH~~g  220 (365)
T 2y7j_A          152 ------ILRQV----AGHPHIITLIDSYESSSFMFLVFDLMRKGELFDYLTEKVALSEKETRSIMRSLLE-AVSFLHANN  220 (365)
T ss_dssp             ------HHHHH----TTCTTBCCEEEEEEBSSEEEEEECCCTTCBHHHHHHHHSSCCHHHHHHHHHHHHH-HHHHHHHTT
T ss_pred             ------HHHHh----cCCCCEeEEEEEEeeCCEEEEEEEeCCCCcHHHHHHhcCCCCHHHHHHHHHHHHH-HHHHHHhCC
Confidence                  33333    357788877777777888999999999999988754    555666777877777 788999999


Q ss_pred             cccC---Ccccccc----cceEEecccccCCcc
Q 011921          441 FMQR---WLSFLPW----IYILIEGRCSNLFPE  466 (475)
Q Consensus       441 ~~H~---PGNILl~----l~LiDFG~~~~l~pe  466 (475)
                      ++|+   |+||+++    ++|+|||++..+.+.
T Consensus       221 i~H~Dlkp~NIl~~~~~~ikl~DfG~~~~~~~~  253 (365)
T 2y7j_A          221 IVHRDLKPENILLDDNMQIRLSDFGFSCHLEPG  253 (365)
T ss_dssp             EECSCCSGGGEEECTTCCEEECCCTTCEECCTT
T ss_pred             eecCCCCHHHEEECCCCCEEEEecCcccccCCC
Confidence            9999   9999997    899999998877653



>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Back     alignment and structure
>4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* Back     alignment and structure
>4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens} Back     alignment and structure
>4gt4_A Tyrosine-protein kinase transmembrane receptor RO; ATP binding, phosphorylation, transferase; 2.41A {Homo sapiens} PDB: 3zzw_A Back     alignment and structure
>1zth_A RIO1 serine protein kinase; ribosome biogenesis, rRNA, ADP, manganese, transferase; HET: ADP; 1.89A {Archaeoglobus fulgidus} PDB: 1zp9_A* 1ztf_A* Back     alignment and structure
>4asz_A BDNF/NT-3 growth factors receptor; transferase, TRKA, TRKB; 1.70A {Homo sapiens} PDB: 4at3_A* 4at4_A* 4at5_A* 3v5q_A* Back     alignment and structure
>4gyi_A RIO2 kinase; protein kinase, ADP complex, phosphoaspartate, acyl-phosphat ribosome biogenesis, Ser/Thr protein kinase; HET: PHD ADP; 2.20A {Chaetomium thermophilum} PDB: 4gyg_A Back     alignment and structure
>3fpq_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase, ATP-BIND kinase, nucleotide-binding, phosphoprotein; 1.80A {Rattus norvegicus} Back     alignment and structure
>4b9d_A Serine/threonine-protein kinase NEK1; transferase, inhibitor; HET: CK7; 1.90A {Homo sapiens} PDB: 4apc_A* Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Back     alignment and structure
>3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} Back     alignment and structure
>4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ... Back     alignment and structure
>3hyh_A Carbon catabolite-derepressing protein kinase; kinase domain, transferase, ATP-binding, carbohydrate metabo kinase, membrane; 2.20A {Saccharomyces cerevisiae} PDB: 3dae_A 2fh9_A 3mn3_A Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Back     alignment and structure
>4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* Back     alignment and structure
>3hmm_A TGF-beta receptor type-1; ALK5, kinase, inhibitor, quinazoline, aortic aneurysm, ATP-binding, craniosynostosis, disease mutation, disulfide bond; HET: 855; 1.70A {Homo sapiens} PDB: 1vjy_A* 3gxl_A* 3tzm_A* 2wot_A* 2wou_A* 1py5_A* 1rw8_A* Back     alignment and structure
>1zar_A RIO2 kinase; serine kinase, winged-helix, RIO domain, ADP-Mn complex, rRNA processing, transferase; HET: ADP; 1.75A {Archaeoglobus fulgidus} SCOP: a.4.5.56 d.144.1.9 PDB: 1tqi_A* 1tqp_A* 1tqm_A* 1zao_A* Back     alignment and structure
>3ubd_A Ribosomal protein S6 kinase alpha-3; kinase-inhibitor complex, induced FIT, transferase-transfera inhibitor complex; HET: SL0; 1.53A {Mus musculus} PDB: 4el9_A* 3g51_A* 2z7q_A* 2z7r_A* 2z7s_A* Back     alignment and structure
>4f9c_A Cell division cycle 7-related protein kinase; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_A* 4f9b_A* 4f9a_A* Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} SCOP: d.144.1.7 PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Back     alignment and structure
>4hcu_A Tyrosine-protein kinase ITK/TSK; transferase-transferase inhibitor complex; HET: 13L; 1.43A {Homo sapiens} PDB: 4hct_A* 4hcv_A* 3t9t_A* 1sm2_A* 1snu_A* 1snx_A 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens} Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} SCOP: d.144.1.7 PDB: 3sxr_A* Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Back     alignment and structure
>3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} SCOP: d.144.1.7 PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3u9c_A* 4fbx_A* 3mb7_A* 3mb6_A* ... Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A* Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Back     alignment and structure
>3en9_A Glycoprotease, O-sialoglycoprotein endopeptidase/protein kinase; endopeptidase activity, protein kinase activity; HET: TBR; 2.67A {Methanocaldococcus jannaschii} PDB: 3enh_A* 2vwb_A* Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vhk_A* 3vid_A* 3hng_A* Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 4e4m_A* 4f08_A* 4f09_A* 3q32_A* 3rvg_A* 4hge_A* 3tjc_A* 3tjd_A* 4bbe_A* 4bbf_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* ... Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} SCOP: d.144.1.0 Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} SCOP: d.144.1.7 PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 4ehz_A* 4ei4_A* 4fk6_A* 3eyg_A* 3eyh_A* Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} SCOP: d.144.1.7 PDB: 2qkr_A* Back     alignment and structure
>2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Back     alignment and structure
>2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 4dea_A* 4deb_A* ... Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 4hvd_A* 4hvg_A* 4hvh_A* 4hvi_A* 3pjc_A* 1yvj_A* Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} SCOP: d.144.1.7 PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} PDB: 4bbm_A* Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Back     alignment and structure
>2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ... Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Back     alignment and structure
>3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Back     alignment and structure
>4hgt_A Casein kinase I isoform delta; CK1D, inhibitor, transferase-transferase inhibitor C; HET: 15G; 1.80A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 3uzp_A* 4hnf_A* 1cki_A 1ckj_A 4hni_A* 4hok_A Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* 4e20_A* 4e1z_A* Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Back     alignment and structure
>1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 4deg_A* 4deh_A* 4dei_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 4aoi_A* 4ap7_A* 3q6w_A* ... Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Back     alignment and structure
>3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 4asx_A* 2qlu_A* Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} SCOP: d.144.1.7 PDB: 4fk3_A* 3c4c_A* 3c4d_A* 3idp_A* 4g9r_A* 3ii5_A* 4e26_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 3d4q_A* 4e4x_A* 4g9c_A* ... Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Back     alignment and structure
>4exu_A Mitogen-activated protein kinase 13; P38 kinase, transferase; 1.70A {Homo sapiens} PDB: 4eyj_A* 4eym_A* 3coi_A Back     alignment and structure
>4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* Back     alignment and structure
>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} PDB: 3uib_A* Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>1nd4_A Aminoglycoside 3'-phosphotransferase; protein kinase, ATPase, kanamycin; HET: KAN; 2.10A {Klebsiella pneumoniae} SCOP: d.144.1.6 Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Back     alignment and structure
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Back     alignment and structure
>2r3i_A Cell division protein kinase 2; serine/threonine-protein kinase, cell cycle, inhibition, cyclin-dependent kinase, cancer, ATP-binding; HET: SCF; 1.28A {Homo sapiens} PDB: 2r3j_A* 2r3k_A* 2r3l_A* 2r3m_A* 2r3n_A* 2r3o_A* 2r3p_A* 2r3q_A* 1jvp_P* 1buh_A 1ckp_A* 1di8_A* 1dm2_A* 1f5q_A 1fin_A* 1fq1_B* 1fvt_A* 1fvv_A* 1g5s_A* 1gih_A* ... Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 4gsb_A* 4gt3_A* 4gva_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3zu7_A 3zuv_A* 3o71_A 3r63_A 3c9w_A* 2y9q_A* 4fmq_A* ... Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 4ec9_A* 4ec8_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* 4bch_A* 4bci_A* 4bcj_A* 4bcf_A* Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} PDB: 3fpq_A Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* 4azf_A* Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} SCOP: d.144.1.0 PDB: 3kmw_A* 3rep_A* Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 4g5j_A* 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* ... Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Back     alignment and structure
>3tm0_A Aminoglycoside 3'-phosphotransferase; protein kinase, phosphorylation, transferase-antibiotic COMP; HET: ANP B31; 2.10A {Enterococcus faecalis} SCOP: d.144.1.6 PDB: 2b0q_A* 1l8t_A* 3q2j_A* 1j7i_A* 1j7u_A* 3h8p_A* 1j7l_A* 2bkk_A* Back     alignment and structure
>3dxp_A Putative acyl-COA dehydrogenase; protein kinase-like fold, structural genomics, joint center structural genomics, JCSG; 2.32A {Ralstonia eutropha JMP134} Back     alignment and structure
>4gkh_A Aminoglycoside 3'-phosphotransferase APHA1-IAB; pyrazolopyrimidine, 1-Na-PP1, bumped kinase inhibitor, BKI, kinase inhibitor; HET: KAN 0J9; 1.86A {Acinetobacter baumannii} PDB: 4feu_A* 4few_A* 4fex_A* 4fev_A* 4gki_A* 4ej7_A* 3r78_A* Back     alignment and structure
>3sg8_A APH(2'')-ID; antibiotic resistance enzyme, transferase, aminoglycoside, phosphorylation, transferase-antibiotic complex; HET: TOY; 1.80A {Enterococcus casseliflavus} PDB: 3sg9_A* 3n4v_A 3n4t_A 3n4u_A 3r81_A* 3r80_A* 3r7z_A* 3r82_A* 3vcq_A* 4dbx_A 4de4_A* 4dfb_A* 4dfu_A* 4dt9_A* 4dt8_A* 4dtb_A* 3sgc_A 4dta_A* 3lzh_A Back     alignment and structure
>2olc_A MTR kinase, methylthioribose kinase; kinase ADP-2HO complex, transferase; HET: CPS ADP; 2.00A {Bacillus subtilis} SCOP: d.144.1.6 PDB: 2pu8_A* 2pui_A* 2pul_A* 2pun_A* 2pup_A* Back     alignment and structure
>3ats_A Putative uncharacterized protein; hypothetical protein, putative aminoglycoside phosphortransf transferase; 1.67A {Mycobacterium tuberculosis} PDB: 3att_A* Back     alignment and structure
>3tdw_A Gentamicin resistance protein; kinase, phosphoryl transfer, antibiotic resistance, transfer; HET: GDP; 1.70A {Enterococcus gallinarum} PDB: 3tdv_A* Back     alignment and structure
>2q83_A YTAA protein; 2635576, structural genomics, joint center for structu genomics, JCSG, protein structure initiative, PSI-2, transf; HET: ADN CIT UNL; 2.50A {Bacillus subtilis} Back     alignment and structure
>3f7w_A Putative fructosamine-3-kinase; YP_290396.1, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI-2; 1.85A {Thermobifida fusca YX} Back     alignment and structure
>1zyl_A Hypothetical protein YIHE; putative protein kinase, structural genomics, PSI, protein structure initiative; 2.80A {Escherichia coli} SCOP: d.144.1.6 Back     alignment and structure
>3i1a_A Spectinomycin phosphotransferase; protein kinase, aminoglycoside phosphotransferase, antibiotic resistance; HET: MES PG4; 1.70A {Legionella pneumophila} PDB: 3i0q_A* 3i0o_A* 3q2m_A* Back     alignment and structure
>2ppq_A HSK, HK, homoserine kinase; structural genomics, MCSG, PSI-2, protein structure initiative; 2.00A {Agrobacterium tumefaciens str} SCOP: d.144.1.6 Back     alignment and structure
>3c5i_A Choline kinase; choline, kinase, malaria, transferase, structural genomics, structural genomics consortium; 2.20A {Plasmodium knowlesi} PDB: 3fi8_A* Back     alignment and structure
>3dxq_A Choline/ethanolamine kinase family protein; NP_106042.1, STR genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 2.55A {Mesorhizobium loti} Back     alignment and structure
>3jr1_A Putative fructosamine-3-kinase; YP_719053.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 2.32A {Haemophilus somnus 129PT} Back     alignment and structure
>3feg_A Choline/ethanolamine kinase; non-protein kinase, choline kinase, structural genomics CONS SGC, hemicholinium-3, phosphorylation; HET: HC7 ADP AMP; 1.30A {Homo sapiens} PDB: 3lq3_A* 2ig7_A* Back     alignment and structure
>3csv_A Aminoglycoside phosphotransferase; YP_614837.1, phosphotransferase enzyme family, structural genomics, JOIN for structural genomics, JCSG; HET: MSE; 2.15A {Silicibacter SP} Back     alignment and structure
>2pyw_A Uncharacterized protein; 5-methylthioribose kinase, plant methionine recycling, refol transferase; HET: SR1 ADP; 1.90A {Arabidopsis thaliana} Back     alignment and structure
>1nw1_A Choline kinase (49.2 KD); phospholipid synthesis, protein kinase fold, transferase; 2.02A {Caenorhabditis elegans} SCOP: d.144.1.8 Back     alignment and structure
>3mes_A Choline kinase; malaria, structural genomics, structural genomics consortium, SGC, transferase; HET: ADP DME PT3; 2.35A {Cryptosporidium parvum} Back     alignment and structure
>2qg7_A Ethanolamine kinase PV091845; malaria, SGC, structural genomics consortium, transferase; 2.41A {Plasmodium vivax} Back     alignment and structure
>3g15_A CK, chetk-alpha, choline kinase alpha; non-protein kinase, structural genomics CONS SGC, hemicholinium-3, transferase; HET: ADP HC6; 1.70A {Homo sapiens} PDB: 3f2r_A* 2i7q_A 2cko_A 2ckp_A* 2ckq_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query475
d1zara2191 Rio2 serine protein kinase C-terminal domain {Arch 99.73
d1yhwa1 293 pak1 {Human (Homo sapiens) [TaxId: 9606]} 99.56
d1sm2a_263 Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie 99.54
d1opja_ 287 Abelsone tyrosine kinase (abl) {Mouse (Mus musculu 99.52
d2jfla1 288 STE20-like serine/threonine-protein kinase, SLK {H 99.51
d1qpca_ 272 Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax 99.51
d1phka_ 277 gamma-subunit of glycogen phosphorylase kinase (Ph 99.5
d2j4za1263 Aurora-related kinase 1 (aurora-2) {Human (Homo sa 99.49
d1nvra_ 271 Cell cycle checkpoint kinase chk1 {Human (Homo sap 99.49
d1koba_ 352 Twitchin, kinase domain {California sea hare (Aply 99.48
d1u5ra_ 309 Serine/threonine protein kinase TAO2 {Rat (Rattus 99.48
d1fmka3 285 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 99.47
d1xbba_ 277 Tyrosine-protein kinase SYK {Human (Homo sapiens) 99.47
d1u59a_ 285 Tyrosine-protein kinase ZAP-70 {Human (Homo sapien 99.46
d1koaa2 350 Twitchin, kinase domain {Caenorhabditis elegans, p 99.46
d1t4ha_270 Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 99.46
d1s9ja_ 322 Dual specificity mitogen-activated protein kinase 99.46
d1k2pa_258 Bruton's tyrosine kinase (Btk) {Human (Homo sapien 99.46
d1a06a_ 307 Calmodulin-dependent protein kinase {Rat (Rattus n 99.45
d1jpaa_ 299 ephb2 receptor tyrosine kinase {Mouse (Mus musculu 99.44
d1tkia_ 321 Titin, kinase domain {Human (Homo sapiens) [TaxId: 99.44
d1jksa_ 293 Death-associated protein kinase, Dap {Human (Homo 99.43
d3bqca1 328 Protein kinase CK2, alpha subunit {Rattus norvegic 99.43
d1uwha_ 276 B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} 99.42
d1uu3a_ 288 3-phosphoinositide dependent protein kinase-1 Pdk1 99.42
d1mqba_ 283 epha2 receptor tyrosine kinase {Human (Homo sapien 99.42
d2java1269 Serine/threonine-protein kinase Nek2 {Human (Homo 99.42
d1ywna1 299 Vascular endothelial growth factor receptor 2 (kdr 99.41
d1omwa3 364 G-protein coupled receptor kinase 2 {Cow (Bos taur 99.4
d1o6ya_ 277 Mycobacterial protein kinase PknB, catalytic domai 99.4
d1lufa_301 Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax 99.4
d1ua2a_ 299 Cell division protein kinase 7, CDK7 {Human (Homo 99.4
d1rjba_325 Fl cytokine receptor {Human (Homo sapiens) [TaxId: 99.38
d1fota_ 316 cAMP-dependent PK, catalytic subunit {Baker's yeas 99.37
d1ckia_ 299 Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax 99.36
d1t46a_ 311 c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] 99.36
d2ozaa1 335 MAP kinase activated protein kinase 2, mapkap2 {Hu 99.35
d1rdqe_ 350 cAMP-dependent PK, catalytic subunit {Mouse (Mus m 99.35
d1o6la_ 337 Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 99.34
d1csna_ 293 Casein kinase-1, CK1 {Fission yeast (Schizosacchar 99.34
d1xjda_ 320 Protein kinase C, theta type {Human (Homo sapiens) 99.33
d1p4oa_ 308 Insulin-like growth factor 1 receptor {Human (Homo 99.33
d1mp8a_ 273 Focal adhesion kinase 1 (fak) {Human (Homo sapiens 99.33
d1fgka_ 299 Fibroblast growth factor receptor 1 {Human (Homo s 99.32
d1gz8a_ 298 Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T 99.32
d1ob3a_ 286 Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) 99.32
d1r0pa_ 311 Hepatocyte growth factor receptor, c-MET {Human (H 99.31
d1cm8a_ 346 MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 99.31
d1xwsa_273 Proto-oncogene serine/threonine-protein kinase Pim 99.3
d1q5ka_ 350 Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho 99.28
d1unla_ 292 Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [T 99.28
d1pmea_ 345 MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 99.27
d1u46a_273 Activated CDC42 kinase 1, ACK1 {Human (Homo sapien 99.27
d1fvra_ 309 Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} 99.26
d2gfsa1 348 MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] 99.25
d1xkka_ 317 EGF receptor tyrosine kinase, Erbb-1 {Human (Homo 99.24
d1byga_262 Carboxyl-terminal src kinase (csk) {Human (Homo sa 99.22
d1vjya_ 303 Type I TGF-beta receptor R4 {Human (Homo sapiens) 99.2
d1vzoa_ 322 Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( 99.16
d2b1pa1 355 c-jun N-terminal kinase (jnk3s) {Human (Homo sapie 99.14
d3blha1 318 Cell division protein kinase 9, CDK9 {Human (Homo 99.11
d1blxa_ 305 Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T 99.1
d1q8ya_ 362 Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T 98.9
d1nd4a_255 Aminoglycoside 3'-phosphotransferase IIa (Kanamyci 98.45
d1zyla1 325 RdoA {Escherichia coli [TaxId: 562]} 98.18
d1j7la_ 263 Type IIIa 3',5"-aminoglycoside phosphotransferase 97.43
d2pula1 392 Methylthioribose kinase MtnK {Bacillus subtilis [T 97.33
d1nw1a_ 395 Choline kinase {Caenorhabditis elegans [TaxId: 623 96.0
d2ppqa1 316 Homoserine kinase ThrB {Agrobacterium tumefaciens 94.66
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: RIO1-like kinases
domain: Rio2 serine protein kinase C-terminal domain
species: Archaeoglobus fulgidus [TaxId: 2234]
Probab=99.73  E-value=1.3e-18  Score=159.03  Aligned_cols=146  Identities=14%  Similarity=0.092  Sum_probs=100.0

Q ss_pred             ccccccccceEEEeeecCCCEEEEEEecCCcccchhhHHHHHHHHHHHhccccCccCHHHHHHHHHHHhHHHhhHHHHHH
Q 011921          291 EPMAAASIGQVHRAVTKDGMQVAMKIQYPGVADSIESDIQNVKILLDYTNLIPKGLYLDSAMKVAREELSRECDYEMEAA  370 (475)
Q Consensus       291 ~PIAaASIGQVHrA~L~dG~~VAVKVqrPgI~~~i~~DL~~l~~l~~~~~~~p~~~~l~~iv~e~~~~L~~ELDf~~EA~  370 (475)
                      ++||+|++|+||+|+..+|++|||||+|++.......  ...+.        ........         ........|.+
T Consensus         6 ~~IG~G~~g~Vy~a~~~~g~~vAvKi~r~~~~~~~~~--~~~~~--------~~~~~~~~---------~~~~~~~~e~~   66 (191)
T d1zara2           6 KLMGEGKESAVFNCYSEKFGECVVKFHKVGHTSFKKV--KEKRD--------YGDLHFSV---------LAIRSARNEFR   66 (191)
T ss_dssp             EEEEECSSEEEEEEEETTTEEEEEEEECC------CC--CC---------------CHHH---------HHHHHHHHHHH
T ss_pred             CEeeeCcceEEEEEECCCCCEEEEEEEecccchhhhh--hhhhh--------hccHHHHH---------HHHHHHHHHHH
Confidence            5799999999999999999999999999876421000  00000        00000000         11123455777


Q ss_pred             HHHHHHHhhcCCCCeeeceeecCCCCCceEEeecccCCCchhhhccCHHHHHHHHHHHHHHHHHHHHHCCcccC---Ccc
Q 011921          371 NQKRFRDVLSNAKGFYVPYVVDDTSSKRVLTTELVSGIPIDKVAQLSQETRNYVGKKLLELTLMELFVFRFMQR---WLS  447 (475)
Q Consensus       371 N~~rf~~~~~~~~~V~VP~Vy~elst~rVLVMEyIeG~~L~d~~~l~~~~r~~ia~~ll~~~L~~lf~~G~~H~---PGN  447 (475)
                      ++.++.       .+.+|..|.  ....+|+|||++|.++.++   +......++.++++ .+..+|..|++|+   |+|
T Consensus        67 ~l~~l~-------~~~v~~~~~--~~~~~lvme~~~~~~~~~l---~~~~~~~i~~ql~~-~l~~lH~~giiHrDiKP~N  133 (191)
T d1zara2          67 ALQKLQ-------GLAVPKVYA--WEGNAVLMELIDAKELYRV---RVENPDEVLDMILE-EVAKFYHRGIVHGDLSQYN  133 (191)
T ss_dssp             HHHHTT-------TSSSCCEEE--EETTEEEEECCCCEEGGGC---CCSCHHHHHHHHHH-HHHHHHHTTEECSCCSTTS
T ss_pred             HHHHcc-------CCCcceEEE--ecCCEEEEEeeccccccch---hhHHHHHHHHHHHH-HHHHHhhCCEEEccCChhh
Confidence            776653       466788775  4567999999999887664   33344567777777 7889999999999   999


Q ss_pred             cccc---cceEEecccccCCcccc
Q 011921          448 FLPW---IYILIEGRCSNLFPELN  468 (475)
Q Consensus       448 ILl~---l~LiDFG~~~~l~pe~~  468 (475)
                      ||++   ++|+|||+++...++..
T Consensus       134 ILv~~~~~~liDFG~a~~~~~~~~  157 (191)
T d1zara2         134 VLVSEEGIWIIDFPQSVEVGEEGW  157 (191)
T ss_dssp             EEEETTEEEECCCTTCEETTSTTH
T ss_pred             eeeeCCCEEEEECCCcccCCCCCc
Confidence            9998   99999999988865543



>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nd4a_ d.144.1.6 (A:) Aminoglycoside 3'-phosphotransferase IIa (Kanamycin kinase) {Bacteria (Klebsiella pneumoniae) [TaxId: 573]} Back     information, alignment and structure
>d1zyla1 d.144.1.6 (A:4-328) RdoA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j7la_ d.144.1.6 (A:) Type IIIa 3',5"-aminoglycoside phosphotransferase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2pula1 d.144.1.6 (A:5-396) Methylthioribose kinase MtnK {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1nw1a_ d.144.1.8 (A:) Choline kinase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2ppqa1 d.144.1.6 (A:5-320) Homoserine kinase ThrB {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure