Citrus Sinensis ID: 011992


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470---
MEAGRNLLSSPPSFPSRTRVKHSLSSSASSSSSSSVLMHNEQSAPAVASVPTSSVARHFPTSVLLQEQRDEYRPLLHMFKEDKTSQATSDSRNIETEAFFVEEKNSGDLDQLVQDLEHQFLHWPDLWNLSPPMKRGEDPSVSLTMQSLSNDTEESVDAEPFDAVALARKALSASKEAASLAENPKLNGAEFTDISLTSSLGYPLEEVKQFSQPRFLERRSKKRKVSKPQVTNHETYNSRKASVKKKLSEGFDRNDPLRLFLWGPETRKLLTADEEFELIAQIQDLIRLEKEKSKLQSQFGREPTLIEWAKAIGLSCRDLKSELHSGNSSREKLINANLRLVVHVAKQYQGRGISLHDLLQEGSMGLMKSVEKFKPQAGCRFANTGVEIPDISVQKQLMRQHVRNLLTLLNPKERCIVRLRFGIEDGKPKSLSEVGNIFGLSKERVRQLESRALYRLKQSLGGKASYGYADLLI
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccccccccccHHcHHcccccHHHHHHHHcccccHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcHHHHHHHHccccccccccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccccHHHHHHHHccccccccHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHcHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHcccHHHHHHHHHHHHHHHccccccccccccccccc
ccccHHcccccccccccccccccccccccccccccccccccccccccccccccHHHccccccHcccccccccccHHHHHccccHHHHcHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHcccHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHcccccHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHcHcccccccEEEEHEccccccccccccccHHHHHHHHHHHHHHHHcccHcccccHHHHHHHHHHHcccccccccHHHHHHHHcccHHHHHHHHHHHHHHHHccccccccHHHcHEcc
meagrnllssppsfpsrtrvkhslsssasssssssVLMHneqsapavasvptssvarhfptsvllqeqrdeyrpllhmfkedktsqatsdsrnIETEAFFveeknsgdlDQLVQDLEHqflhwpdlwnlsppmkrgedpsvsltmqslsndteesvdaepfDAVALARKALSASKEAAslaenpklngaeftdisltsslgypleevkqfsqprflerrskkrkvskpqvtnhetynSRKASVKKKLsegfdrndplrlflwgpetrklltaDEEFELIAQIQDLIRLEKEKSKLQSQFGREPTLIEWAKAIGLSCRdlkselhsgnssREKLINANLRLVVHVAKQYqgrgislhdLLQEGSMGLMKSVEkfkpqagcrfantgveipdisVQKQLMRQHVRNLLtllnpkerCIVRLRFgiedgkpkslsevgnIFGLSKERVRQLESRALYRLKQSLggkasygyadlli
meagrnllssppsfpsrtrVKHSLSSSASSSSSSSVLMHNEQSAPAVASVPTSSVARHFPTSVLLQEQRDEYRPLLHMfkedktsqatsdsrNIETEAFFVEEKNSGDLDQLVQDLEHQFLHWPDLWNLSPPMKRGEDPSVSLTMQSLSNDTEESVDAEPFDAVALARKALSASKEAAslaenpklngaeFTDISLTSslgypleevkqfsqprflerrskkrkvskpqvtnhetynsrkasvkkklsegfdrndplrlfLWGPETRKLLTADEEFELIAQIQDLIRLEKEKSKLqsqfgreptLIEWAKAIGLSCRDLKSELHSGNSSREKLINANLRLVVHVAKQYQGRGISLHDLLQEGSMGLMKSVEKFKPQAGCRFANTGVEIPDISVQKQLMRQHVRNlltllnpkerCIVRLRfgiedgkpkslsevgnifglskeRVRQLESRALYrlkqslggkasygyadlli
MEAGRNLLSSPPSFPSRTRVKHslsssasssssssVLMHNEQsapavasvptssvaRHFPTSVLLQEQRDEYRPLLHMFKEDKTSQATSDSRNIETEAFFVEEKNSGDLDQLVQDLEHQFLHWPDLWNLSPPMKRGEDPSVSLTMQSLSNDTEESVDAEPFDavalarkalsaskeaaslaeNPKLNGAEFTDISLTSSLGYPLEEVKQFSQPRFLERRSKKRKVSKPQVTNHETYNSRKASVKKKLSEGFDRNDPLRLFLWGPETRKLLTADEEFELIAQIQDLIRLEKEKSKLQSQFGREPTLIEWAKAIGLSCRDLKSELHSGNSSREKLINANLRLVVHVAKQYQGRGISLHDLLQEGSMGLMKSVEKFKPQAGCRFANTGVEIPDISVQKQLMRQHVRNLLTLLNPKERCIVRLRFGIEDGKPKSLSEVGNIFGLSKERVRQLESRALYRLKQSLGGKASYGYADLLI
**************************************************************************************************FFV******DLDQLVQDLEHQFLHWPDLWNL******************************************************************************************************************************PLRLFLWGPETRKLLTADEEFELIAQIQDLIRLE*********FGREPTLIEWAKAIGLSCRDL************KLINANLRLVVHVAKQYQGRGISLHDLLQEGSMGLMKSVEKFKPQAGCRFANTGVEIPDISVQKQLMRQHVRNLLTLLNPKERCIVRLRFGIEDGKPKSLSEVGNIFGLSKERVRQLESRALYRLKQSLGGKASYGY*****
****************************************************************************************************************VQDLEHQFL***************************************FDAVALARKALSASKEAASLAENPKLNGAEF**************************************************************NDPLRLFLWGPETRKLLTADEEFELIAQIQDLIRLEKEKS*********PTLIEWAKAIGLSCRDLKSELHSGNSSREKLINANLRLVVHVAKQYQGRGISLHDLLQEGSMGLMKSVEKFKPQAGCRFANTGVEIPDISVQKQLMRQHVRNLLTLLNPKE*****************LSEVGNIFGLSKERVRQLESRALYRLKQSL**KASYGYADLLI
******************************************************VARHFPTSVLLQEQRDEYRPLLHMFKED*********RNIETEAFFVEEKNSGDLDQLVQDLEHQFLHWPDLWNLSPPMKRGEDPSVSLTMQS**********AEPFDAVALARKALSASKEAASLAENPKLNGAEFTDISLTSSLGYPLEEVKQFSQPRFLE*************TNHETYNSRKASVKKKLSEGFDRNDPLRLFLWGPETRKLLTADEEFELIAQIQDLIRLEKEKSKLQSQFGREPTLIEWAKAIGLSCRDLK********SREKLINANLRLVVHVAKQYQGRGISLHDLLQEGSMGLMKSVEKFKPQAGCRFANTGVEIPDISVQKQLMRQHVRNLLTLLNPKERCIVRLRFGIEDGKPKSLSEVGNIFGLSKERVRQLESRALYRLKQSLGGKASYGYADLLI
************************************************************************RPLLHMFKEDKTSQATSDSRNIETEAFFVE***SGDLDQLVQDLEHQFLHWPDLWNLSPPMKRGEDPSVSLTMQSLSNDTEESVDAEPFDAVALARKALSASKEAASLAENPKLNGAEFTDISLTSSLGYPLEEVKQFSQPRFLERRSKKRKVSKPQVTNHETYNSRKASVKKKLSEGFDRNDPLRLFLWGPETRKLLTADEEFELIAQIQDLIRLEKEKSKLQSQFGREPTLIEWAKAIGLSCRDLKSELHSGNSSREKLINANLRLVVHVAKQYQGRGISLHDLLQEGSMGLMKSVEKFKPQAGCRFANTGVEIPDISVQKQLMRQHVRNLLTLLNPKERCIVRLRFGIEDGKPKSLSEVGNIFGLSKERVRQLESRALYRLKQSLGGKASYGYADLLI
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEAGRNLLSSPPSFPSRTRVKHSLSSSASSSSSSSVLMHNEQSAPAVASVPTSSVARHFPTSVLLQEQRDEYRPLLHMFKEDKTSQATSDSRNIETEAFFVEEKNSGDLDQLVQDLEHQFLHWPDLWNLSPPMKRGEDPSVSLTMQSLSNDTEESVDAEPFDAVALARKALSASKEAASLAENPKLNGAEFTDISLTSSLGYPLEEVKQFSQPRFLERRSKKRKVSKPQVTNHETYNSRKASVKKKLSEGFDRNDPLRLFLWGPETRKLLTADEEFExxxxxxxxxxxxxxxxxxxxxFGREPTLIEWAKAIGLSCRDLKSELHSGNSSREKLINANLRLVVHVAKQYQGRGISLHDLLQEGSMGLMKSVEKFKPQAGCRFANTGVEIPDISVQKQLMRQHVRNLLTLLNPKERCIVRLRFGIEDGKPKSLSEVGNIFGLSKERVRQLESRALYRLKQSLGGKASYGYADLLI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query473 2.2.26 [Sep-21-2011]
Q9LD95547 RNA polymerase sigma fact yes no 0.744 0.643 0.494 7e-85
O22056572 RNA polymerase sigma fact no no 0.427 0.353 0.360 5e-29
P26683390 RNA polymerase sigma fact yes no 0.348 0.423 0.365 1e-24
Q31ME3320 RNA polymerase sigma fact yes no 0.397 0.587 0.323 3e-22
Q31QG5320 RNA polymerase sigma fact no no 0.243 0.359 0.456 8e-22
P38023399 RNA polymerase sigma fact no no 0.272 0.323 0.418 1e-21
Q03065332 RNA polymerase sigma-B fa no no 0.310 0.442 0.360 3e-18
Q59996404 Probable RNA polymerase s N/A no 0.399 0.467 0.296 3e-18
Q03066416 RNA polymerase sigma-C fa no no 0.274 0.312 0.329 6e-16
P74565425 RNA polymerase sigma fact N/A no 0.298 0.331 0.306 1e-15
>sp|Q9LD95|SIGF_ARATH RNA polymerase sigma factor sigF, chloroplastic OS=Arabidopsis thaliana GN=SIGF PE=1 SV=1 Back     alignment and function desciption
 Score =  315 bits (806), Expect = 7e-85,   Method: Compositional matrix adjust.
 Identities = 193/390 (49%), Positives = 248/390 (63%), Gaps = 38/390 (9%)

Query: 1   MEAGRNLLSSPPSFPSRTRVKHSLSSSASSSSSSSVLMHNEQSAPAVASVPTSSVARHFP 60
           MEA RNL+SS PSF ++T +K     S+ SS SS V++H++ + P V S   +S++RHFP
Sbjct: 1   MEATRNLVSSSPSFQTKTHLK-----SSYSSPSSVVMLHDQTTTPVVNSRHLNSLSRHFP 55

Query: 61  TSVLLQEQRDEYRPLLHMFKEDKTSQATSDSRNIETEAFFVEEKNSGDLDQLV-----QD 115
            SVL QE R+E RPL H  ++D+TSQ T + R                 D+LV     + 
Sbjct: 56  ASVLSQEPREESRPLSHALRDDRTSQLTLERRQ---------------FDELVSSREDEK 100

Query: 116 LEHQFLHWPDLWNL--SPPMKRGEDPSVSLTMQSLSNDTEESVDAEPFDAVALARKALSA 173
            E Q LH   LWNL  SP     + P+V   +           DAE  D VALA+KALSA
Sbjct: 101 FEQQLLHSTGLWNLLISPLTSETKLPAVVSPL----------ADAELCDVVALAQKALSA 150

Query: 174 SKEAASLAENPKLNGAE-FTDISLTSSLGYPLEEVKQFSQPRFLERRSKKRKVSKPQVTN 232
           SK+AA L ++ + N ++   D   TSS     E+       R LERR+K R+  K    +
Sbjct: 151 SKQAALLVDDTEANPSDNIKDSLSTSSSMSLPEKGNIVRSKRQLERRAKNRRAPKSNDVD 210

Query: 233 HETYNSRKASVKKKLSEGFDRNDPLRLFLWGPETRKLLTADEEFELIAQIQDLIRLEKEK 292
            E Y  +K S KKK  +G D +D L+LFLWGPET++LLTA EE ELI+ IQ L++LEK K
Sbjct: 211 DEGYVPQKTSAKKKYKQGADNDDALQLFLWGPETKQLLTAKEEAELISHIQHLLKLEKVK 270

Query: 293 SKLQSQFGREPTLIEWAKAIGLSCRDLKSELHSGNSSREKLINANLRLVVHVAKQYQGRG 352
           +KL+SQ G EPT+ EWA+A+G+S   LKS++H G SSREKLI ANLRLVVH+AKQYQ RG
Sbjct: 271 TKLESQNGCEPTIGEWAEAMGISSPVLKSDIHRGRSSREKLITANLRLVVHIAKQYQNRG 330

Query: 353 ISLHDLLQEGSMGLMKSVEKFKPQAGCRFA 382
           ++  DLLQEGSMGLMKSVEKFKPQ+GCRFA
Sbjct: 331 LNFQDLLQEGSMGLMKSVEKFKPQSGCRFA 360




Sigma factors are initiation factors that promote the attachment of plastid-encoded RNA polymerase (PEP) to specific initiation sites and are then released. Regulates transcription in chloroplast in a DG1-dependent manner. Involved in light-dependent chloroplast development. Required during early plant development and primary leaf formation.
Arabidopsis thaliana (taxid: 3702)
>sp|O22056|SIGB_ARATH RNA polymerase sigma factor sigB OS=Arabidopsis thaliana GN=SIGB PE=2 SV=2 Back     alignment and function description
>sp|P26683|RPOD_NOSS1 RNA polymerase sigma factor RpoD OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rpoD PE=3 SV=1 Back     alignment and function description
>sp|Q31ME3|RPOD2_SYNE7 RNA polymerase sigma factor rpoD2 OS=Synechococcus elongatus (strain PCC 7942) GN=rpoD2 PE=1 SV=1 Back     alignment and function description
>sp|Q31QG5|RPOD3_SYNE7 RNA polymerase sigma factor rpoD3 OS=Synechococcus elongatus (strain PCC 7942) GN=rpoD3 PE=3 SV=1 Back     alignment and function description
>sp|P38023|RPOD1_SYNE7 RNA polymerase sigma factor rpoD1 OS=Synechococcus elongatus (strain PCC 7942) GN=rpoD1 PE=3 SV=2 Back     alignment and function description
>sp|Q03065|RPSB_NOSS1 RNA polymerase sigma-B factor OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=sigB PE=3 SV=1 Back     alignment and function description
>sp|Q59996|RPSC_SYNY3 Probable RNA polymerase sigma-C factor OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sigC PE=3 SV=1 Back     alignment and function description
>sp|Q03066|RPSC_NOSS1 RNA polymerase sigma-C factor OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=sigC PE=3 SV=2 Back     alignment and function description
>sp|P74565|RPOD_SYNY3 RNA polymerase sigma factor RpoD OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=rpoD PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query473
224068757535 predicted protein [Populus trichocarpa] 0.782 0.691 0.550 1e-116
297741628561 unnamed protein product [Vitis vinifera] 0.909 0.766 0.520 1e-115
359481391572 PREDICTED: RNA polymerase sigma factor r 0.928 0.767 0.516 1e-113
255556952548 RNA polymerase sigma factor rpoD, putati 0.807 0.697 0.551 1e-113
356536959571 PREDICTED: RNA polymerase sigma factor r 0.841 0.697 0.525 3e-98
356548319 574 PREDICTED: RNA polymerase sigma factor r 0.843 0.695 0.501 2e-96
449451030562 PREDICTED: RNA polymerase sigma factor s 0.824 0.693 0.495 3e-90
312282671547 unnamed protein product [Thellungiella h 0.746 0.645 0.506 6e-87
297827203546 RNA polymerase sigma-70 factor [Arabidop 0.742 0.642 0.502 8e-86
18404292547 RNApolymerase sigma-subunit F [Arabidops 0.744 0.643 0.494 4e-83
>gi|224068757|ref|XP_002326192.1| predicted protein [Populus trichocarpa] gi|222833385|gb|EEE71862.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  423 bits (1088), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 223/405 (55%), Positives = 285/405 (70%), Gaps = 35/405 (8%)

Query: 1   MEAGRNLLSSPPSFPSRTRVKHSLSSSASSSSSSSVLMHNEQSAPAVASVPTSSVARHFP 60
           MEAGR LLSS PSFP+RT +K+SL+SS        VL+  EQ+ PAV+S+PT+S A+HFP
Sbjct: 1   MEAGRTLLSSSPSFPTRTHLKNSLTSS--------VLILREQATPAVSSIPTTSTAQHFP 52

Query: 61  TSVLLQEQRDEYRPLLHMFKEDKTSQATSDSRNIETEAFFVEEKNSGDLDQLVQDLEHQF 120
           TSVLLQEQRDE+RPL ++FKED+ SQAT D R  E      E K+S +LDQLV++ E+Q 
Sbjct: 53  TSVLLQEQRDEFRPLQNIFKEDRASQATLDRRKTEIGTSGHEGKDSDELDQLVENFEYQL 112

Query: 121 LHWPDLWNLSPPMKRGEDPSVSLTMQSLSNDTEESVDAEPFDAVALARKALSASKEAASL 180
            HWP  WNL                      T++ +D EP + + LA++ALSASK AA L
Sbjct: 113 HHWPAYWNL----------------------TDKLIDVEPTNVINLAKRALSASKHAAFL 150

Query: 181 AENPKLNGAEFTDISLTSSLGYPLEEVKQFSQPRFLERRSKKRKVSKPQVTNHETYNSRK 240
           A+N      +  +++ TSS  + LEEVK     R L R+S  R+  K +    ETY+S+ 
Sbjct: 151 ADN----NTDLDNLASTSSSSFSLEEVKIVRSRRHLARQSLNRRAPKTKDLIFETYDSKS 206

Query: 241 ASVKKKLSEGFDRNDPLRLFLWGPETRKLLTADEEFELIAQIQDLIRLEKEKSKLQSQFG 300
           A ++K+LS+GFD NDPLRLFLWGPET++LLTA EEFELIAQIQDL+ LE  K++L+SQFG
Sbjct: 207 ADIQKRLSQGFDPNDPLRLFLWGPETKQLLTAKEEFELIAQIQDLMNLEGVKNRLESQFG 266

Query: 301 REPTLIEWAKAIGLSCRDLKSELHSGNSSREKLINANLRLVVHVAKQYQGRGISLHDLLQ 360
           REPTL+EWA+A+GLSC  LK +LHSGN SREKLINANLR+VVH+AK+YQ RG+ L DLLQ
Sbjct: 267 REPTLVEWAQAVGLSCHVLKLQLHSGNRSREKLINANLRMVVHIAKRYQNRGLGLQDLLQ 326

Query: 361 EGSMGLMKSVEKFKPQAGCRFANTGVEIPDISVQKQLMRQHVRNL 405
           EG++GLMKS+EKFKPQAGCRFA         ++ K +  QH R +
Sbjct: 327 EGTVGLMKSIEKFKPQAGCRFATYAYWWIRQTITKAIF-QHSRTI 370




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|297741628|emb|CBI32760.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359481391|ref|XP_002276710.2| PREDICTED: RNA polymerase sigma factor rpoD [Vitis vinifera] Back     alignment and taxonomy information
>gi|255556952|ref|XP_002519509.1| RNA polymerase sigma factor rpoD, putative [Ricinus communis] gi|223541372|gb|EEF42923.1| RNA polymerase sigma factor rpoD, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356536959|ref|XP_003536999.1| PREDICTED: RNA polymerase sigma factor rpoD-like [Glycine max] Back     alignment and taxonomy information
>gi|356548319|ref|XP_003542550.1| PREDICTED: RNA polymerase sigma factor rpoD [Glycine max] Back     alignment and taxonomy information
>gi|449451030|ref|XP_004143265.1| PREDICTED: RNA polymerase sigma factor sigF, chloroplastic-like [Cucumis sativus] gi|449482444|ref|XP_004156283.1| PREDICTED: RNA polymerase sigma factor sigF, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|312282671|dbj|BAJ34201.1| unnamed protein product [Thellungiella halophila] Back     alignment and taxonomy information
>gi|297827203|ref|XP_002881484.1| RNA polymerase sigma-70 factor [Arabidopsis lyrata subsp. lyrata] gi|297327323|gb|EFH57743.1| RNA polymerase sigma-70 factor [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|18404292|ref|NP_565856.1| RNApolymerase sigma-subunit F [Arabidopsis thaliana] gi|75173811|sp|Q9LD95.1|SIGF_ARATH RecName: Full=RNA polymerase sigma factor sigF, chloroplastic; Short=Sigma factor F; Short=Sigma-F; AltName: Full=Protein SINGLET OXYGEN-LINKED DEATH ACTIVATOR 8; AltName: Full=RNA polymerase sigma factor sig6; Short=Atsig6; Short=Sigma factor 6; Flags: Precursor gi|7209640|dbj|BAA92288.1| SigF [Arabidopsis thaliana] gi|7688083|emb|CAB89775.1| sigma factor-like protein [Arabidopsis thaliana] gi|16604647|gb|AAL24116.1| putative RNA polymerase sigma-70 factor [Arabidopsis thaliana] gi|20197948|gb|AAD31584.2| putative RNA polymerase sigma-70 factor [Arabidopsis thaliana] gi|20259557|gb|AAM14121.1| putative RNA polymerase sigma-70 factor protein [Arabidopsis thaliana] gi|330254238|gb|AEC09332.1| RNApolymerase sigma-subunit F [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query473
TAIR|locus:2057996547 SIGF "AT2G36990" [Arabidopsis 0.733 0.634 0.412 1.2e-56
UNIPROTKB|Q84LK8572 SIG6 "Sig6" [Oryza sativa Japo 0.503 0.416 0.359 1.1e-36
TAIR|locus:2025650572 SIG2 "AT1G08540" [Arabidopsis 0.522 0.431 0.337 3.8e-30
UNIPROTKB|Q59563323 mysB "RNA polymerase sigma fac 0.164 0.241 0.455 2.7e-23
TIGR_CMR|DET_0551520 DET_0551 "RNA polymerase sigma 0.143 0.130 0.420 2.2e-21
TIGR_CMR|VC_0534335 VC_0534 "RNA polymerase sigma 0.312 0.441 0.314 1.6e-20
TIGR_CMR|CPS_1079296 CPS_1079 "RNA polymerase sigma 0.164 0.263 0.397 8.8e-18
TIGR_CMR|CBU_1669352 CBU_1669 "RNA polymerase sigma 0.342 0.460 0.301 1.2e-17
TIGR_CMR|SPO_1750660 SPO_1750 "RNA polymerase sigma 0.131 0.093 0.444 2.2e-17
UNIPROTKB|Q9KUK1625 VC_0517 "RNA polymerase sigma 0.230 0.174 0.350 3.5e-17
TAIR|locus:2057996 SIGF "AT2G36990" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 583 (210.3 bits), Expect = 1.2e-56, P = 1.2e-56
 Identities = 155/376 (41%), Positives = 211/376 (56%)

Query:    85 SQATSDSRNIETEAFFVEEKNSGDLDQLVQD--LEHQFLHWPDLWNL--SPPMKRGEDPS 140
             S A  D R   T    +E +   +L    +D   E Q LH   LWNL  SP     + P+
Sbjct:    71 SHALRDDR---TSQLTLERRQFDELVSSREDEKFEQQLLHSTGLWNLLISPLTSETKLPA 127

Query:   141 VSLTMQSLSNDTEESVDAEPFDXXXXXXXXXXXXXXXXXXXXNPKLNGAE-FTD-ISLTS 198
             V   +  L+       DAE  D                    + + N ++   D +S +S
Sbjct:   128 V---VSPLA-------DAELCDVVALAQKALSASKQAALLVDDTEANPSDNIKDSLSTSS 177

Query:   199 SLGYPLEEVKQFSQPRFLERRSKKRKVSKPQVTNHETYNSRKASVKKKLSEGFDRNDPLR 258
             S+  P E+       R LERR+K R+  K    + E Y  +K S KKK  +G D +D L+
Sbjct:   178 SMSLP-EKGNIVRSKRQLERRAKNRRAPKSNDVDDEGYVPQKTSAKKKYKQGADNDDALQ 236

Query:   259 LFLWGPETRKLLTADEEFELIAQIQDLIRLEKEKSKLQSQFGREPTLIEWAKAIGLSCRD 318
             LFLWGPET++LLTA EE ELI+ IQ L++LEK K+KL+SQ G EPT+ EWA+A+G+S   
Sbjct:   237 LFLWGPETKQLLTAKEEAELISHIQHLLKLEKVKTKLESQNGCEPTIGEWAEAMGISSPV 296

Query:   319 LKSELHSGNSSREKLINANLRLVVHVAKQYQGRGISLHDLLQEGSMGLMKSVEKFKPQAG 378
             LKS++H G SSREKLI ANLRLVVH+AKQYQ RG++  DLLQEGSMGLMKSVEKFKPQ+G
Sbjct:   297 LKSDIHRGRSSREKLITANLRLVVHIAKQYQNRGLNFQDLLQEGSMGLMKSVEKFKPQSG 356

Query:   379 CRFANTGVEIPDISVQKQLMRQH--VR---NLLTLLNPKERCIVRLRFGIEDGKPK-SLS 432
             CRFA         S++K + +    +R   N+  LL        R +  +++G  + S  
Sbjct:   357 CRFATYAYWWIRQSIRKSIFQNSRTIRLPENVYMLLGKVSEA--R-KTCVQEGNYRPSKE 413

Query:   433 EVGNIFGLSKERVRQL 448
             E+    G+S E++ +L
Sbjct:   414 ELAGHVGVSTEKLDKL 429


GO:0003677 "DNA binding" evidence=ISS
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0003899 "DNA-directed RNA polymerase activity" evidence=ISS
GO:0005634 "nucleus" evidence=ISM
GO:0006355 "regulation of transcription, DNA-dependent" evidence=ISS
GO:0006352 "DNA-dependent transcription, initiation" evidence=TAS
GO:0009507 "chloroplast" evidence=IDA
GO:0009536 "plastid" evidence=IDA
GO:0016987 "sigma factor activity" evidence=ISS;IDA
GO:0071483 "cellular response to blue light" evidence=IEP
GO:0045893 "positive regulation of transcription, DNA-dependent" evidence=RCA;IMP
GO:0071482 "cellular response to light stimulus" evidence=IMP
GO:0090351 "seedling development" evidence=IMP
GO:0001053 "plastid sigma factor activity" evidence=IMP
GO:0005515 "protein binding" evidence=IPI
GO:0009902 "chloroplast relocation" evidence=RCA
GO:0009965 "leaf morphogenesis" evidence=RCA
GO:0010027 "thylakoid membrane organization" evidence=RCA
GO:0016117 "carotenoid biosynthetic process" evidence=RCA
GO:0019288 "isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway" evidence=RCA
GO:0030154 "cell differentiation" evidence=RCA
GO:0034660 "ncRNA metabolic process" evidence=RCA
UNIPROTKB|Q84LK8 SIG6 "Sig6" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2025650 SIG2 "AT1G08540" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q59563 mysB "RNA polymerase sigma factor" [Mycobacterium tuberculosis (taxid:1773)] Back     alignment and assigned GO terms
TIGR_CMR|DET_0551 DET_0551 "RNA polymerase sigma factor RpoD" [Dehalococcoides ethenogenes 195 (taxid:243164)] Back     alignment and assigned GO terms
TIGR_CMR|VC_0534 VC_0534 "RNA polymerase sigma factor RpoS" [Vibrio cholerae O1 biovar El Tor (taxid:686)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_1079 CPS_1079 "RNA polymerase sigma factor RpoS" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
TIGR_CMR|CBU_1669 CBU_1669 "RNA polymerase sigma factor RpoS" [Coxiella burnetii RSA 493 (taxid:227377)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_1750 SPO_1750 "RNA polymerase sigma-70 factor RpoD" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
UNIPROTKB|Q9KUK1 VC_0517 "RNA polymerase sigma factor" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query473
TIGR02997298 TIGR02997, Sig70-cyanoRpoD, RNA polymerase sigma f 3e-36
PRK07406373 PRK07406, PRK07406, RNA polymerase sigma factor Rp 5e-31
PRK07405317 PRK07405, PRK07405, RNA polymerase sigma factor Si 4e-30
PRK05949327 PRK05949, PRK05949, RNA polymerase sigma factor; V 4e-27
COG0568342 COG0568, RpoD, DNA-directed RNA polymerase, sigma 1e-22
PRK07598415 PRK07598, PRK07598, RNA polymerase sigma factor Si 6e-22
TIGR02997298 TIGR02997, Sig70-cyanoRpoD, RNA polymerase sigma f 2e-20
COG0568342 COG0568, RpoD, DNA-directed RNA polymerase, sigma 3e-19
TIGR02393238 TIGR02393, RpoD_Cterm, RNA polymerase sigma factor 2e-18
PRK05901509 PRK05901, PRK05901, RNA polymerase sigma factor; P 5e-17
TIGR02846227 TIGR02846, spore_sigmaK, RNA polymerase sigma-K fa 2e-16
PRK07406373 PRK07406, PRK07406, RNA polymerase sigma factor Rp 4e-16
PRK05803233 PRK05803, PRK05803, sporulation sigma factor SigK; 5e-16
TIGR02393238 TIGR02393, RpoD_Cterm, RNA polymerase sigma factor 6e-16
PRK07921324 PRK07921, PRK07921, RNA polymerase sigma factor Si 1e-15
TIGR02835234 TIGR02835, spore_sigmaE, RNA polymerase sigma-E fa 3e-15
PRK09210367 PRK09210, PRK09210, RNA polymerase sigma factor Rp 5e-15
PRK07598415 PRK07598, PRK07598, RNA polymerase sigma factor Si 7e-15
PRK05901509 PRK05901, PRK05901, RNA polymerase sigma factor; P 8e-15
TIGR02394285 TIGR02394, rpoS_proteo, RNA polymerase sigma facto 1e-14
TIGR02937158 TIGR02937, sigma70-ECF, RNA polymerase sigma facto 1e-14
PRK05657325 PRK05657, PRK05657, RNA polymerase sigma factor Rp 3e-14
PRK05949327 PRK05949, PRK05949, RNA polymerase sigma factor; V 8e-14
PRK07921324 PRK07921, PRK07921, RNA polymerase sigma factor Si 9e-14
TIGR02392270 TIGR02392, rpoH_proteo, alternative sigma factor R 1e-12
pfam0454550 pfam04545, Sigma70_r4, Sigma-70, region 4 4e-12
PRK09210367 PRK09210, PRK09210, RNA polymerase sigma factor Rp 6e-12
PRK06596284 PRK06596, PRK06596, RNA polymerase factor sigma-32 7e-12
TIGR02394285 TIGR02394, rpoS_proteo, RNA polymerase sigma facto 2e-11
pfam0454271 pfam04542, Sigma70_r2, Sigma-70 region 2 2e-11
PRK05658619 PRK05658, PRK05658, RNA polymerase sigma factor Rp 3e-11
TIGR02980227 TIGR02980, SigBFG, RNA polymerase sigma-70 factor, 8e-11
PRK07405317 PRK07405, PRK07405, RNA polymerase sigma factor Si 1e-10
PRK08215258 PRK08215, PRK08215, sporulation sigma factor SigG; 2e-10
cd0617155 cd06171, Sigma70_r4, Sigma70, region (SR) 4 refers 3e-10
PRK05657325 PRK05657, PRK05657, RNA polymerase sigma factor Rp 1e-09
TIGR02850254 TIGR02850, spore_sigG, RNA polymerase sigma-G fact 2e-09
COG1191247 COG1191, FliA, DNA-directed RNA polymerase special 2e-09
PRK07500289 PRK07500, rpoH2, RNA polymerase factor sigma-32; R 2e-09
COG1191247 COG1191, FliA, DNA-directed RNA polymerase special 5e-09
PRK05658619 PRK05658, PRK05658, RNA polymerase sigma factor Rp 6e-09
PRK07500 289 PRK07500, rpoH2, RNA polymerase factor sigma-32; R 5e-08
PRK05572252 PRK05572, PRK05572, sporulation sigma factor SigF; 5e-08
PRK08301234 PRK08301, PRK08301, sporulation sigma factor SigE; 9e-08
TIGR02885231 TIGR02885, spore_sigF, RNA polymerase sigma-F fact 1e-07
TIGR02980227 TIGR02980, SigBFG, RNA polymerase sigma-70 factor, 2e-07
TIGR02479224 TIGR02479, FliA_WhiG, RNA polymerase sigma factor, 3e-07
TIGR02392270 TIGR02392, rpoH_proteo, alternative sigma factor R 4e-07
PRK08301234 PRK08301, PRK08301, sporulation sigma factor SigE; 7e-07
PRK07670251 PRK07670, PRK07670, RNA polymerase sigma factor Si 6e-06
TIGR02885231 TIGR02885, spore_sigF, RNA polymerase sigma-F fact 8e-06
PRK06596284 PRK06596, PRK06596, RNA polymerase factor sigma-32 3e-05
PRK07122264 PRK07122, PRK07122, RNA polymerase sigma factor Si 3e-05
PRK06986236 PRK06986, fliA, flagellar biosynthesis sigma facto 6e-05
PRK06288268 PRK06288, PRK06288, RNA polymerase sigma factor Wh 5e-04
PRK05572252 PRK05572, PRK05572, sporulation sigma factor SigF; 0.002
COG1595182 COG1595, RpoE, DNA-directed RNA polymerase special 0.002
PRK05911257 PRK05911, PRK05911, RNA polymerase sigma factor si 0.002
>gnl|CDD|234082 TIGR02997, Sig70-cyanoRpoD, RNA polymerase sigma factor, cyanobacterial RpoD-like family Back     alignment and domain information
 Score =  135 bits (342), Expect = 3e-36
 Identities = 60/113 (53%), Positives = 81/113 (71%)

Query: 269 LLTADEEFELIAQIQDLIRLEKEKSKLQSQFGREPTLIEWAKAIGLSCRDLKSELHSGNS 328
           LLT +EE EL  Q+Q ++ LE+ + +L+ Q GREP+  EWA A GLS  +L+  L  G  
Sbjct: 15  LLTPEEEIELARQVQQMMVLEELREELEEQLGREPSKEEWAAAAGLSEAELRQRLRQGQR 74

Query: 329 SREKLINANLRLVVHVAKQYQGRGISLHDLLQEGSMGLMKSVEKFKPQAGCRF 381
           ++EK+I ANLRLVV VAK+YQ RG+ L DL+QEGS+GL ++VEKF P  G +F
Sbjct: 75  AKEKMIKANLRLVVSVAKKYQNRGLELLDLIQEGSLGLERAVEKFDPTRGYKF 127


This family includes a number of closely related sigma-70 (TIGR02937) factors in the cyanobacteria. All appear most closely related to the essential sigma-70 factor RpoD, and some score above trusted to the RpoD C-terminal domain model (TIGR02393). Length = 298

>gnl|CDD|236012 PRK07406, PRK07406, RNA polymerase sigma factor RpoD; Validated Back     alignment and domain information
>gnl|CDD|180963 PRK07405, PRK07405, RNA polymerase sigma factor SigD; Validated Back     alignment and domain information
>gnl|CDD|180321 PRK05949, PRK05949, RNA polymerase sigma factor; Validated Back     alignment and domain information
>gnl|CDD|223642 COG0568, RpoD, DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) [Transcription] Back     alignment and domain information
>gnl|CDD|236067 PRK07598, PRK07598, RNA polymerase sigma factor SigC; Validated Back     alignment and domain information
>gnl|CDD|234082 TIGR02997, Sig70-cyanoRpoD, RNA polymerase sigma factor, cyanobacterial RpoD-like family Back     alignment and domain information
>gnl|CDD|223642 COG0568, RpoD, DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) [Transcription] Back     alignment and domain information
>gnl|CDD|213709 TIGR02393, RpoD_Cterm, RNA polymerase sigma factor RpoD, C-terminal domain Back     alignment and domain information
>gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional Back     alignment and domain information
>gnl|CDD|131893 TIGR02846, spore_sigmaK, RNA polymerase sigma-K factor Back     alignment and domain information
>gnl|CDD|236012 PRK07406, PRK07406, RNA polymerase sigma factor RpoD; Validated Back     alignment and domain information
>gnl|CDD|180266 PRK05803, PRK05803, sporulation sigma factor SigK; Reviewed Back     alignment and domain information
>gnl|CDD|213709 TIGR02393, RpoD_Cterm, RNA polymerase sigma factor RpoD, C-terminal domain Back     alignment and domain information
>gnl|CDD|181169 PRK07921, PRK07921, RNA polymerase sigma factor SigB; Reviewed Back     alignment and domain information
>gnl|CDD|131882 TIGR02835, spore_sigmaE, RNA polymerase sigma-E factor Back     alignment and domain information
>gnl|CDD|236413 PRK09210, PRK09210, RNA polymerase sigma factor RpoD; Validated Back     alignment and domain information
>gnl|CDD|236067 PRK07598, PRK07598, RNA polymerase sigma factor SigC; Validated Back     alignment and domain information
>gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional Back     alignment and domain information
>gnl|CDD|131447 TIGR02394, rpoS_proteo, RNA polymerase sigma factor RpoS Back     alignment and domain information
>gnl|CDD|234065 TIGR02937, sigma70-ECF, RNA polymerase sigma factor, sigma-70 family Back     alignment and domain information
>gnl|CDD|235548 PRK05657, PRK05657, RNA polymerase sigma factor RpoS; Validated Back     alignment and domain information
>gnl|CDD|180321 PRK05949, PRK05949, RNA polymerase sigma factor; Validated Back     alignment and domain information
>gnl|CDD|181169 PRK07921, PRK07921, RNA polymerase sigma factor SigB; Reviewed Back     alignment and domain information
>gnl|CDD|233844 TIGR02392, rpoH_proteo, alternative sigma factor RpoH Back     alignment and domain information
>gnl|CDD|218139 pfam04545, Sigma70_r4, Sigma-70, region 4 Back     alignment and domain information
>gnl|CDD|236413 PRK09210, PRK09210, RNA polymerase sigma factor RpoD; Validated Back     alignment and domain information
>gnl|CDD|235838 PRK06596, PRK06596, RNA polymerase factor sigma-32; Reviewed Back     alignment and domain information
>gnl|CDD|131447 TIGR02394, rpoS_proteo, RNA polymerase sigma factor RpoS Back     alignment and domain information
>gnl|CDD|218138 pfam04542, Sigma70_r2, Sigma-70 region 2 Back     alignment and domain information
>gnl|CDD|235549 PRK05658, PRK05658, RNA polymerase sigma factor RpoD; Validated Back     alignment and domain information
>gnl|CDD|234078 TIGR02980, SigBFG, RNA polymerase sigma-70 factor, sigma-B/F/G subfamily Back     alignment and domain information
>gnl|CDD|180963 PRK07405, PRK07405, RNA polymerase sigma factor SigD; Validated Back     alignment and domain information
>gnl|CDD|181296 PRK08215, PRK08215, sporulation sigma factor SigG; Reviewed Back     alignment and domain information
>gnl|CDD|100119 cd06171, Sigma70_r4, Sigma70, region (SR) 4 refers to the most C-terminal of four conserved domains found in Escherichia coli (Ec) sigma70, the main housekeeping sigma, and related sigma-factors (SFs) Back     alignment and domain information
>gnl|CDD|235548 PRK05657, PRK05657, RNA polymerase sigma factor RpoS; Validated Back     alignment and domain information
>gnl|CDD|131897 TIGR02850, spore_sigG, RNA polymerase sigma-G factor Back     alignment and domain information
>gnl|CDD|224112 COG1191, FliA, DNA-directed RNA polymerase specialized sigma subunit [Transcription] Back     alignment and domain information
>gnl|CDD|236033 PRK07500, rpoH2, RNA polymerase factor sigma-32; Reviewed Back     alignment and domain information
>gnl|CDD|224112 COG1191, FliA, DNA-directed RNA polymerase specialized sigma subunit [Transcription] Back     alignment and domain information
>gnl|CDD|235549 PRK05658, PRK05658, RNA polymerase sigma factor RpoD; Validated Back     alignment and domain information
>gnl|CDD|236033 PRK07500, rpoH2, RNA polymerase factor sigma-32; Reviewed Back     alignment and domain information
>gnl|CDD|180137 PRK05572, PRK05572, sporulation sigma factor SigF; Validated Back     alignment and domain information
>gnl|CDD|236228 PRK08301, PRK08301, sporulation sigma factor SigE; Reviewed Back     alignment and domain information
>gnl|CDD|131931 TIGR02885, spore_sigF, RNA polymerase sigma-F factor Back     alignment and domain information
>gnl|CDD|234078 TIGR02980, SigBFG, RNA polymerase sigma-70 factor, sigma-B/F/G subfamily Back     alignment and domain information
>gnl|CDD|233885 TIGR02479, FliA_WhiG, RNA polymerase sigma factor, FliA/WhiG family Back     alignment and domain information
>gnl|CDD|233844 TIGR02392, rpoH_proteo, alternative sigma factor RpoH Back     alignment and domain information
>gnl|CDD|236228 PRK08301, PRK08301, sporulation sigma factor SigE; Reviewed Back     alignment and domain information
>gnl|CDD|181075 PRK07670, PRK07670, RNA polymerase sigma factor SigD; Validated Back     alignment and domain information
>gnl|CDD|131931 TIGR02885, spore_sigF, RNA polymerase sigma-F factor Back     alignment and domain information
>gnl|CDD|235838 PRK06596, PRK06596, RNA polymerase factor sigma-32; Reviewed Back     alignment and domain information
>gnl|CDD|168831 PRK07122, PRK07122, RNA polymerase sigma factor SigF; Reviewed Back     alignment and domain information
>gnl|CDD|235901 PRK06986, fliA, flagellar biosynthesis sigma factor; Validated Back     alignment and domain information
>gnl|CDD|235770 PRK06288, PRK06288, RNA polymerase sigma factor WhiG; Reviewed Back     alignment and domain information
>gnl|CDD|180137 PRK05572, PRK05572, sporulation sigma factor SigF; Validated Back     alignment and domain information
>gnl|CDD|224511 COG1595, RpoE, DNA-directed RNA polymerase specialized sigma subunit, sigma24 homolog [Transcription] Back     alignment and domain information
>gnl|CDD|235644 PRK05911, PRK05911, RNA polymerase sigma factor sigma-28; Reviewed Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 473
PRK07598415 RNA polymerase sigma factor SigC; Validated 100.0
TIGR02997298 Sig70-cyanoRpoD RNA polymerase sigma factor, cyano 100.0
PRK05949327 RNA polymerase sigma factor; Validated 100.0
PRK07405317 RNA polymerase sigma factor SigD; Validated 100.0
PRK07406373 RNA polymerase sigma factor RpoD; Validated 100.0
PRK07921324 RNA polymerase sigma factor SigB; Reviewed 99.97
PRK05901509 RNA polymerase sigma factor; Provisional 99.97
COG0568342 RpoD DNA-directed RNA polymerase, sigma subunit (s 99.96
PRK09210367 RNA polymerase sigma factor RpoD; Validated 99.96
PRK05658619 RNA polymerase sigma factor RpoD; Validated 99.92
TIGR02393238 RpoD_Cterm RNA polymerase sigma factor RpoD, C-ter 99.92
COG1191247 FliA DNA-directed RNA polymerase specialized sigma 99.91
PRK05657325 RNA polymerase sigma factor RpoS; Validated 99.91
TIGR02392270 rpoH_proteo alternative sigma factor RpoH. A sigma 99.91
PRK06596284 RNA polymerase factor sigma-32; Reviewed 99.9
PRK07500289 rpoH2 RNA polymerase factor sigma-32; Reviewed 99.9
TIGR02394285 rpoS_proteo RNA polymerase sigma factor RpoS. A si 99.9
PRK05803233 sporulation sigma factor SigK; Reviewed 99.88
PRK07122264 RNA polymerase sigma factor SigF; Reviewed 99.87
PRK05911257 RNA polymerase sigma factor sigma-28; Reviewed 99.87
PRK08215258 sporulation sigma factor SigG; Reviewed 99.86
TIGR02850254 spore_sigG RNA polymerase sigma-G factor. Members 99.86
TIGR02941255 Sigma_B RNA polymerase sigma-B factor. This sigma 99.85
PRK07408256 RNA polymerase sigma factor SigF; Reviewed 99.85
PRK08583257 RNA polymerase sigma factor SigB; Validated 99.85
PRK06288268 RNA polymerase sigma factor WhiG; Reviewed 99.84
PRK05602186 RNA polymerase sigma factor; Reviewed 99.84
TIGR02846227 spore_sigmaK RNA polymerase sigma-K factor. The sp 99.84
PRK07670251 RNA polymerase sigma factor SigD; Validated 99.82
PRK09646194 RNA polymerase sigma factor SigK; Reviewed 99.82
PRK08301234 sporulation sigma factor SigE; Reviewed 99.81
TIGR02835234 spore_sigmaE RNA polymerase sigma-E factor. Member 99.81
PRK09648189 RNA polymerase sigma factor SigD; Reviewed 99.81
PRK06986236 fliA flagellar biosynthesis sigma factor; Validate 99.8
PRK12513194 RNA polymerase sigma factor; Provisional 99.8
TIGR02952170 Sig70_famx2 RNA polymerase sigma-70 factor, TIGR02 99.8
TIGR02980227 SigBFG RNA polymerase sigma-70 factor, sigma-B/F/G 99.8
PRK12514179 RNA polymerase sigma factor; Provisional 99.8
PRK05572252 sporulation sigma factor SigF; Validated 99.8
PRK12427231 flagellar biosynthesis sigma factor; Provisional 99.8
TIGR02885231 spore_sigF RNA polymerase sigma-F factor. Members 99.8
PRK12538233 RNA polymerase sigma factor; Provisional 99.8
PRK12524196 RNA polymerase sigma factor; Provisional 99.79
PRK09641187 RNA polymerase sigma factor SigW; Provisional 99.79
PRK06811189 RNA polymerase factor sigma-70; Validated 99.79
TIGR02948187 SigW_bacill RNA polymerase sigma-W factor. This si 99.79
TIGR02939190 RpoE_Sigma70 RNA polymerase sigma factor RpoE. A s 99.79
PRK12537182 RNA polymerase sigma factor; Provisional 99.79
PRK08295208 RNA polymerase factor sigma-70; Validated 99.79
PRK06759154 RNA polymerase factor sigma-70; Validated 99.79
PRK13919186 putative RNA polymerase sigma E protein; Provision 99.79
PRK12542185 RNA polymerase sigma factor; Provisional 99.78
PRK12534187 RNA polymerase sigma factor; Provisional 99.78
PRK12515189 RNA polymerase sigma factor; Provisional 99.78
TIGR02479224 FliA_WhiG RNA polymerase sigma factor, FliA/WhiG f 99.77
PRK09652182 RNA polymerase sigma factor RpoE; Provisional 99.77
PRK11923193 algU RNA polymerase sigma factor AlgU; Provisional 99.77
PRK12519194 RNA polymerase sigma factor; Provisional 99.77
PRK09638176 RNA polymerase sigma factor SigY; Reviewed 99.77
PRK09643192 RNA polymerase sigma factor SigM; Reviewed 99.77
TIGR02954169 Sig70_famx3 RNA polymerase sigma-70 factor, TIGR02 99.76
TIGR02859198 spore_sigH RNA polymerase sigma-H factor. Members 99.76
PRK12543179 RNA polymerase sigma factor; Provisional 99.76
PRK11924179 RNA polymerase sigma factor; Provisional 99.76
PRK09415179 RNA polymerase factor sigma C; Reviewed 99.76
PRK09640188 RNA polymerase sigma factor SigX; Reviewed 99.75
PRK11922231 RNA polymerase sigma factor; Provisional 99.75
PRK12531194 RNA polymerase sigma factor; Provisional 99.75
TIGR02985161 Sig70_bacteroi1 RNA polymerase sigma-70 factor, Ba 99.75
PRK09645173 RNA polymerase sigma factor SigL; Provisional 99.75
TIGR03001244 Sig-70_gmx1 RNA polymerase sigma-70 factor, Myxoco 99.75
PRK12526206 RNA polymerase sigma factor; Provisional 99.74
PRK12529178 RNA polymerase sigma factor; Provisional 99.74
PRK12520191 RNA polymerase sigma factor; Provisional 99.73
TIGR02989159 Sig-70_gvs1 RNA polymerase sigma-70 factor, Rhodop 99.73
PRK12539184 RNA polymerase sigma factor; Provisional 99.73
PRK12522173 RNA polymerase sigma factor; Provisional 99.73
PRK09642160 RNA polymerase sigma factor SigW; Reviewed 99.72
TIGR02984189 Sig-70_plancto1 RNA polymerase sigma-70 factor, Pl 99.72
TIGR02999183 Sig-70_X6 RNA polymerase sigma factor, TIGR02999 f 99.72
PRK12512184 RNA polymerase sigma factor; Provisional 99.72
PRK12518175 RNA polymerase sigma factor; Provisional 99.72
PRK09649185 RNA polymerase sigma factor SigC; Reviewed 99.71
COG1595182 RpoE DNA-directed RNA polymerase specialized sigma 99.71
PRK12516187 RNA polymerase sigma factor; Provisional 99.71
PRK09644165 RNA polymerase sigma factor SigM; Provisional 99.71
PRK12533216 RNA polymerase sigma factor; Provisional 99.71
PRK12523172 RNA polymerase sigma factor; Reviewed 99.71
TIGR02983162 SigE-fam_strep RNA polymerase sigma-70 factor, sig 99.71
PRK12536181 RNA polymerase sigma factor; Provisional 99.7
PRK09647203 RNA polymerase sigma factor SigE; Reviewed 99.7
TIGR02937158 sigma70-ECF RNA polymerase sigma factor, sigma-70 99.69
TIGR02947193 SigH_actino RNA polymerase sigma-70 factor, TIGR02 99.69
PRK12547164 RNA polymerase sigma factor; Provisional 99.69
PRK12528161 RNA polymerase sigma factor; Provisional 99.68
PRK12541161 RNA polymerase sigma factor; Provisional 99.67
PRK09639166 RNA polymerase sigma factor SigX; Provisional 99.67
PRK12517188 RNA polymerase sigma factor; Provisional 99.67
PRK12535196 RNA polymerase sigma factor; Provisional 99.67
PRK09651172 RNA polymerase sigma factor FecI; Provisional 99.67
TIGR02950154 SigM_subfam RNA polymerase sigma factor, SigM fami 99.66
TIGR02960 324 SigX5 RNA polymerase sigma-70 factor, TIGR02960 fa 99.66
TIGR02943188 Sig70_famx1 RNA polymerase sigma-70 factor, TIGR02 99.66
PRK12540182 RNA polymerase sigma factor; Provisional 99.66
PRK12530189 RNA polymerase sigma factor; Provisional 99.65
PRK12527159 RNA polymerase sigma factor; Reviewed 99.65
PRK12545201 RNA polymerase sigma factor; Provisional 99.65
PRK07037163 extracytoplasmic-function sigma-70 factor; Validat 99.65
PRK08241 339 RNA polymerase factor sigma-70; Validated 99.65
PRK12532195 RNA polymerase sigma factor; Provisional 99.65
PRK09637181 RNA polymerase sigma factor SigZ; Provisional 99.65
PRK12544206 RNA polymerase sigma factor; Provisional 99.64
PRK12525168 RNA polymerase sigma factor; Provisional 99.63
TIGR02959170 SigZ RNA polymerase sigma factor, SigZ family. Thi 99.62
PRK12546188 RNA polymerase sigma factor; Provisional 99.61
PRK12511182 RNA polymerase sigma factor; Provisional 99.61
PRK06704228 RNA polymerase factor sigma-70; Validated 99.56
PRK09636 293 RNA polymerase sigma factor SigJ; Provisional 99.55
PRK09191 261 two-component response regulator; Provisional 99.5
PRK09635 290 sigI RNA polymerase sigma factor SigI; Provisional 99.48
TIGR02957 281 SigX4 RNA polymerase sigma-70 factor, TIGR02957 fa 99.48
PRK09047161 RNA polymerase factor sigma-70; Validated 99.47
PRK07122264 RNA polymerase sigma factor SigF; Reviewed 99.46
TIGR02393238 RpoD_Cterm RNA polymerase sigma factor RpoD, C-ter 99.39
TIGR03209142 P21_Cbot clostridium toxin-associated regulator Bo 99.3
PRK05911257 RNA polymerase sigma factor sigma-28; Reviewed 99.3
PF0454550 Sigma70_r4: Sigma-70, region 4; InterPro: IPR00763 99.24
COG1191247 FliA DNA-directed RNA polymerase specialized sigma 99.21
PF07638185 Sigma70_ECF: ECF sigma factor 99.1
TIGR02479224 FliA_WhiG RNA polymerase sigma factor, FliA/WhiG f 99.1
PF0828154 Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013 99.0
PRK12427231 flagellar biosynthesis sigma factor; Provisional 98.94
PRK06930170 positive control sigma-like factor; Validated 98.88
TIGR02895218 spore_sigI RNA polymerase sigma-I factor. Members 98.74
PRK07921324 RNA polymerase sigma factor SigB; Reviewed 98.74
PRK05901509 RNA polymerase sigma factor; Provisional 98.68
PRK08311237 putative RNA polymerase sigma factor SigI; Reviewe 98.6
PRK07406373 RNA polymerase sigma factor RpoD; Validated 98.56
COG0568342 RpoD DNA-directed RNA polymerase, sigma subunit (s 98.56
PRK05658619 RNA polymerase sigma factor RpoD; Validated 98.55
PRK07408256 RNA polymerase sigma factor SigF; Reviewed 98.54
PRK09210367 RNA polymerase sigma factor RpoD; Validated 98.52
PRK00118104 putative DNA-binding protein; Validated 98.51
cd0617155 Sigma70_r4 Sigma70, region (SR) 4 refers to the mo 98.42
PRK07598415 RNA polymerase sigma factor SigC; Validated 98.4
PRK05949327 RNA polymerase sigma factor; Validated 98.4
PF0454271 Sigma70_r2: Sigma-70 region 2 ; InterPro: IPR00762 98.26
PRK04217110 hypothetical protein; Provisional 98.19
PRK07405317 RNA polymerase sigma factor SigD; Validated 98.17
TIGR02997298 Sig70-cyanoRpoD RNA polymerase sigma factor, cyano 98.14
PF04297101 UPF0122: Putative helix-turn-helix protein, YlxM / 98.13
TIGR00721137 tfx DNA-binding protein, Tfx family. Tfx from Meth 98.11
PRK03975141 tfx putative transcriptional regulator; Provisiona 98.11
PRK07500289 rpoH2 RNA polymerase factor sigma-32; Reviewed 98.05
PRK06596284 RNA polymerase factor sigma-32; Reviewed 98.03
TIGR01636134 phage_rinA phage transcriptional activator, RinA f 98.01
TIGR02850254 spore_sigG RNA polymerase sigma-G factor. Members 97.99
PRK06288268 RNA polymerase sigma factor WhiG; Reviewed 97.98
smart0042158 HTH_LUXR helix_turn_helix, Lux Regulon. lux regulo 97.88
PF0453978 Sigma70_r3: Sigma-70 region 3; InterPro: IPR007624 97.87
TIGR0387973 near_KaiC_dom probable regulatory domain. This mod 97.87
TIGR02885231 spore_sigF RNA polymerase sigma-F factor. Members 97.78
PRK08215258 sporulation sigma factor SigG; Reviewed 97.74
PF07374100 DUF1492: Protein of unknown function (DUF1492); In 97.72
TIGR02980227 SigBFG RNA polymerase sigma-70 factor, sigma-B/F/G 97.72
PF0019658 GerE: Bacterial regulatory proteins, luxR family; 97.7
TIGR02392270 rpoH_proteo alternative sigma factor RpoH. A sigma 97.69
PRK07670251 RNA polymerase sigma factor SigD; Validated 97.69
cd0617057 LuxR_C_like C-terminal DNA-binding domain of LuxR- 97.68
PRK05657325 RNA polymerase sigma factor RpoS; Validated 97.59
PF0496753 HTH_10: HTH DNA binding domain; InterPro: IPR00705 97.57
PRK15411207 rcsA colanic acid capsular biosynthesis activation 97.42
PRK05572252 sporulation sigma factor SigF; Validated 97.4
PRK10840216 transcriptional regulator RcsB; Provisional 97.36
PRK11475207 DNA-binding transcriptional activator BglJ; Provis 97.35
TIGR03541232 reg_near_HchA LuxR family transcriptional regulato 97.34
PRK06986236 fliA flagellar biosynthesis sigma factor; Validate 97.34
PRK13719217 conjugal transfer transcriptional regulator TraJ; 97.33
PRK15201198 fimbriae regulatory protein FimW; Provisional 97.33
TIGR03020247 EpsA transcriptional regulator EpsA. Proteins in t 97.31
PRK13870234 transcriptional regulator TraR; Provisional 97.3
PRK10100216 DNA-binding transcriptional regulator CsgD; Provis 97.27
COG2197211 CitB Response regulator containing a CheY-like rec 97.27
PRK10188240 DNA-binding transcriptional activator SdiA; Provis 97.23
TIGR02941255 Sigma_B RNA polymerase sigma-B factor. This sigma 97.13
COG4566202 TtrR Response regulator [Signal transduction mecha 97.1
TIGR0132194 TrpR trp operon repressor, proteobacterial. This m 97.1
PF02001106 DUF134: Protein of unknown function DUF134; InterP 97.08
PF1393644 HTH_38: Helix-turn-helix domain; PDB: 2W48_A. 97.06
PRK09483217 response regulator; Provisional 96.99
COG277165 CsgD DNA-binding HTH domain-containing proteins [T 96.94
PRK15369211 two component system sensor kinase SsrB; Provision 96.93
TIGR01637132 phage_arpU phage transcriptional regulator, ArpU f 96.9
PF0014037 Sigma70_r1_2: Sigma-70 factor, region 1.2; InterPr 96.84
COG3413215 Predicted DNA binding protein [General function pr 96.79
COG2739105 Uncharacterized protein conserved in bacteria [Fun 96.75
PRK09390202 fixJ response regulator FixJ; Provisional 96.71
TIGR02394285 rpoS_proteo RNA polymerase sigma factor RpoS. A si 96.69
PRK10651216 transcriptional regulator NarL; Provisional 96.64
PRK08583257 RNA polymerase sigma factor SigB; Validated 96.36
COG134299 Predicted DNA-binding proteins [General function p 96.21
PRK0138199 Trp operon repressor; Provisional 96.17
PRK10403215 transcriptional regulator NarP; Provisional 96.16
PRK15320251 transcriptional activator SprB; Provisional 96.04
COG1356143 tfx Transcriptional regulator [DNA replication, re 95.96
PRK04841903 transcriptional regulator MalT; Provisional 95.84
PRK09935210 transcriptional regulator FimZ; Provisional 95.73
PRK13558665 bacterio-opsin activator; Provisional 95.68
PRK09958204 DNA-binding transcriptional activator EvgA; Provis 95.65
PF1361353 HTH_Tnp_4: Helix-turn-helix of DDE superfamily end 95.63
TIGR02895218 spore_sigI RNA polymerase sigma-I factor. Members 95.63
PRK10360196 DNA-binding transcriptional activator UhpA; Provis 95.61
COG4941 415 Predicted RNA polymerase sigma factor containing a 95.53
PF0172665 LexA_DNA_bind: LexA DNA binding domain; InterPro: 95.47
PF1341248 HTH_24: Winged helix-turn-helix DNA-binding; PDB: 95.26
PRK15418 318 transcriptional regulator LsrR; Provisional 95.24
PF1338450 HTH_23: Homeodomain-like domain; PDB: 2X48_C. 95.17
TIGR0253188 yecD_yerC TrpR-related protein YerC/YecD. This mod 94.56
cd0056942 HTH_Hin_like Helix-turn-helix domain of Hin and re 94.51
PF06530125 Phage_antitermQ: Phage antitermination protein Q; 94.32
PF05263130 DUF722: Protein of unknown function (DUF722); Inte 93.48
PF1066860 Phage_terminase: Phage terminase small subunit; In 93.3
PF1340442 HTH_AsnC-type: AsnC-type helix-turn-helix domain; 92.98
PF0279645 HTH_7: Helix-turn-helix domain of resolvase; Inter 92.97
TIGR02395429 rpoN_sigma RNA polymerase sigma-54 factor. A sigma 92.96
PF0605658 Terminase_5: Putative ATPase subunit of terminase 92.8
COG2390 321 DeoR Transcriptional regulator, contains sigma fac 92.77
PHA0067578 hypothetical protein 92.73
PF09862113 DUF2089: Protein of unknown function (DUF2089); In 92.7
PRK10430239 DNA-binding transcriptional activator DcuR; Provis 92.63
PF1351852 HTH_28: Helix-turn-helix domain 92.62
COG2909894 MalT ATP-dependent transcriptional regulator [Tran 92.2
PF0421853 CENP-B_N: CENP-B N-terminal DNA-binding domain; In 92.19
PF0032532 Crp: Bacterial regulatory proteins, crp family; In 92.17
smart00351125 PAX Paired Box domain. 91.91
PF1280262 MarR_2: MarR family; PDB: 3ECO_B 2QWW_B 3KP6_B 3KP 91.86
PRK05932455 RNA polymerase factor sigma-54; Reviewed 91.25
PF1373055 HTH_36: Helix-turn-helix domain 91.16
PF1264565 HTH_16: Helix-turn-helix domain; InterPro: IPR0247 90.49
PF0102247 HTH_5: Bacterial regulatory protein, arsR family; 90.19
PRK11083228 DNA-binding response regulator CreB; Provisional 89.84
PF0265085 HTH_WhiA: WhiA C-terminal HTH domain; InterPro: IP 89.45
PF0132560 Fe_dep_repress: Iron dependent repressor, N-termin 89.17
cd00131128 PAX Paired Box domain 89.15
COG3415138 Transposase and inactivated derivatives [DNA repli 89.14
PF0344478 HrcA_DNA-bdg: Winged helix-turn-helix transcriptio 88.9
PHA0259183 hypothetical protein; Provisional 88.68
PF1284061 HTH_20: Helix-turn-helix domain; PDB: 1ULY_A 2CWE_ 88.5
PF0827955 HTH_11: HTH domain; InterPro: IPR013196 Winged hel 88.21
PRK12469481 RNA polymerase factor sigma-54; Provisional 87.97
smart0055068 Zalpha Z-DNA-binding domain in adenosine deaminase 87.92
PF1354252 HTH_Tnp_ISL3: Helix-turn-helix domain of transposa 87.65
PF1374480 HTH_37: Helix-turn-helix domain; PDB: 2A6C_B 2O38_ 87.64
PRK10336219 DNA-binding transcriptional regulator QseB; Provis 87.54
PRK10046225 dpiA two-component response regulator DpiA; Provis 87.4
smart00344108 HTH_ASNC helix_turn_helix ASNC type. AsnC: an auto 87.29
PRK10710240 DNA-binding transcriptional regulator BaeR; Provis 86.76
PF0453978 Sigma70_r3: Sigma-70 region 3; InterPro: IPR007624 86.75
PF0035646 LacI: Bacterial regulatory proteins, lacI family; 86.73
PF1346368 HTH_27: Winged helix DNA-binding domain; PDB: 3GFL 86.59
PF0933952 HTH_IclR: IclR helix-turn-helix domain; InterPro: 86.48
PRK15479221 transcriptional regulatory protein TctD; Provision 86.08
PF0141877 HTH_6: Helix-turn-helix domain, rpiR family; Inter 85.99
TIGR02154226 PhoB phosphate regulon transcriptional regulatory 85.95
PRK12423 202 LexA repressor; Provisional 85.9
PF1272851 HTH_17: Helix-turn-helix domain 85.74
PF13022142 HTH_Tnp_1_2: Helix-turn-helix of insertion element 85.53
PF0137187 Trp_repressor: Trp repressor protein; InterPro: IP 85.49
PF0104759 MarR: MarR family; InterPro: IPR000835 The MarR-ty 85.16
PRK11179153 DNA-binding transcriptional regulator AsnC; Provis 84.44
PF0197868 TrmB: Sugar-specific transcriptional regulator Trm 84.21
CHL00148240 orf27 Ycf27; Reviewed 83.98
TIGR00498 199 lexA SOS regulatory protein LexA. LexA acts as a h 83.57
TIGR0176449 excise DNA binding domain, excisionase family. An 83.12
PRK00215 205 LexA repressor; Validated 82.95
PRK13413200 mpi multiple promoter invertase; Provisional 82.13
TIGR03787227 marine_sort_RR proteobacterial dedicated sortase s 82.07
COG2973103 TrpR Trp operon repressor [Transcription] 82.05
PF0172665 LexA_DNA_bind: LexA DNA binding domain; InterPro: 81.58
cd0476249 HTH_MerR-trunc Helix-Turn-Helix DNA binding domain 81.53
smart0034560 HTH_GNTR helix_turn_helix gluconate operon transcr 81.5
COG1522154 Lrp Transcriptional regulators [Transcription] 81.38
PRK11169164 leucine-responsive transcriptional regulator; Prov 81.31
COG3355126 Predicted transcriptional regulator [Transcription 81.07
PF13551112 HTH_29: Winged helix-turn helix 80.94
PHA0197667 helix-turn-helix protein 80.82
>PRK07598 RNA polymerase sigma factor SigC; Validated Back     alignment and domain information
Probab=100.00  E-value=1.9e-38  Score=331.35  Aligned_cols=219  Identities=39%  Similarity=0.664  Sum_probs=199.1

Q ss_pred             ChhHHhhhcccCccCCCChHHHHHHHHHHHHHHH--------------------HHHHHHHHHHHhCCCCCHHHHHHHcC
Q 011992          254 NDPLRLFLWGPETRKLLTADEEFELIAQIQDLIR--------------------LEKEKSKLQSQFGREPTLIEWAKAIG  313 (473)
Q Consensus       254 ~~~lR~~~~~pr~~~lLT~eEE~~L~~~iq~l~k--------------------le~a~~~L~~~lGRePT~eEiA~~lG  313 (473)
                      .|++|.|++.++++|+||++||++|++++|.+.+                    |++++.+|..++|++||..|||+++|
T Consensus        59 ~d~v~~yl~~igr~~lL~~~eEv~l~~~vq~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~l~~~~g~~pt~~ewa~~~~  138 (415)
T PRK07598         59 TDLVRLYLQEIGRVRLLGRDEEVSEAQKVQRYMKLIVLANAAKEGDEVIKPYLRLIEVRERLTSELGHRPSLERWAKTAD  138 (415)
T ss_pred             CChHHHHHHhcccccCCCHHHHHHHHHHHHHHHHHhhhhhhhhcccchhhhHHHHHHHHHHHHHHhCCCCCHHHHHHHhC
Confidence            4589999999999999999999999999999998                    89999999999999999999995555


Q ss_pred             ----------------------CCHHHHHHHHhhcchHHHHHHHHHHHHHHHHHHHhhcCCcchhhHhhhhHHHHHHHhh
Q 011992          314 ----------------------LSCRDLKSELHSGNSSREKLINANLRLVVHVAKQYQGRGISLHDLLQEGSMGLMKSVE  371 (473)
Q Consensus       314 ----------------------ms~eeL~~~l~~g~~A~e~Li~~yl~lV~sIA~ry~~~~~saEDLiQEg~lgL~kAie  371 (473)
                                            |+.++|...+..|..|+++||..|+++|+++|++|.+++.+++||+|||++|||++++
T Consensus       139 ~~~~~l~~~l~~~~~~~~~~~~l~~~eL~~~l~~G~~A~e~LI~~nlrLVvsiAkky~~~g~~~eDLiQEG~iGL~rave  218 (415)
T PRK07598        139 ISLADLKPTLAEGKRRWAEIAKLTVEELEQIQKQGLRAKEHMIKANLRLVVSVAKKYQNRGLELLDLVQEGTLGLERAVE  218 (415)
T ss_pred             CcHHHHHHhhhhhhhhhhhhccCCHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHccCCCCHHHHHHHHHHHHHHHHH
Confidence                                  5566666667788899999999999999999999999999999999999999999999


Q ss_pred             hhCccCCCccccC-------------------------------------------------------------------
Q 011992          372 KFKPQAGCRFANT-------------------------------------------------------------------  384 (473)
Q Consensus       372 kFDp~kg~~FsT~-------------------------------------------------------------------  384 (473)
                      +|||.+|++|+|+                                                                   
T Consensus       219 kFDp~rG~rFSTYa~wwIRqaI~r~i~~~srtIrlP~~i~e~l~~lrk~~r~L~~~lgR~pt~~EiA~~l~is~~~vr~~  298 (415)
T PRK07598        219 KFDPTKGYRFSTYAYWWIRQGITRAIATQSRTIRLPVHITEKLNKIKKAQRKISQEKGRTPTIEDIAQELEMTPTQVREV  298 (415)
T ss_pred             HcCcccCCCHHHHHHHHHHHHHHHHHHHcCCceehhHHHHHHHHHHHHHHHHHHHHhCCCCCHHHHHHHhCCCHHHHHHH
Confidence            9999999999990                                                                   


Q ss_pred             ----------------------------CCCCchHHHHHHHHHHHHHHHHhhCCHHHHHHHHHHhhccCCCCCCHHHHHH
Q 011992          385 ----------------------------GVEIPDISVQKQLMRQHVRNLLTLLNPKERCIVRLRFGIEDGKPKSLSEVGN  436 (473)
Q Consensus       385 ----------------------------~~~~pee~le~~el~e~L~~aL~~LperER~VL~LrY~L~~ge~lTlkEIAe  436 (473)
                                                  ....|++.+....+...|..+|..||+++|.||.|+|+|+||+++|++|||+
T Consensus       299 l~~~~~~~SLd~~vg~~~d~~l~d~l~~~~~~pee~~~~~~l~~~L~~~L~~L~~reR~VI~LRygl~d~~~~Tl~EIA~  378 (415)
T PRK07598        299 LLRVPRSVSLETKVGKDKDTELGDLLETDDISPEEMLMRESLQRDLQHLLADLTSRERDVIRMRFGLADGHTYSLAEIGR  378 (415)
T ss_pred             HHHccCCcccccccCCCccccHHHhccCCCCCHHHHHHHHHHHHHHHHHHHhCCHHHHHHHHHHHhcCCCCCCCHHHHHH
Confidence                                        0123455566677788899999999999999999999999999999999999


Q ss_pred             HHCCCHHHHHHHHHHHHHHHHHHhccCchhhhhhhh
Q 011992          437 IFGLSKERVRQLESRALYRLKQSLGGKASYGYADLL  472 (473)
Q Consensus       437 ~LGIS~~rVrqi~~RAL~KLR~~L~~~~l~~yldll  472 (473)
                      .||||+++|++++++|++|||+.-....+++|++-|
T Consensus       379 ~LGvS~erVRqie~rAl~KLR~~~~~~~l~~y~~~~  414 (415)
T PRK07598        379 ALDLSRERVRQIESKALQKLRQPKRRNRIRDYLELL  414 (415)
T ss_pred             HHCcCHHHHHHHHHHHHHHHhchhHHHHHHHHHHhc
Confidence            999999999999999999999988888899998754



>TIGR02997 Sig70-cyanoRpoD RNA polymerase sigma factor, cyanobacterial RpoD-like family Back     alignment and domain information
>PRK05949 RNA polymerase sigma factor; Validated Back     alignment and domain information
>PRK07405 RNA polymerase sigma factor SigD; Validated Back     alignment and domain information
>PRK07406 RNA polymerase sigma factor RpoD; Validated Back     alignment and domain information
>PRK07921 RNA polymerase sigma factor SigB; Reviewed Back     alignment and domain information
>PRK05901 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>COG0568 RpoD DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) [Transcription] Back     alignment and domain information
>PRK09210 RNA polymerase sigma factor RpoD; Validated Back     alignment and domain information
>PRK05658 RNA polymerase sigma factor RpoD; Validated Back     alignment and domain information
>TIGR02393 RpoD_Cterm RNA polymerase sigma factor RpoD, C-terminal domain Back     alignment and domain information
>COG1191 FliA DNA-directed RNA polymerase specialized sigma subunit [Transcription] Back     alignment and domain information
>PRK05657 RNA polymerase sigma factor RpoS; Validated Back     alignment and domain information
>TIGR02392 rpoH_proteo alternative sigma factor RpoH Back     alignment and domain information
>PRK06596 RNA polymerase factor sigma-32; Reviewed Back     alignment and domain information
>PRK07500 rpoH2 RNA polymerase factor sigma-32; Reviewed Back     alignment and domain information
>TIGR02394 rpoS_proteo RNA polymerase sigma factor RpoS Back     alignment and domain information
>PRK05803 sporulation sigma factor SigK; Reviewed Back     alignment and domain information
>PRK07122 RNA polymerase sigma factor SigF; Reviewed Back     alignment and domain information
>PRK05911 RNA polymerase sigma factor sigma-28; Reviewed Back     alignment and domain information
>PRK08215 sporulation sigma factor SigG; Reviewed Back     alignment and domain information
>TIGR02850 spore_sigG RNA polymerase sigma-G factor Back     alignment and domain information
>TIGR02941 Sigma_B RNA polymerase sigma-B factor Back     alignment and domain information
>PRK07408 RNA polymerase sigma factor SigF; Reviewed Back     alignment and domain information
>PRK08583 RNA polymerase sigma factor SigB; Validated Back     alignment and domain information
>PRK06288 RNA polymerase sigma factor WhiG; Reviewed Back     alignment and domain information
>PRK05602 RNA polymerase sigma factor; Reviewed Back     alignment and domain information
>TIGR02846 spore_sigmaK RNA polymerase sigma-K factor Back     alignment and domain information
>PRK07670 RNA polymerase sigma factor SigD; Validated Back     alignment and domain information
>PRK09646 RNA polymerase sigma factor SigK; Reviewed Back     alignment and domain information
>PRK08301 sporulation sigma factor SigE; Reviewed Back     alignment and domain information
>TIGR02835 spore_sigmaE RNA polymerase sigma-E factor Back     alignment and domain information
>PRK09648 RNA polymerase sigma factor SigD; Reviewed Back     alignment and domain information
>PRK06986 fliA flagellar biosynthesis sigma factor; Validated Back     alignment and domain information
>PRK12513 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>TIGR02952 Sig70_famx2 RNA polymerase sigma-70 factor, TIGR02952 family Back     alignment and domain information
>TIGR02980 SigBFG RNA polymerase sigma-70 factor, sigma-B/F/G subfamily Back     alignment and domain information
>PRK12514 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK05572 sporulation sigma factor SigF; Validated Back     alignment and domain information
>PRK12427 flagellar biosynthesis sigma factor; Provisional Back     alignment and domain information
>TIGR02885 spore_sigF RNA polymerase sigma-F factor Back     alignment and domain information
>PRK12538 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12524 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK09641 RNA polymerase sigma factor SigW; Provisional Back     alignment and domain information
>PRK06811 RNA polymerase factor sigma-70; Validated Back     alignment and domain information
>TIGR02948 SigW_bacill RNA polymerase sigma-W factor Back     alignment and domain information
>TIGR02939 RpoE_Sigma70 RNA polymerase sigma factor RpoE Back     alignment and domain information
>PRK12537 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK08295 RNA polymerase factor sigma-70; Validated Back     alignment and domain information
>PRK06759 RNA polymerase factor sigma-70; Validated Back     alignment and domain information
>PRK13919 putative RNA polymerase sigma E protein; Provisional Back     alignment and domain information
>PRK12542 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12534 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12515 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>TIGR02479 FliA_WhiG RNA polymerase sigma factor, FliA/WhiG family Back     alignment and domain information
>PRK09652 RNA polymerase sigma factor RpoE; Provisional Back     alignment and domain information
>PRK11923 algU RNA polymerase sigma factor AlgU; Provisional Back     alignment and domain information
>PRK12519 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK09638 RNA polymerase sigma factor SigY; Reviewed Back     alignment and domain information
>PRK09643 RNA polymerase sigma factor SigM; Reviewed Back     alignment and domain information
>TIGR02954 Sig70_famx3 RNA polymerase sigma-70 factor, TIGR02954 family Back     alignment and domain information
>TIGR02859 spore_sigH RNA polymerase sigma-H factor Back     alignment and domain information
>PRK12543 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK11924 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK09415 RNA polymerase factor sigma C; Reviewed Back     alignment and domain information
>PRK09640 RNA polymerase sigma factor SigX; Reviewed Back     alignment and domain information
>PRK11922 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12531 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>TIGR02985 Sig70_bacteroi1 RNA polymerase sigma-70 factor, Bacteroides expansion family 1 Back     alignment and domain information
>PRK09645 RNA polymerase sigma factor SigL; Provisional Back     alignment and domain information
>TIGR03001 Sig-70_gmx1 RNA polymerase sigma-70 factor, Myxococcales family 1 Back     alignment and domain information
>PRK12526 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12529 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12520 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>TIGR02989 Sig-70_gvs1 RNA polymerase sigma-70 factor, Rhodopirellula/Verrucomicrobium family Back     alignment and domain information
>PRK12539 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12522 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK09642 RNA polymerase sigma factor SigW; Reviewed Back     alignment and domain information
>TIGR02984 Sig-70_plancto1 RNA polymerase sigma-70 factor, Planctomycetaceae-specific subfamily 1 Back     alignment and domain information
>TIGR02999 Sig-70_X6 RNA polymerase sigma factor, TIGR02999 family Back     alignment and domain information
>PRK12512 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12518 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK09649 RNA polymerase sigma factor SigC; Reviewed Back     alignment and domain information
>COG1595 RpoE DNA-directed RNA polymerase specialized sigma subunit, sigma24 homolog [Transcription] Back     alignment and domain information
>PRK12516 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK09644 RNA polymerase sigma factor SigM; Provisional Back     alignment and domain information
>PRK12533 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12523 RNA polymerase sigma factor; Reviewed Back     alignment and domain information
>TIGR02983 SigE-fam_strep RNA polymerase sigma-70 factor, sigma-E family Back     alignment and domain information
>PRK12536 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK09647 RNA polymerase sigma factor SigE; Reviewed Back     alignment and domain information
>TIGR02937 sigma70-ECF RNA polymerase sigma factor, sigma-70 family Back     alignment and domain information
>TIGR02947 SigH_actino RNA polymerase sigma-70 factor, TIGR02947 family Back     alignment and domain information
>PRK12547 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12528 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12541 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK09639 RNA polymerase sigma factor SigX; Provisional Back     alignment and domain information
>PRK12517 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12535 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK09651 RNA polymerase sigma factor FecI; Provisional Back     alignment and domain information
>TIGR02950 SigM_subfam RNA polymerase sigma factor, SigM family Back     alignment and domain information
>TIGR02960 SigX5 RNA polymerase sigma-70 factor, TIGR02960 family Back     alignment and domain information
>TIGR02943 Sig70_famx1 RNA polymerase sigma-70 factor, TIGR02943 family Back     alignment and domain information
>PRK12540 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12530 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12527 RNA polymerase sigma factor; Reviewed Back     alignment and domain information
>PRK12545 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK07037 extracytoplasmic-function sigma-70 factor; Validated Back     alignment and domain information
>PRK08241 RNA polymerase factor sigma-70; Validated Back     alignment and domain information
>PRK12532 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK09637 RNA polymerase sigma factor SigZ; Provisional Back     alignment and domain information
>PRK12544 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12525 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>TIGR02959 SigZ RNA polymerase sigma factor, SigZ family Back     alignment and domain information
>PRK12546 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12511 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK06704 RNA polymerase factor sigma-70; Validated Back     alignment and domain information
>PRK09636 RNA polymerase sigma factor SigJ; Provisional Back     alignment and domain information
>PRK09191 two-component response regulator; Provisional Back     alignment and domain information
>PRK09635 sigI RNA polymerase sigma factor SigI; Provisional Back     alignment and domain information
>TIGR02957 SigX4 RNA polymerase sigma-70 factor, TIGR02957 family Back     alignment and domain information
>PRK09047 RNA polymerase factor sigma-70; Validated Back     alignment and domain information
>PRK07122 RNA polymerase sigma factor SigF; Reviewed Back     alignment and domain information
>TIGR02393 RpoD_Cterm RNA polymerase sigma factor RpoD, C-terminal domain Back     alignment and domain information
>TIGR03209 P21_Cbot clostridium toxin-associated regulator BotR Back     alignment and domain information
>PRK05911 RNA polymerase sigma factor sigma-28; Reviewed Back     alignment and domain information
>PF04545 Sigma70_r4: Sigma-70, region 4; InterPro: IPR007630 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>COG1191 FliA DNA-directed RNA polymerase specialized sigma subunit [Transcription] Back     alignment and domain information
>PF07638 Sigma70_ECF: ECF sigma factor Back     alignment and domain information
>TIGR02479 FliA_WhiG RNA polymerase sigma factor, FliA/WhiG family Back     alignment and domain information
>PF08281 Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013249 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>PRK12427 flagellar biosynthesis sigma factor; Provisional Back     alignment and domain information
>PRK06930 positive control sigma-like factor; Validated Back     alignment and domain information
>TIGR02895 spore_sigI RNA polymerase sigma-I factor Back     alignment and domain information
>PRK07921 RNA polymerase sigma factor SigB; Reviewed Back     alignment and domain information
>PRK05901 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK08311 putative RNA polymerase sigma factor SigI; Reviewed Back     alignment and domain information
>PRK07406 RNA polymerase sigma factor RpoD; Validated Back     alignment and domain information
>COG0568 RpoD DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) [Transcription] Back     alignment and domain information
>PRK05658 RNA polymerase sigma factor RpoD; Validated Back     alignment and domain information
>PRK07408 RNA polymerase sigma factor SigF; Reviewed Back     alignment and domain information
>PRK09210 RNA polymerase sigma factor RpoD; Validated Back     alignment and domain information
>PRK00118 putative DNA-binding protein; Validated Back     alignment and domain information
>cd06171 Sigma70_r4 Sigma70, region (SR) 4 refers to the most C-terminal of four conserved domains found in Escherichia coli (Ec) sigma70, the main housekeeping sigma, and related sigma-factors (SFs) Back     alignment and domain information
>PRK07598 RNA polymerase sigma factor SigC; Validated Back     alignment and domain information
>PRK05949 RNA polymerase sigma factor; Validated Back     alignment and domain information
>PF04542 Sigma70_r2: Sigma-70 region 2 ; InterPro: IPR007627 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>PRK04217 hypothetical protein; Provisional Back     alignment and domain information
>PRK07405 RNA polymerase sigma factor SigD; Validated Back     alignment and domain information
>TIGR02997 Sig70-cyanoRpoD RNA polymerase sigma factor, cyanobacterial RpoD-like family Back     alignment and domain information
>PF04297 UPF0122: Putative helix-turn-helix protein, YlxM / p13 like; InterPro: IPR007394 Members of this family are predicted to contain a helix-turn-helix motif, for example residues 37-55 in Mycoplasma mycoides p13 (O05290 from SWISSPROT) Back     alignment and domain information
>TIGR00721 tfx DNA-binding protein, Tfx family Back     alignment and domain information
>PRK03975 tfx putative transcriptional regulator; Provisional Back     alignment and domain information
>PRK07500 rpoH2 RNA polymerase factor sigma-32; Reviewed Back     alignment and domain information
>PRK06596 RNA polymerase factor sigma-32; Reviewed Back     alignment and domain information
>TIGR01636 phage_rinA phage transcriptional activator, RinA family Back     alignment and domain information
>TIGR02850 spore_sigG RNA polymerase sigma-G factor Back     alignment and domain information
>PRK06288 RNA polymerase sigma factor WhiG; Reviewed Back     alignment and domain information
>smart00421 HTH_LUXR helix_turn_helix, Lux Regulon Back     alignment and domain information
>PF04539 Sigma70_r3: Sigma-70 region 3; InterPro: IPR007624 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>TIGR03879 near_KaiC_dom probable regulatory domain Back     alignment and domain information
>TIGR02885 spore_sigF RNA polymerase sigma-F factor Back     alignment and domain information
>PRK08215 sporulation sigma factor SigG; Reviewed Back     alignment and domain information
>PF07374 DUF1492: Protein of unknown function (DUF1492); InterPro: IPR010861 This entry is represented by Streptococcus phage 7201, Orf19 Back     alignment and domain information
>TIGR02980 SigBFG RNA polymerase sigma-70 factor, sigma-B/F/G subfamily Back     alignment and domain information
>PF00196 GerE: Bacterial regulatory proteins, luxR family; InterPro: IPR000792 This domain is a DNA-binding, helix-turn-helix (HTH) domain of about 65 amino acids, present in transcription regulators of the LuxR/FixJ family of response regulators Back     alignment and domain information
>TIGR02392 rpoH_proteo alternative sigma factor RpoH Back     alignment and domain information
>PRK07670 RNA polymerase sigma factor SigD; Validated Back     alignment and domain information
>cd06170 LuxR_C_like C-terminal DNA-binding domain of LuxR-like proteins Back     alignment and domain information
>PRK05657 RNA polymerase sigma factor RpoS; Validated Back     alignment and domain information
>PF04967 HTH_10: HTH DNA binding domain; InterPro: IPR007050 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif Back     alignment and domain information
>PRK15411 rcsA colanic acid capsular biosynthesis activation protein A; Provisional Back     alignment and domain information
>PRK05572 sporulation sigma factor SigF; Validated Back     alignment and domain information
>PRK10840 transcriptional regulator RcsB; Provisional Back     alignment and domain information
>PRK11475 DNA-binding transcriptional activator BglJ; Provisional Back     alignment and domain information
>TIGR03541 reg_near_HchA LuxR family transcriptional regulatory, chaperone HchA-associated Back     alignment and domain information
>PRK06986 fliA flagellar biosynthesis sigma factor; Validated Back     alignment and domain information
>PRK13719 conjugal transfer transcriptional regulator TraJ; Provisional Back     alignment and domain information
>PRK15201 fimbriae regulatory protein FimW; Provisional Back     alignment and domain information
>TIGR03020 EpsA transcriptional regulator EpsA Back     alignment and domain information
>PRK13870 transcriptional regulator TraR; Provisional Back     alignment and domain information
>PRK10100 DNA-binding transcriptional regulator CsgD; Provisional Back     alignment and domain information
>COG2197 CitB Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>PRK10188 DNA-binding transcriptional activator SdiA; Provisional Back     alignment and domain information
>TIGR02941 Sigma_B RNA polymerase sigma-B factor Back     alignment and domain information
>COG4566 TtrR Response regulator [Signal transduction mechanisms] Back     alignment and domain information
>TIGR01321 TrpR trp operon repressor, proteobacterial Back     alignment and domain information
>PF02001 DUF134: Protein of unknown function DUF134; InterPro: IPR002852 The bacterial and archaeal proteins in this family have no known function Back     alignment and domain information
>PF13936 HTH_38: Helix-turn-helix domain; PDB: 2W48_A Back     alignment and domain information
>PRK09483 response regulator; Provisional Back     alignment and domain information
>COG2771 CsgD DNA-binding HTH domain-containing proteins [Transcription] Back     alignment and domain information
>PRK15369 two component system sensor kinase SsrB; Provisional Back     alignment and domain information
>TIGR01637 phage_arpU phage transcriptional regulator, ArpU family Back     alignment and domain information
>PF00140 Sigma70_r1_2: Sigma-70 factor, region 1 Back     alignment and domain information
>COG3413 Predicted DNA binding protein [General function prediction only] Back     alignment and domain information
>COG2739 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK09390 fixJ response regulator FixJ; Provisional Back     alignment and domain information
>TIGR02394 rpoS_proteo RNA polymerase sigma factor RpoS Back     alignment and domain information
>PRK10651 transcriptional regulator NarL; Provisional Back     alignment and domain information
>PRK08583 RNA polymerase sigma factor SigB; Validated Back     alignment and domain information
>COG1342 Predicted DNA-binding proteins [General function prediction only] Back     alignment and domain information
>PRK01381 Trp operon repressor; Provisional Back     alignment and domain information
>PRK10403 transcriptional regulator NarP; Provisional Back     alignment and domain information
>PRK15320 transcriptional activator SprB; Provisional Back     alignment and domain information
>COG1356 tfx Transcriptional regulator [DNA replication, recombination and repair] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PRK09935 transcriptional regulator FimZ; Provisional Back     alignment and domain information
>PRK13558 bacterio-opsin activator; Provisional Back     alignment and domain information
>PRK09958 DNA-binding transcriptional activator EvgA; Provisional Back     alignment and domain information
>PF13613 HTH_Tnp_4: Helix-turn-helix of DDE superfamily endonuclease Back     alignment and domain information
>TIGR02895 spore_sigI RNA polymerase sigma-I factor Back     alignment and domain information
>PRK10360 DNA-binding transcriptional activator UhpA; Provisional Back     alignment and domain information
>COG4941 Predicted RNA polymerase sigma factor containing a TPR repeat domain [Transcription] Back     alignment and domain information
>PF01726 LexA_DNA_bind: LexA DNA binding domain; InterPro: IPR006199 This is the DNA binding domain of the LexA SOS regulon repressor which prevents expression of DNA repair proteins in bacteria Back     alignment and domain information
>PF13412 HTH_24: Winged helix-turn-helix DNA-binding; PDB: 1I1G_B 2IA0_B 3I4P_A 2GQQ_A 2L4A_A 2CFX_B 2DBB_B 2EFO_A 2EFQ_A 2PN6_A Back     alignment and domain information
>PRK15418 transcriptional regulator LsrR; Provisional Back     alignment and domain information
>PF13384 HTH_23: Homeodomain-like domain; PDB: 2X48_C Back     alignment and domain information
>TIGR02531 yecD_yerC TrpR-related protein YerC/YecD Back     alignment and domain information
>cd00569 HTH_Hin_like Helix-turn-helix domain of Hin and related proteins, a family of DNA-binding domains unique to bacteria and represented by the Hin protein of Salmonella Back     alignment and domain information
>PF06530 Phage_antitermQ: Phage antitermination protein Q; InterPro: IPR010534 This entry is represented by Bacteriophage 933W, GpQ Back     alignment and domain information
>PF05263 DUF722: Protein of unknown function (DUF722); InterPro: IPR007927 This entry is represented by Bacteriophage bIL285, Orf38 Back     alignment and domain information
>PF10668 Phage_terminase: Phage terminase small subunit; InterPro: IPR018925 This entry describes the terminase small subunit from Enterococcus phage phiFL1A, related proteins in other bacteriophage, and prophage regions of bacterial genomes Back     alignment and domain information
>PF13404 HTH_AsnC-type: AsnC-type helix-turn-helix domain; PDB: 2ZNY_E 2ZNZ_G 1RI7_A 2CYY_A 2E1C_A 2VC1_B 2QZ8_A 2W29_C 2IVM_B 2VBX_B Back     alignment and domain information
>PF02796 HTH_7: Helix-turn-helix domain of resolvase; InterPro: IPR006120 Site-specific recombination plays an important role in DNA rearrangement in prokaryotic organisms Back     alignment and domain information
>TIGR02395 rpoN_sigma RNA polymerase sigma-54 factor Back     alignment and domain information
>PF06056 Terminase_5: Putative ATPase subunit of terminase (gpP-like); InterPro: IPR010332 This family of proteins are annotated as ATPase subunits of phage terminase after [] Back     alignment and domain information
>COG2390 DeoR Transcriptional regulator, contains sigma factor-related N-terminal domain [Transcription] Back     alignment and domain information
>PHA00675 hypothetical protein Back     alignment and domain information
>PF09862 DUF2089: Protein of unknown function (DUF2089); InterPro: IPR018658 This family consists of various hypothetical prokaryotic proteins Back     alignment and domain information
>PRK10430 DNA-binding transcriptional activator DcuR; Provisional Back     alignment and domain information
>PF13518 HTH_28: Helix-turn-helix domain Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PF04218 CENP-B_N: CENP-B N-terminal DNA-binding domain; InterPro: IPR006695 Centromere Protein B (CENP-B) is a DNA-binding protein localized to the centromere Back     alignment and domain information
>PF00325 Crp: Bacterial regulatory proteins, crp family; InterPro: IPR001808 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif Back     alignment and domain information
>smart00351 PAX Paired Box domain Back     alignment and domain information
>PF12802 MarR_2: MarR family; PDB: 3ECO_B 2QWW_B 3KP6_B 3KP4_B 3KP2_A 3KP5_A 3KP3_B 3KP7_A 3NQO_B 3K0L_B Back     alignment and domain information
>PRK05932 RNA polymerase factor sigma-54; Reviewed Back     alignment and domain information
>PF13730 HTH_36: Helix-turn-helix domain Back     alignment and domain information
>PF12645 HTH_16: Helix-turn-helix domain; InterPro: IPR024760 This domain appears to be a helix-turn-helix domain, suggesting a transcriptional regulatory protein Back     alignment and domain information
>PF01022 HTH_5: Bacterial regulatory protein, arsR family; InterPro: IPR001845 Bacterial transcription regulatory proteins that bind DNA via a helix-turn-helix (HTH) motif can be grouped into families on the basis of sequence similarities Back     alignment and domain information
>PRK11083 DNA-binding response regulator CreB; Provisional Back     alignment and domain information
>PF02650 HTH_WhiA: WhiA C-terminal HTH domain; InterPro: IPR023054 This domain is found at the C terminus of the sporulation regulator WhiA Back     alignment and domain information
>PF01325 Fe_dep_repress: Iron dependent repressor, N-terminal DNA binding domain; InterPro: IPR022687 The DtxR-type HTH domain is a DNA-binding, winged helix-turn-helix (wHTH) domain of about 65 residues present in metalloregulators of the DtxR/MntR family Back     alignment and domain information
>cd00131 PAX Paired Box domain Back     alignment and domain information
>COG3415 Transposase and inactivated derivatives [DNA replication, recombination, and repair] Back     alignment and domain information
>PF03444 HrcA_DNA-bdg: Winged helix-turn-helix transcription repressor, HrcA DNA-binding; InterPro: IPR005104 Prokaryotic cells have a defence mechanism against a sudden heat-shock stress Back     alignment and domain information
>PHA02591 hypothetical protein; Provisional Back     alignment and domain information
>PF12840 HTH_20: Helix-turn-helix domain; PDB: 1ULY_A 2CWE_A 1Y0U_B 2QUF_B 2QLZ_C 2OQG_B 2ZKZ_C 3PQK_A 3PQJ_D 3F6O_B Back     alignment and domain information
>PF08279 HTH_11: HTH domain; InterPro: IPR013196 Winged helix DNA-binding proteins share a related winged helix-turn-helix DNA-binding motif, where the "wings", or loops, are small beta-sheets Back     alignment and domain information
>PRK12469 RNA polymerase factor sigma-54; Provisional Back     alignment and domain information
>smart00550 Zalpha Z-DNA-binding domain in adenosine deaminases Back     alignment and domain information
>PF13542 HTH_Tnp_ISL3: Helix-turn-helix domain of transposase family ISL3 Back     alignment and domain information
>PF13744 HTH_37: Helix-turn-helix domain; PDB: 2A6C_B 2O38_A Back     alignment and domain information
>PRK10336 DNA-binding transcriptional regulator QseB; Provisional Back     alignment and domain information
>PRK10046 dpiA two-component response regulator DpiA; Provisional Back     alignment and domain information
>smart00344 HTH_ASNC helix_turn_helix ASNC type Back     alignment and domain information
>PRK10710 DNA-binding transcriptional regulator BaeR; Provisional Back     alignment and domain information
>PF04539 Sigma70_r3: Sigma-70 region 3; InterPro: IPR007624 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>PF00356 LacI: Bacterial regulatory proteins, lacI family; InterPro: IPR000843 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif Back     alignment and domain information
>PF13463 HTH_27: Winged helix DNA-binding domain; PDB: 3GFL_A 2YR2_B 3GFM_A 3GFJ_A 3GF2_A 3GEZ_A 2GXG_A 3GFI_A 2EB7_A Back     alignment and domain information
>PF09339 HTH_IclR: IclR helix-turn-helix domain; InterPro: IPR005471 The many bacterial transcription regulation proteins which bind DNA through a 'helix-turn-helix' motif can be classified into subfamilies on the basis of sequence similarities Back     alignment and domain information
>PRK15479 transcriptional regulatory protein TctD; Provisional Back     alignment and domain information
>PF01418 HTH_6: Helix-turn-helix domain, rpiR family; InterPro: IPR000281 This domain contains a helix-turn-helix motif [] Back     alignment and domain information
>TIGR02154 PhoB phosphate regulon transcriptional regulatory protein PhoB Back     alignment and domain information
>PRK12423 LexA repressor; Provisional Back     alignment and domain information
>PF12728 HTH_17: Helix-turn-helix domain Back     alignment and domain information
>PF13022 HTH_Tnp_1_2: Helix-turn-helix of insertion element transposase; PDB: 2AO9_I Back     alignment and domain information
>PF01371 Trp_repressor: Trp repressor protein; InterPro: IPR000831 The Trp repressor (TrpR) binds to at least five operators in the Escherichia coli genome, repressing gene expression Back     alignment and domain information
>PF01047 MarR: MarR family; InterPro: IPR000835 The MarR-type HTH domain is a DNA-binding, winged helix-turn-helix (wHTH) domain of about 135 amino acids present in transcription regulators of the MarR/SlyA family, involved in the development of antibiotic resistance Back     alignment and domain information
>PRK11179 DNA-binding transcriptional regulator AsnC; Provisional Back     alignment and domain information
>PF01978 TrmB: Sugar-specific transcriptional regulator TrmB; InterPro: IPR002831 TrmB, is a protein of 38,800 apparent molecular weight, that is involved in the maltose-specific regulation of the trehalose/maltose ABC transport operon in Thermococcus litoralis Back     alignment and domain information
>CHL00148 orf27 Ycf27; Reviewed Back     alignment and domain information
>TIGR00498 lexA SOS regulatory protein LexA Back     alignment and domain information
>TIGR01764 excise DNA binding domain, excisionase family Back     alignment and domain information
>PRK00215 LexA repressor; Validated Back     alignment and domain information
>PRK13413 mpi multiple promoter invertase; Provisional Back     alignment and domain information
>TIGR03787 marine_sort_RR proteobacterial dedicated sortase system response regulator Back     alignment and domain information
>COG2973 TrpR Trp operon repressor [Transcription] Back     alignment and domain information
>PF01726 LexA_DNA_bind: LexA DNA binding domain; InterPro: IPR006199 This is the DNA binding domain of the LexA SOS regulon repressor which prevents expression of DNA repair proteins in bacteria Back     alignment and domain information
>cd04762 HTH_MerR-trunc Helix-Turn-Helix DNA binding domain of truncated MerR-like proteins Back     alignment and domain information
>smart00345 HTH_GNTR helix_turn_helix gluconate operon transcriptional repressor Back     alignment and domain information
>COG1522 Lrp Transcriptional regulators [Transcription] Back     alignment and domain information
>PRK11169 leucine-responsive transcriptional regulator; Provisional Back     alignment and domain information
>COG3355 Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>PF13551 HTH_29: Winged helix-turn helix Back     alignment and domain information
>PHA01976 helix-turn-helix protein Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query473
1l9u_H332 Thermus Aquaticus Rna Polymerase Holoenzyme At 4 A 4e-14
1l9u_H332 Thermus Aquaticus Rna Polymerase Holoenzyme At 4 A 1e-07
3les_A179 2f5 Epitope Scaffold Es2 Length = 179 5e-13
1l9z_H438 Thermus Aquaticus Rna Polymerase HoloenzymeFORK-Jun 1e-12
1l9z_H438 Thermus Aquaticus Rna Polymerase HoloenzymeFORK-Jun 1e-07
1ku2_A241 Crystal Structure Of Thermus Aquaticus Rna Polymera 2e-12
3ugo_A245 Crystal Structure Of Rna-Polymerase Sigma Subunit D 2e-12
3dxj_F423 Crystal Structure Of Thermus Thermophilus Rna Polym 9e-12
3dxj_F423 Crystal Structure Of Thermus Thermophilus Rna Polym 9e-08
1iw7_F423 Crystal Structure Of The Rna Polymerase Holoenzyme 9e-12
1iw7_F423 Crystal Structure Of The Rna Polymerase Holoenzyme 9e-08
4g7h_F443 Crystal Structure Of Thermus Thermophilus Transcrip 1e-11
4g7h_F443 Crystal Structure Of Thermus Thermophilus Transcrip 1e-07
1tty_A87 Solution Structure Of Sigma A Region 4 From Thermot 1e-11
4g6d_A73 G1 Orf67 / Staphyloccus Aureus Sigmaa Domain 4 Comp 5e-11
4g94_A62 G1 Orf67 / Staphyloccus Aureus Sigmaa Domain 4 Comp 7e-11
4igc_X613 X-ray Crystal Structure Of Escherichia Coli Sigma70 2e-10
4igc_X613 X-ray Crystal Structure Of Escherichia Coli Sigma70 6e-08
3iyd_F613 Three-Dimensional Em Structure Of An Intact Activat 2e-10
3iyd_F613 Three-Dimensional Em Structure Of An Intact Activat 5e-08
1sig_A339 Crystal Structure Of A Sigma70 Subunit Fragment Fro 2e-10
1rio_H73 Structure Of Bacteriophage Lambda Ci-Ntd In Complex 8e-07
1ku3_A73 Crystal Structure Of Thermus Aquaticus Rna Polymera 1e-06
1tlh_B81 T4 Asia Bound To Sigma70 Region 4 Length = 81 1e-06
3t72_q99 Phob(E)-Sigma70(4)-(Rnap-Betha-Flap-Tip-Helix)-Dna 2e-06
3n97_A72 Rna Polymerase Alpha C-Terminal Domain (E. Coli) An 2e-06
1l0o_C243 Crystal Structure Of The Bacillus Stearothermophilu 7e-06
2p7v_B68 Crystal Structure Of The Escherichia Coli Regulator 1e-05
>pdb|1L9U|H Chain H, Thermus Aquaticus Rna Polymerase Holoenzyme At 4 A Resolution Length = 332 Back     alignment and structure

Iteration: 1

Score = 75.9 bits (185), Expect = 4e-14, Method: Compositional matrix adjust. Identities = 52/148 (35%), Positives = 84/148 (56%), Gaps = 21/148 (14%) Query: 254 NDPLRLFLWGPETRKLLTADEEFELIAQIQD---LIRLEKEKSKLQSQFGREPTLIEWAK 310 +DP+R +L LLT +EE +L ++++ I+ E + L + RE + AK Sbjct: 2 SDPVRQYLHEIGQVPLLTLEEEIDLARKVEEGMEAIKKLSEATGLDQELIRE---VVRAK 58 Query: 311 AIGLS------------CRDLKSELH---SGNSSREKLINANLRLVVHVAKQYQGRGISL 355 +G + ++LK LH G ++R+ LI ANLRLVV +AK+Y GRG+S Sbjct: 59 ILGTARVEEVDGKLKSLPKELKRYLHIAREGEAARQHLIEANLRLVVSIAKKYTGRGLSF 118 Query: 356 HDLLQEGSMGLMKSVEKFKPQAGCRFAN 383 DL+QEG+ GL+++VEKF+ + +F+ Sbjct: 119 LDLIQEGNQGLIRAVEKFEYKRRFKFST 146
>pdb|1L9U|H Chain H, Thermus Aquaticus Rna Polymerase Holoenzyme At 4 A Resolution Length = 332 Back     alignment and structure
>pdb|3LES|A Chain A, 2f5 Epitope Scaffold Es2 Length = 179 Back     alignment and structure
>pdb|1L9Z|H Chain H, Thermus Aquaticus Rna Polymerase HoloenzymeFORK-Junction Promoter Dna Complex At 6.5 A Resolution Length = 438 Back     alignment and structure
>pdb|1L9Z|H Chain H, Thermus Aquaticus Rna Polymerase HoloenzymeFORK-Junction Promoter Dna Complex At 6.5 A Resolution Length = 438 Back     alignment and structure
>pdb|1KU2|A Chain A, Crystal Structure Of Thermus Aquaticus Rna Polymerase Sigma Subunit Fragment Containing Regions 1.2 To 3.1 Length = 241 Back     alignment and structure
>pdb|3UGO|A Chain A, Crystal Structure Of Rna-Polymerase Sigma Subunit Domain 2 Complexed With -10 Promoter Element Ssdna Oligo (Tacaat) Length = 245 Back     alignment and structure
>pdb|3DXJ|F Chain F, Crystal Structure Of Thermus Thermophilus Rna Polymerase Holoenzyme In Complex With The Antibiotic Myxopyronin Length = 423 Back     alignment and structure
>pdb|3DXJ|F Chain F, Crystal Structure Of Thermus Thermophilus Rna Polymerase Holoenzyme In Complex With The Antibiotic Myxopyronin Length = 423 Back     alignment and structure
>pdb|1IW7|F Chain F, Crystal Structure Of The Rna Polymerase Holoenzyme From Thermus Thermophilus At 2.6a Resolution Length = 423 Back     alignment and structure
>pdb|1IW7|F Chain F, Crystal Structure Of The Rna Polymerase Holoenzyme From Thermus Thermophilus At 2.6a Resolution Length = 423 Back     alignment and structure
>pdb|4G7H|F Chain F, Crystal Structure Of Thermus Thermophilus Transcription Initiation Complex Length = 443 Back     alignment and structure
>pdb|4G7H|F Chain F, Crystal Structure Of Thermus Thermophilus Transcription Initiation Complex Length = 443 Back     alignment and structure
>pdb|1TTY|A Chain A, Solution Structure Of Sigma A Region 4 From Thermotoga Maritima Length = 87 Back     alignment and structure
>pdb|4G6D|A Chain A, G1 Orf67 / Staphyloccus Aureus Sigmaa Domain 4 Complex Length = 73 Back     alignment and structure
>pdb|4G94|A Chain A, G1 Orf67 / Staphyloccus Aureus Sigmaa Domain 4 Complex Length = 62 Back     alignment and structure
>pdb|4IGC|X Chain X, X-ray Crystal Structure Of Escherichia Coli Sigma70 Holoenzyme Length = 613 Back     alignment and structure
>pdb|4IGC|X Chain X, X-ray Crystal Structure Of Escherichia Coli Sigma70 Holoenzyme Length = 613 Back     alignment and structure
>pdb|3IYD|F Chain F, Three-Dimensional Em Structure Of An Intact Activator-Dependent Transcription Initiation Complex Length = 613 Back     alignment and structure
>pdb|3IYD|F Chain F, Three-Dimensional Em Structure Of An Intact Activator-Dependent Transcription Initiation Complex Length = 613 Back     alignment and structure
>pdb|1SIG|A Chain A, Crystal Structure Of A Sigma70 Subunit Fragment From Escherichia Coli Rna Polymerase Length = 339 Back     alignment and structure
>pdb|1RIO|H Chain H, Structure Of Bacteriophage Lambda Ci-Ntd In Complex With Sigma-Region4 Of Thermus Aquaticus Bound To Dna Length = 73 Back     alignment and structure
>pdb|1KU3|A Chain A, Crystal Structure Of Thermus Aquaticus Rna Polymerase Sigma Subunit Fragment, Region 4 Length = 73 Back     alignment and structure
>pdb|1TLH|B Chain B, T4 Asia Bound To Sigma70 Region 4 Length = 81 Back     alignment and structure
>pdb|3T72|QQ Chain q, Phob(E)-Sigma70(4)-(Rnap-Betha-Flap-Tip-Helix)-Dna Transcription Activation Sub-Complex Length = 99 Back     alignment and structure
>pdb|3N97|A Chain A, Rna Polymerase Alpha C-Terminal Domain (E. Coli) And Sigma Region 4 (T. Aq. Mutant) Bound To (Up,-35 Element) Dna Length = 72 Back     alignment and structure
>pdb|1L0O|C Chain C, Crystal Structure Of The Bacillus Stearothermophilus Anti- Sigma Factor Spoiiab With The Sporulation Sigma Factor Sigmaf Length = 243 Back     alignment and structure
>pdb|2P7V|B Chain B, Crystal Structure Of The Escherichia Coli Regulator Of Sigma 70, Rsd, In Complex With Sigma 70 Domain 4 Length = 68 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query473
1rp3_A239 RNA polymerase sigma factor sigma-28 (FLIA); trans 3e-19
1rp3_A239 RNA polymerase sigma factor sigma-28 (FLIA); trans 6e-12
3ugo_A245 RNA polymerase sigma factor; protein-DNA complex, 1e-18
1l0o_C243 Sigma factor; bergerat fold, helix-turn-helix, pro 2e-18
1l0o_C243 Sigma factor; bergerat fold, helix-turn-helix, pro 2e-15
2a6h_F423 RNA polymerase sigma factor RPOD; RNA polymerase h 2e-17
2a6h_F423 RNA polymerase sigma factor RPOD; RNA polymerase h 1e-15
1tty_A87 Sigma-A, RNA polymerase sigma factor RPOD; helix-t 3e-17
1l9z_H438 Sigma factor SIGA; helix-turn-helix, coiled-coil, 1e-16
1l9z_H438 Sigma factor SIGA; helix-turn-helix, coiled-coil, 4e-15
3t72_q99 RNA polymerase sigma factor RPOD, DNA-directed RN 1e-16
3iyd_F613 RNA polymerase sigma factor RPOD; transcription, i 4e-15
3iyd_F613 RNA polymerase sigma factor RPOD; transcription, i 3e-13
2p7v_B68 Sigma-70, RNA polymerase sigma factor RPOD; RSD, r 9e-15
1ku3_A73 Sigma factor SIGA; helix-turn-helix, transcription 2e-14
1sig_A339 Sigma70, RNA polymerase primary sigma factor; RNA 2e-14
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-08
>1rp3_A RNA polymerase sigma factor sigma-28 (FLIA); transcription; 2.30A {Aquifex aeolicus} SCOP: a.4.13.1 a.4.13.2 a.177.1.1 PDB: 1sc5_A Length = 239 Back     alignment and structure
 Score = 86.1 bits (214), Expect = 3e-19
 Identities = 40/174 (22%), Positives = 73/174 (41%), Gaps = 38/174 (21%)

Query: 287 RLEKEKSKLQSQFGREPTLIEWAKAIGLSCRDLKSELHSGNSSREKLINANLRLVVHVAK 346
           R+++   KL+ + GREPT  E AK +G+S  +L   L   N S                 
Sbjct: 100 RIKEVVEKLKEKLGREPTDEEVAKELGISTEELFKTLDKINFSYI--------------- 144

Query: 347 QYQGRGISLHDLLQEGSMGLMKSVEKFKPQAGCRFANTGVEIPDISVQKQLMRQHVRNLL 406
                 +SL ++ ++ +    + +                   +  V K+ + + V+  +
Sbjct: 145 ------LSLEEVFRDFARDYSELIPS-------------STNVEEEVIKRELTEKVKEAV 185

Query: 407 TLLNPKERCIVRLRFGIEDGKPKSLSEVGNIFGLSKERVRQLESRALYRLKQSL 460
           + L  +E+ +++L F  E        EV  I   S  RV QL+++AL RL++ L
Sbjct: 186 SKLPEREKLVIQLIFYEE----LPAKEVAKILETSVSRVSQLKAKALERLREML 235


>1rp3_A RNA polymerase sigma factor sigma-28 (FLIA); transcription; 2.30A {Aquifex aeolicus} SCOP: a.4.13.1 a.4.13.2 a.177.1.1 PDB: 1sc5_A Length = 239 Back     alignment and structure
>3ugo_A RNA polymerase sigma factor; protein-DNA complex, bacterial promoter opening, G-quartet, quadruplex, DNA binding; 2.10A {Thermus aquaticus} PDB: 3ugp_A 1ku2_A 3lev_A* 3les_A* Length = 245 Back     alignment and structure
>1l0o_C Sigma factor; bergerat fold, helix-turn-helix, protein binding; HET: ADP; 2.90A {Geobacillus stearothermophilus} SCOP: a.4.13.2 Length = 243 Back     alignment and structure
>1l0o_C Sigma factor; bergerat fold, helix-turn-helix, protein binding; HET: ADP; 2.90A {Geobacillus stearothermophilus} SCOP: a.4.13.2 Length = 243 Back     alignment and structure
>2a6h_F RNA polymerase sigma factor RPOD; RNA polymerase holoenzyme, streptolydigin, antibiotic, transcription regulation; HET: STD; 2.40A {Thermus thermophilus} SCOP: a.4.13.1 a.4.13.2 a.177.1.1 PDB: 1smy_F* 1zyr_F* 1iw7_F* 2a69_F* 2a6e_F 2a68_F* 2be5_F* 2cw0_F 3eql_F* 3dxj_F* 1l9u_H Length = 423 Back     alignment and structure
>2a6h_F RNA polymerase sigma factor RPOD; RNA polymerase holoenzyme, streptolydigin, antibiotic, transcription regulation; HET: STD; 2.40A {Thermus thermophilus} SCOP: a.4.13.1 a.4.13.2 a.177.1.1 PDB: 1smy_F* 1zyr_F* 1iw7_F* 2a69_F* 2a6e_F 2a68_F* 2be5_F* 2cw0_F 3eql_F* 3dxj_F* 1l9u_H Length = 423 Back     alignment and structure
>1tty_A Sigma-A, RNA polymerase sigma factor RPOD; helix-turn-helix, transcription; NMR {Thermotoga maritima} SCOP: a.4.13.2 Length = 87 Back     alignment and structure
>1l9z_H Sigma factor SIGA; helix-turn-helix, coiled-coil, transcription/DNA complex; 6.50A {Thermus aquaticus} SCOP: i.8.1.1 Length = 438 Back     alignment and structure
>1l9z_H Sigma factor SIGA; helix-turn-helix, coiled-coil, transcription/DNA complex; 6.50A {Thermus aquaticus} SCOP: i.8.1.1 Length = 438 Back     alignment and structure
>3t72_q RNA polymerase sigma factor RPOD, DNA-directed RN polymerase subunit beta; winged-helix motif, transcription activation, DNA-binding; 4.33A {Escherichia coli} PDB: 1tlh_B Length = 99 Back     alignment and structure
>3iyd_F RNA polymerase sigma factor RPOD; transcription, initiation, class I, activator, RNA polymeras holoenzyme, sigma70, open complex, CAP, CRP; HET: DNA CMP; 19.80A {Escherichia coli k-12} Length = 613 Back     alignment and structure
>3iyd_F RNA polymerase sigma factor RPOD; transcription, initiation, class I, activator, RNA polymeras holoenzyme, sigma70, open complex, CAP, CRP; HET: DNA CMP; 19.80A {Escherichia coli k-12} Length = 613 Back     alignment and structure
>2p7v_B Sigma-70, RNA polymerase sigma factor RPOD; RSD, regulator of sigma 70, sigma 70 domain 4, transcription, regulation, helix-turn-helix; 2.60A {Escherichia coli} SCOP: a.4.13.2 Length = 68 Back     alignment and structure
>1ku3_A Sigma factor SIGA; helix-turn-helix, transcription; 1.80A {Thermus aquaticus} SCOP: a.4.13.2 PDB: 1ku7_A 1rio_H 3n97_A* Length = 73 Back     alignment and structure
>1sig_A Sigma70, RNA polymerase primary sigma factor; RNA polymerase sigma factor, transcription regulation; 2.60A {Escherichia coli} SCOP: a.177.1.1 Length = 339 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query473
1l9z_H438 Sigma factor SIGA; helix-turn-helix, coiled-coil, 99.97
2a6h_F423 RNA polymerase sigma factor RPOD; RNA polymerase h 99.97
3ugo_A245 RNA polymerase sigma factor; protein-DNA complex, 99.91
3iyd_F613 RNA polymerase sigma factor RPOD; transcription, i 99.84
2q1z_A184 RPOE, ECF SIGE; ECF sigma factor, cupin fold, zinc 99.83
1rp3_A239 RNA polymerase sigma factor sigma-28 (FLIA); trans 99.82
1or7_A194 Sigma-24, RNA polymerase sigma-E factor; regulatio 99.8
1l0o_C243 Sigma factor; bergerat fold, helix-turn-helix, pro 99.74
3mzy_A164 RNA polymerase sigma-H factor; PSI, MCSG, structur 99.64
2lfw_A157 PHYR sigma-like domain; signal transduction, respo 99.6
3t72_q99 RNA polymerase sigma factor RPOD, DNA-directed RN 99.5
3n0r_A 286 Response regulator; sigma factor, receiver, two-co 99.46
1tty_A87 Sigma-A, RNA polymerase sigma factor RPOD; helix-t 99.32
3hug_A92 RNA polymerase sigma factor; ECF sigma factor, zin 99.32
1ku3_A73 Sigma factor SIGA; helix-turn-helix, transcription 99.28
2p7v_B68 Sigma-70, RNA polymerase sigma factor RPOD; RSD, r 99.23
2o8x_A70 Probable RNA polymerase sigma-C factor; promoter r 99.06
1xsv_A113 Hypothetical UPF0122 protein SAV1236; helix-turn-h 98.93
1s7o_A113 Hypothetical UPF0122 protein SPY1201/SPYM3_0842/SP 98.77
3clo_A258 Transcriptional regulator; NP_811094.1, bacterial 98.77
1sig_A339 Sigma70, RNA polymerase primary sigma factor; RNA 98.71
3c57_A95 Two component transcriptional regulatory protein; 98.56
2rnj_A91 Response regulator protein VRAR; HTH LUXR-type dom 98.56
1x3u_A79 Transcriptional regulatory protein FIXJ; helix-tur 98.56
1je8_A82 Nitrate/nitrite response regulator protein NARL; p 98.44
1jhg_A101 Trp operon repressor; complex (regulatory protein- 98.36
1fse_A74 GERE; helix-turn-helix DNA-binding protein transcr 98.27
3ulq_B90 Transcriptional regulatory protein COMA; tetratric 98.06
2jpc_A61 SSRB; DNA binding protein, structural genomics, PS 98.03
2o7g_A112 Probable RNA polymerase sigma-C factor; sigma fact 98.0
1p4w_A99 RCSB; solution structure, DNA binding domain, DNA 97.97
1h3l_A87 RNA polymerase sigma factor; transcription, DNA-bi 97.89
2q0o_A236 Probable transcriptional activator protein TRAR; h 97.6
3ugo_A245 RNA polymerase sigma factor; protein-DNA complex, 97.59
1l3l_A234 Transcriptional activator protein TRAR; helix-turn 97.59
2a6h_F423 RNA polymerase sigma factor RPOD; RNA polymerase h 97.43
3szt_A237 QCSR, quorum-sensing control repressor; quorum sen 97.42
1l9z_H438 Sigma factor SIGA; helix-turn-helix, coiled-coil, 97.42
3qp6_A265 CVIR transcriptional regulator; quorum sensing, ag 97.31
1tc3_C51 Protein (TC3 transposase); DNA binding, helix-turn 97.12
2w7n_A101 TRFB transcriptional repressor protein; INCP, plas 96.95
1yio_A208 Response regulatory protein; transcription regulat 96.66
2x48_A55 CAG38821; archeal virus, viral protein; 2.60A {Sul 96.64
3iyd_F613 RNA polymerase sigma factor RPOD; transcription, i 96.64
1a04_A215 Nitrate/nitrite response regulator protein NARL; s 96.35
3c3w_A225 Two component transcriptional regulatory protein; 96.06
1rp3_A239 RNA polymerase sigma factor sigma-28 (FLIA); trans 95.58
3p7n_A258 Sensor histidine kinase; LOV domain, light-activat 95.46
3klo_A225 Transcriptional regulator VPST; REC domain, HTH do 95.4
1jko_C52 HIN recombinase, DNA-invertase HIN; water-mediated 93.97
1p2f_A220 Response regulator; DRRB, OMPR/PHOB, transcription 93.94
2oqr_A230 Sensory transduction protein REGX3; response regul 93.74
2gwr_A238 DNA-binding response regulator MTRA; two-component 93.66
1qgp_A77 Protein (double stranded RNA adenosine deaminase); 93.24
3kor_A119 Possible Trp repressor; putative DNA-binding Trp r 92.52
1qbj_A81 Protein (double-stranded RNA specific adenosine D 92.51
1kgs_A225 DRRD, DNA binding response regulator D; DNA-bindin 92.48
1ys7_A233 Transcriptional regulatory protein PRRA; response 92.27
1u78_A141 TC3 transposase, transposable element TC3 transpos 92.12
1pdn_C128 Protein (PRD paired); protein-DNA complex, double 92.03
1zx4_A 192 P1 PARB, plasmid partition PAR B protein, PARB; tr 91.65
3q9s_A249 DNA-binding response regulator; DNA binding protei 91.37
3r0j_A250 Possible two component system response transcript 91.35
1k78_A149 Paired box protein PAX5; paired domain, ETS domain 90.5
1l0o_C243 Sigma factor; bergerat fold, helix-turn-helix, pro 90.46
2hqr_A223 Putative transcriptional regulator; phosporylation 90.33
2d1h_A109 ST1889, 109AA long hypothetical transcriptional re 89.96
2elh_A87 CG11849-PA, LD40883P; structural genomics, NPPSFA, 89.19
2w48_A 315 Sorbitol operon regulator; SORC, activator, repres 89.09
3k2z_A 196 LEXA repressor; winged helix-turn-helix, SOS syste 88.88
2o3f_A111 Putative HTH-type transcriptional regulator YBBH; 88.59
2heo_A67 Z-DNA binding protein 1; protein DLM1-Z-DNA comple 88.55
1oyi_A82 Double-stranded RNA-binding protein; (alpha+beta) 88.42
3nqo_A189 MARR-family transcriptional regulator; structural 88.36
2dbb_A151 Putative HTH-type transcriptional regulator PH006; 88.14
1r1u_A106 CZRA, repressor protein; zinc, DNA binding, transc 88.1
2cfx_A144 HTH-type transcriptional regulator LRPC; transcrip 87.97
2glo_A59 Brinker CG9653-PA; protein-DNA complex, helix-turn 87.83
1y0u_A96 Arsenical resistance operon repressor, putative; s 87.71
3bro_A141 Transcriptional regulator; helix_TURN_helix, multi 87.67
3ech_A142 MEXR, multidrug resistance operon repressor; winge 87.56
3r0a_A123 Putative transcriptional regulator; structural gen 87.47
3tgn_A146 ADC operon repressor ADCR; helix-turn-helix, trans 87.21
2cyy_A151 Putative HTH-type transcriptional regulator PH151; 87.03
2cg4_A152 Regulatory protein ASNC; DNA binding, FFRP, LRP fa 86.83
2jn6_A97 Protein CGL2762, transposase; GFT PSI-2, protein s 86.7
2w25_A150 Probable transcriptional regulatory protein; trans 86.59
2p5v_A162 Transcriptional regulator, LRP/ASNC family; NMB057 86.56
3eco_A139 MEPR; mutlidrug efflux pump regulator winged helix 86.53
2zkz_A99 Transcriptional repressor PAGR; protein-DNA, HTH m 86.28
1sfx_A109 Conserved hypothetical protein AF2008; structural 86.22
1i1g_A141 Transcriptional regulator LRPA; helix-turn-helix, 86.08
3bpv_A138 Transcriptional regulator; MARR, DNA binding, tran 86.02
2x4h_A139 Hypothetical protein SSO2273; transcription; 2.30A 85.98
2gxg_A146 146AA long hypothetical transcriptional regulator; 85.88
2pn6_A150 ST1022, 150AA long hypothetical transcriptional re 85.81
3cuo_A99 Uncharacterized HTH-type transcriptional regulato; 85.79
3bdd_A142 Regulatory protein MARR; putative multiple antibio 85.79
3pqk_A102 Biofilm growth-associated repressor; helix-turn-he 85.63
2k27_A159 Paired box protein PAX-8; paired domain, solution 85.57
3i4p_A162 Transcriptional regulator, ASNC family; PSI, struc 85.56
2fa5_A162 Transcriptional regulator MARR/EMRR family; multip 85.54
2lkp_A119 Transcriptional regulator, ARSR family; symmetric 84.99
2nnn_A140 Probable transcriptional regulator; structural gen 84.87
3jth_A98 Transcription activator HLYU; transcription factor 84.68
3iwf_A107 Transcription regulator RPIR family; transcription 84.44
4hbl_A149 Transcriptional regulator, MARR family; HTH, trans 84.43
2e1c_A171 Putative HTH-type transcriptional regulator PH151; 84.24
3cdh_A155 Transcriptional regulator, MARR family; helix-turn 84.06
2oqg_A114 Possible transcriptional regulator, ARSR family P; 83.91
2qww_A154 Transcriptional regulator, MARR family; YP_013417. 83.81
2l0k_A93 Stage III sporulation protein D; SPOIIID, solution 83.81
1uxc_A65 FRUR (1-57), fructose repressor; DNA-binding prote 83.68
2rdp_A150 Putative transcriptional regulator MARR; PFAM PF01 83.67
1ku9_A152 Hypothetical protein MJ223; putative transcription 83.5
2ia0_A171 Putative HTH-type transcriptional regulator PF086; 83.49
1jgs_A138 Multiple antibiotic resistance protein MARR; trans 83.45
1r1t_A122 Transcriptional repressor SMTB; zinc, transcriptio 82.92
3cjn_A162 Transcriptional regulator, MARR family; silicibact 82.92
1sfu_A75 34L protein; protein/Z-DNA complex, DNA binding pr 82.88
3hsr_A140 HTH-type transcriptional regulator SARZ; helix-tur 82.87
3frw_A107 Putative Trp repressor protein; structural genomic 82.76
3fm5_A150 Transcriptional regulator; MCSG, PF04017, PSI, MAR 82.75
1s3j_A155 YUSO protein; structural genomics, MARR transcript 82.62
3f3x_A144 Transcriptional regulator, MARR family, putative; 82.54
3bj6_A152 Transcriptional regulator, MARR family; helix-turn 82.38
2qvo_A95 Uncharacterized protein AF_1382; PSI, structural g 82.33
2nyx_A168 Probable transcriptional regulatory protein, RV14; 82.19
2kko_A108 Possible transcriptional regulatory protein (possi 82.17
3oop_A143 LIN2960 protein; protein structure initiative, PSI 81.95
3qbm_A199 TETR transcriptional regulator; DNA/RNA-binding th 81.83
3nrv_A148 Putative transcriptional regulator (MARR/EMRR FAM; 81.69
1zug_A71 Phage 434 CRO protein; gene regulating protein, tr 81.6
1r69_A69 Repressor protein CI; gene regulating protein; 2.0 81.48
2fbh_A146 Transcriptional regulator PA3341; MARR, transcript 81.34
3ppb_A195 Putative TETR family transcription regulator; DNA- 81.27
2xi8_A66 Putative transcription regulator; HTH DNA-binding 81.1
3kz3_A80 Repressor protein CI; five helix bundle, DNA-bindi 81.07
3qq6_A78 HTH-type transcriptional regulator SINR; helix-tur 80.99
1jhf_A 202 LEXA repressor; LEXA SOS repressor, hydrolase; 1.8 80.94
2a6c_A83 Helix-turn-helix motif; putative transcriptional r 80.92
2htj_A81 P fimbrial regulatory protein KS71A; winged helix- 80.87
3dcf_A218 Transcriptional regulator of the TETR/ACRR family; 80.85
3kp7_A151 Transcriptional regulator TCAR; multiple drug resi 80.82
1uly_A 192 Hypothetical protein PH1932; helix-turn-helix, str 80.81
3k0l_A162 Repressor protein; helix-turn-helix, structural ge 80.76
1u2w_A122 CADC repressor, cadmium efflux system accessory pr 80.74
3g3z_A145 NMB1585, transcriptional regulator, MARR family; t 80.69
3s2w_A159 Transcriptional regulator, MARR family; structural 80.64
2a61_A145 Transcriptional regulator TM0710; APC4350, MCSG, m 80.4
1y7y_A74 C.AHDI; helix-turn-helix, DNA-binding protein, tra 80.33
>1l9z_H Sigma factor SIGA; helix-turn-helix, coiled-coil, transcription/DNA complex; 6.50A {Thermus aquaticus} SCOP: i.8.1.1 Back     alignment and structure
Probab=99.97  E-value=2e-31  Score=280.09  Aligned_cols=217  Identities=32%  Similarity=0.548  Sum_probs=181.1

Q ss_pred             ChhHHhhhcccCccCCCChHHHHHHHHHHHHHHHHHHH------------------HHHHHHHhCCCCCHHHHHH-----
Q 011992          254 NDPLRLFLWGPETRKLLTADEEFELIAQIQDLIRLEKE------------------KSKLQSQFGREPTLIEWAK-----  310 (473)
Q Consensus       254 ~~~lR~~~~~pr~~~lLT~eEE~~L~~~iq~l~kle~a------------------~~~L~~~lGRePT~eEiA~-----  310 (473)
                      .++++.|++.++++|+||+|||++|+++++....+...                  +......+|+.|+..||+.     
T Consensus        93 ~d~~~~Yl~ei~~~pLLt~eEE~~La~~i~~g~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  172 (438)
T 1l9z_H           93 SDPVRQYLHEIGQVPLLTLEEEIDLARKVEEGMEAIKKLSEATGLDQELIREVVRAKILGTARIQKIPGLKEKPDPKTVE  172 (438)
T ss_pred             CChHHHHHHHhccCCCCCHHHHHHHHHHHHHhhhHHHHHHhhhccchhhhhhhhhhhhhhcccccccccccccccchhhh
Confidence            35799999999999999999999999999986433221                  1122234567888777632     


Q ss_pred             -------HcCCCHHHHHHHHhhcchHHHHHHHHHHHHHHHHHHHhhcCCcchhhHhhhhHHHHHHHhhhhCccCCCcccc
Q 011992          311 -------AIGLSCRDLKSELHSGNSSREKLINANLRLVVHVAKQYQGRGISLHDLLQEGSMGLMKSVEKFKPQAGCRFAN  383 (473)
Q Consensus       311 -------~lGms~eeL~~~l~~g~~A~e~Li~~yl~lV~sIA~ry~~~~~saEDLiQEg~lgL~kAiekFDp~kg~~FsT  383 (473)
                             .++++..+|...+.+|..|++.||..|+++|+++|++|.+++.+++||+||||+|||+++++||+.+|++|+|
T Consensus       173 ~~~~~~~~~~~~~~eLi~~~~~d~~A~~~Li~~nlrlVv~iA~ry~~~g~~aeDLIQEg~IgL~kAvekFDp~kG~rFsT  252 (438)
T 1l9z_H          173 EVDGKLKSLPKELKRYLHIAREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGLIRAVEKFEYKRRFKFST  252 (438)
T ss_pred             hhhhhhhcccchHHHHHHHHhcCHHHHHHHHHHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHHHHHHhcCcccCCChHH
Confidence                   2456778888888888899999999999999999999999999999999999999999999999999999987


Q ss_pred             CCC-----------------------------------------------------------------------------
Q 011992          384 TGV-----------------------------------------------------------------------------  386 (473)
Q Consensus       384 ~~~-----------------------------------------------------------------------------  386 (473)
                      +..                                                                             
T Consensus       253 YA~~wIR~~I~~~i~~~~R~irlp~~~~~~l~~lrr~~r~l~~~lgr~pt~eeiA~~l~~~v~~e~V~~~~~~~~~~~SL  332 (438)
T 1l9z_H          253 YATWWIRQAINRAIADQARTIRIPVHMVETINKLSRTARQLQQELGREPSYEEIAEAMGPGWDAKRVEETLKIAQEPVSL  332 (438)
T ss_pred             HHHHHHHHHHHHHHHHhcchhccchHHHHHHHHHHHHHHHHHHHhCCCCCHHHHHHHhCCCCCHHHHHHHHHhccccccc
Confidence            100                                                                             


Q ss_pred             ---------------------CCchHHHHHHHHHHHHHHHHhhCCHHHHHHHHHHhhccCCCCCCHHHHHHHHCCCHHHH
Q 011992          387 ---------------------EIPDISVQKQLMRQHVRNLLTLLNPKERCIVRLRFGIEDGKPKSLSEVGNIFGLSKERV  445 (473)
Q Consensus       387 ---------------------~~pee~le~~el~e~L~~aL~~LperER~VL~LrY~L~~ge~lTlkEIAe~LGIS~~rV  445 (473)
                                           ..|+..+...+....|..+|..||+++|.||.+||+|+||+++|++|||+.||||++||
T Consensus       333 d~~~~~d~d~~l~d~l~d~~~~~pee~~~~~~~~~~L~~aL~~L~ereR~VI~LRygL~~~e~~TleEIAe~LgIS~erV  412 (438)
T 1l9z_H          333 ETPIGDEKDSFYGDFIPDENLPSPVEAAAQSLLSEELEKALSKLSEREAMVLKLRKGLIDGREHTLEEVGAYFGVTRERI  412 (438)
T ss_pred             ccccccccchhhhhhhcccccCCHHHHHHHHHHHHHHHHHHHhCCHHHHHHHHHHHhccCCCCCCHHHHHHHHCcCHHHH
Confidence                                 01122233445667899999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHH-HHhccCchhhhhh
Q 011992          446 RQLESRALYRLK-QSLGGKASYGYAD  470 (473)
Q Consensus       446 rqi~~RAL~KLR-~~L~~~~l~~yld  470 (473)
                      +|++++|++||| ..+....+++|++
T Consensus       413 Rqi~~RAlkKLR~~~~~~~~l~~yl~  438 (438)
T 1l9z_H          413 RQIENKALRKLKYHESRTRKLRDFLE  438 (438)
T ss_pred             HHHHHHHHHHHHHhHhhHHHHHHhhC
Confidence            999999999999 7788777888874



>2a6h_F RNA polymerase sigma factor RPOD; RNA polymerase holoenzyme, streptolydigin, antibiotic, transcription regulation; HET: STD; 2.40A {Thermus thermophilus} SCOP: a.4.13.1 a.4.13.2 a.177.1.1 PDB: 1smy_F* 1zyr_F* 1iw7_F* 2a69_F* 2a6e_F 2a68_F* 2be5_F* 2cw0_F 3eql_F* 3dxj_F* 1l9u_H Back     alignment and structure
>3ugo_A RNA polymerase sigma factor; protein-DNA complex, bacterial promoter opening, G-quartet, quadruplex, DNA binding; 2.10A {Thermus aquaticus} PDB: 3ugp_A 4gor_A 1ku2_A 3lev_A* 3les_A* Back     alignment and structure
>3iyd_F RNA polymerase sigma factor RPOD; transcription, initiation, class I, activator, RNA polymeras holoenzyme, sigma70, open complex, CAP, CRP; HET: DNA CMP; 19.80A {Escherichia coli k-12} Back     alignment and structure
>1rp3_A RNA polymerase sigma factor sigma-28 (FLIA); transcription; 2.30A {Aquifex aeolicus} SCOP: a.4.13.1 a.4.13.2 a.177.1.1 PDB: 1sc5_A Back     alignment and structure
>1or7_A Sigma-24, RNA polymerase sigma-E factor; regulation, DNA-binding, transmembrane, transcription; 2.00A {Escherichia coli} SCOP: a.4.13.2 a.177.1.1 PDB: 2h27_A Back     alignment and structure
>1l0o_C Sigma factor; bergerat fold, helix-turn-helix, protein binding; HET: ADP; 2.90A {Geobacillus stearothermophilus} SCOP: a.4.13.2 Back     alignment and structure
>3mzy_A RNA polymerase sigma-H factor; PSI, MCSG, structural genomics, midwest center for structura genomics, protein structure initiative; 2.50A {Fusobacterium nucleatum subsp} Back     alignment and structure
>2lfw_A PHYR sigma-like domain; signal transduction, response regulator, sigma factor mimicr sigma factor, general stress response, signaling protein; NMR {Sphingomonas SP} Back     alignment and structure
>3t72_q RNA polymerase sigma factor RPOD, DNA-directed RN polymerase subunit beta; winged-helix motif, transcription activation, DNA-binding; 4.33A {Escherichia coli} PDB: 1tlh_B Back     alignment and structure
>3n0r_A Response regulator; sigma factor, receiver, two-component SI transduction, signaling protein; HET: MSE GOL; 1.25A {Caulobacter vibrioides} PDB: 3t0y_A Back     alignment and structure
>1tty_A Sigma-A, RNA polymerase sigma factor RPOD; helix-turn-helix, transcription; NMR {Thermotoga maritima} SCOP: a.4.13.2 Back     alignment and structure
>3hug_A RNA polymerase sigma factor; ECF sigma factor, zinc binding anti-sigma factor, oxidative transcription regulation; 2.35A {Mycobacterium tuberculosis} Back     alignment and structure
>1ku3_A Sigma factor SIGA; helix-turn-helix, transcription; 1.80A {Thermus aquaticus} SCOP: a.4.13.2 PDB: 1ku7_A 1rio_H 3n97_A* Back     alignment and structure
>2p7v_B Sigma-70, RNA polymerase sigma factor RPOD; RSD, regulator of sigma 70, sigma 70 domain 4, transcription, regulation, helix-turn-helix; 2.60A {Escherichia coli} SCOP: a.4.13.2 Back     alignment and structure
>2o8x_A Probable RNA polymerase sigma-C factor; promoter recognition, transcription regulation, helix-turn-H motif, transcription; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1xsv_A Hypothetical UPF0122 protein SAV1236; helix-turn-helix, putative DNA-binding protein, signal recognition particle, unknown function; 1.70A {Staphylococcus aureus subsp} SCOP: a.4.13.3 Back     alignment and structure
>1s7o_A Hypothetical UPF0122 protein SPY1201/SPYM3_0842/SPS1042/SPYM18_1152; putative DNA binding protein, structural genomics; 2.31A {Streptococcus pyogenes serotype M3} SCOP: a.4.13.3 Back     alignment and structure
>3clo_A Transcriptional regulator; NP_811094.1, bacterial regulatory proteins, LUXR family, structural genomics; 2.04A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>1sig_A Sigma70, RNA polymerase primary sigma factor; RNA polymerase sigma factor, transcription regulation; 2.60A {Escherichia coli} SCOP: a.177.1.1 Back     alignment and structure
>3c57_A Two component transcriptional regulatory protein; response regulator, two-component regulatory system, DNA-BIN protein; 1.70A {Mycobacterium tuberculosis} PDB: 1zlk_A 1zlj_A Back     alignment and structure
>2rnj_A Response regulator protein VRAR; HTH LUXR-type domain, DNA binding domain, activator, antibiotic resistance, cytoplasm, DNA-binding; NMR {Staphylococcus aureus} Back     alignment and structure
>1x3u_A Transcriptional regulatory protein FIXJ; helix-turn-helix; NMR {Sinorhizobium meliloti} Back     alignment and structure
>1je8_A Nitrate/nitrite response regulator protein NARL; protein-DNA complex, two-component response regulator, helix-turn-helix, DNA bending; 2.12A {Escherichia coli} SCOP: a.4.6.2 PDB: 1zg1_A 1zg5_A Back     alignment and structure
>1jhg_A Trp operon repressor; complex (regulatory protein-peptide), DNA-binding regulatory complex (regulatory protein-peptide) complex; HET: TRP; 1.30A {Escherichia coli} SCOP: a.4.12.1 PDB: 1co0_A* 1mi7_R 1p6z_R 1wrp_R* 1zt9_A* 2oz9_R* 3ssw_R 3wrp_A 1rcs_A* 1wrs_R* 1wrt_R 2xdi_A 3ssx_R* 1trr_A* 1tro_A* Back     alignment and structure
>1fse_A GERE; helix-turn-helix DNA-binding protein transcriptional regulat transcription; 2.05A {Bacillus subtilis} SCOP: a.4.6.2 Back     alignment and structure
>3ulq_B Transcriptional regulatory protein COMA; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} PDB: 2krf_A Back     alignment and structure
>2jpc_A SSRB; DNA binding protein, structural genomics, PSI-2, protein structure initiative; NMR {Salmonella typhimurium} Back     alignment and structure
>2o7g_A Probable RNA polymerase sigma-C factor; sigma factor, transcription regulation, -10 element recognit domain, transcription; 2.70A {Mycobacterium tuberculosis} Back     alignment and structure
>1p4w_A RCSB; solution structure, DNA binding domain, DNA binding protein; NMR {Erwinia amylovora} SCOP: a.4.6.2 Back     alignment and structure
>1h3l_A RNA polymerase sigma factor; transcription, DNA-binding, transcription regulation; 2.37A {Streptomyces coelicolor A3} SCOP: a.177.1.1 Back     alignment and structure
>2q0o_A Probable transcriptional activator protein TRAR; helix-turn-helix, two-helix coiled coil; HET: LAE; 2.00A {Rhizobium SP} Back     alignment and structure
>3ugo_A RNA polymerase sigma factor; protein-DNA complex, bacterial promoter opening, G-quartet, quadruplex, DNA binding; 2.10A {Thermus aquaticus} PDB: 3ugp_A 4gor_A 1ku2_A 3lev_A* 3les_A* Back     alignment and structure
>1l3l_A Transcriptional activator protein TRAR; helix-turn-helix DNA binding motif, alpha/beta/alpha sandwich; HET: LAE; 1.66A {Agrobacterium tumefaciens} SCOP: a.4.6.2 d.110.5.1 PDB: 1h0m_A* Back     alignment and structure
>2a6h_F RNA polymerase sigma factor RPOD; RNA polymerase holoenzyme, streptolydigin, antibiotic, transcription regulation; HET: STD; 2.40A {Thermus thermophilus} SCOP: a.4.13.1 a.4.13.2 a.177.1.1 PDB: 1smy_F* 1zyr_F* 1iw7_F* 2a69_F* 2a6e_F 2a68_F* 2be5_F* 2cw0_F 3eql_F* 3dxj_F* 1l9u_H Back     alignment and structure
>3szt_A QCSR, quorum-sensing control repressor; quorum sensing acyl-homoserine lactone, helix-turn-helix, transcription factor, 3-OXO-C12 HSL; HET: OHN; 2.55A {Pseudomonas aeruginosa} Back     alignment and structure
>1l9z_H Sigma factor SIGA; helix-turn-helix, coiled-coil, transcription/DNA complex; 6.50A {Thermus aquaticus} SCOP: i.8.1.1 Back     alignment and structure
>3qp6_A CVIR transcriptional regulator; quorum sensing, agonist, antagonist, LUXR, acylated homoseri lactone, transcription factor; HET: HL6; 2.00A {Chromobacterium violaceum} PDB: 3qp5_A* Back     alignment and structure
>1tc3_C Protein (TC3 transposase); DNA binding, helix-turn-helix, TC1/mariner family, complex (transposase/DNA), DNA binding protein/DNA complex; HET: DNA; 2.45A {Caenorhabditis elegans} SCOP: a.4.1.2 Back     alignment and structure
>2w7n_A TRFB transcriptional repressor protein; INCP, plasmid, repressor, DNA-binding, transcription/DNA; HET: BRU; 1.85A {Escherichia coli} Back     alignment and structure
>1yio_A Response regulatory protein; transcription regulation, DNA binding protein; 2.20A {Pseudomonas fluorescens} SCOP: a.4.6.2 c.23.1.1 PDB: 1zn2_A Back     alignment and structure
>2x48_A CAG38821; archeal virus, viral protein; 2.60A {Sulfolobus islandicus rod-shaped virusorganism_taxid} Back     alignment and structure
>3iyd_F RNA polymerase sigma factor RPOD; transcription, initiation, class I, activator, RNA polymeras holoenzyme, sigma70, open complex, CAP, CRP; HET: DNA CMP; 19.80A {Escherichia coli k-12} Back     alignment and structure
>1a04_A Nitrate/nitrite response regulator protein NARL; signal transduction protein, response regulators, two- component systems; 2.20A {Escherichia coli} SCOP: a.4.6.2 c.23.1.1 PDB: 1rnl_A Back     alignment and structure
>3c3w_A Two component transcriptional regulatory protein; response regulator, two-component regulatory system, DNA-BIN protein; 2.20A {Mycobacterium tuberculosis} Back     alignment and structure
>1rp3_A RNA polymerase sigma factor sigma-28 (FLIA); transcription; 2.30A {Aquifex aeolicus} SCOP: a.4.13.1 a.4.13.2 a.177.1.1 PDB: 1sc5_A Back     alignment and structure
>3p7n_A Sensor histidine kinase; LOV domain, light-activated transcription factor, DNA bindin; HET: FMN; 2.10A {Erythrobacter litoralis} Back     alignment and structure
>3klo_A Transcriptional regulator VPST; REC domain, HTH domain, DNA-binding, transcription regulation; HET: C2E TAR; 2.80A {Vibrio cholerae} PDB: 3kln_A* Back     alignment and structure
>1jko_C HIN recombinase, DNA-invertase HIN; water-mediated recognition, protein-DNA complex, A10G mutant, DNA binding protein/DNA complex; 2.24A {Synthetic} SCOP: a.4.1.2 PDB: 1ijw_C* 1jj6_C* 1jj8_C* 1hcr_A 1jkp_C 1jkq_C 1jkr_C Back     alignment and structure
>1p2f_A Response regulator; DRRB, OMPR/PHOB, transcription; HET: MSE; 1.80A {Thermotoga maritima} SCOP: a.4.6.1 c.23.1.1 PDB: 3nns_A* Back     alignment and structure
>2oqr_A Sensory transduction protein REGX3; response regulator, winged-helix-turn-helix, DNA-binding, 3D swapping, two component system; 2.03A {Mycobacterium tuberculosis H37RV} Back     alignment and structure
>2gwr_A DNA-binding response regulator MTRA; two-component regulatory system, transcription regulation, phosphorylation, OMPR family; 2.10A {Mycobacterium tuberculosis} PDB: 3nhz_A Back     alignment and structure
>1qgp_A Protein (double stranded RNA adenosine deaminase); Z-alpha-Z-DNA binding domain, RNA-editing, Z-DNA recognition, ADAR1, helix- turn-helix; NMR {Homo sapiens} SCOP: a.4.5.19 Back     alignment and structure
>3kor_A Possible Trp repressor; putative DNA-binding Trp repressor, TRPR like protein, struc genomics, transcription; 1.60A {Staphylococcus aureus} Back     alignment and structure
>1qbj_A Protein (double-stranded RNA specific adenosine D (ADAR1)); protein-Z-DNA complex, hydrolase-DNA complex; HET: DNA; 2.10A {Homo sapiens} SCOP: a.4.5.19 PDB: 3f21_A* 3f22_A* 3f23_A* 3irr_A* 3irq_D* 2gxb_A 2acj_A 2l54_A Back     alignment and structure
>1kgs_A DRRD, DNA binding response regulator D; DNA-binding protein, ALPH-beta sandwich, winged-helix, helix helix, DNA binding protein; HET: DNA MSE; 1.50A {Thermotoga maritima} SCOP: a.4.6.1 c.23.1.1 PDB: 3nnn_A* Back     alignment and structure
>1ys7_A Transcriptional regulatory protein PRRA; response regulator, DNA binding domain, phosphorylation; 1.58A {Mycobacterium tuberculosis} SCOP: a.4.6.1 c.23.1.1 PDB: 1ys6_A Back     alignment and structure
>1u78_A TC3 transposase, transposable element TC3 transposase; transposon DNA, bipartite DNA-binding, HTH- motif, DNA binding protein/DNA complex; 2.69A {Caenorhabditis elegans} SCOP: a.4.1.2 a.4.1.2 Back     alignment and structure
>1pdn_C Protein (PRD paired); protein-DNA complex, double helix, PAX, paired domain, DNA-binding protein, gene regulation/DNA complex; HET: DNA; 2.50A {Drosophila melanogaster} SCOP: a.4.1.5 Back     alignment and structure
>1zx4_A P1 PARB, plasmid partition PAR B protein, PARB; translation; HET: CIT; 2.98A {Enterobacteria phage P1} PDB: 2ntz_A Back     alignment and structure
>3q9s_A DNA-binding response regulator; DNA binding protein; 2.40A {Deinococcus radiodurans} Back     alignment and structure
>3r0j_A Possible two component system response transcript positive regulator PHOP; beta-alpha fold, winged helix-turn-helix; 2.50A {Mycobacterium tuberculosis} Back     alignment and structure
>1k78_A Paired box protein PAX5; paired domain, ETS domain, transcription factor, transcription/DNA complex; 2.25A {Homo sapiens} SCOP: a.4.1.5 a.4.1.5 PDB: 1mdm_A 6pax_A Back     alignment and structure
>1l0o_C Sigma factor; bergerat fold, helix-turn-helix, protein binding; HET: ADP; 2.90A {Geobacillus stearothermophilus} SCOP: a.4.13.2 Back     alignment and structure
>2hqr_A Putative transcriptional regulator; phosporylation-independent response regulator, H. pylori, SY dimer, signaling protein; NMR {Helicobacter pylori} Back     alignment and structure
>2d1h_A ST1889, 109AA long hypothetical transcriptional regulator; helix-turn-helix, intermolecular and intramolecular S-S bond structural genomics; 2.05A {Sulfolobus tokodaii} SCOP: a.4.5.50 Back     alignment and structure
>2elh_A CG11849-PA, LD40883P; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Drosophila melanogaster} Back     alignment and structure
>2w48_A Sorbitol operon regulator; SORC, activator, repressor, DNA-binding, transcription, transcription regulator, transcription regulation; 3.20A {Klebsiella pneumoniae} Back     alignment and structure
>3k2z_A LEXA repressor; winged helix-turn-helix, SOS system, autoca cleavage, DNA damage, DNA repair, DNA replication, DNA-BIND hydrolase; 1.37A {Thermotoga maritima} Back     alignment and structure
>2o3f_A Putative HTH-type transcriptional regulator YBBH; APC85504, putative transcriptional regulator YBBH; HET: MLY; 1.75A {Bacillus subtilis} SCOP: a.4.1.20 Back     alignment and structure
>2heo_A Z-DNA binding protein 1; protein DLM1-Z-DNA complex, immune system-DNA complex; 1.70A {Mus musculus} PDB: 1j75_A Back     alignment and structure
>1oyi_A Double-stranded RNA-binding protein; (alpha+beta) helix-turn-helix, viral protein; NMR {Vaccinia virus} SCOP: a.4.5.19 Back     alignment and structure
>3nqo_A MARR-family transcriptional regulator; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE PG4; 2.20A {Clostridium difficile} Back     alignment and structure
>2dbb_A Putative HTH-type transcriptional regulator PH006; ASNC family, helix-turn-helix (HTH) domain, structural genom NPPSFA; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>1r1u_A CZRA, repressor protein; zinc, DNA binding, transcriptional regulation, winged HTH protein, transcription repressor; 2.00A {Staphylococcus aureus} SCOP: a.4.5.5 PDB: 1r1v_A 2kjb_A 2kjc_A Back     alignment and structure
>2cfx_A HTH-type transcriptional regulator LRPC; transcriptional regulation, DNA binding, FFRP; 2.4A {Bacillus subtilis} SCOP: a.4.5.32 d.58.4.2 Back     alignment and structure
>2glo_A Brinker CG9653-PA; protein-DNA complex, helix-turn-helix motif, transcription/DNA complex; NMR {Drosophila melanogaster} Back     alignment and structure
>1y0u_A Arsenical resistance operon repressor, putative; structural genomics, protein structure initiative, PSI; HET: MSE; 1.60A {Archaeoglobus fulgidus} SCOP: a.4.5.5 Back     alignment and structure
>3bro_A Transcriptional regulator; helix_TURN_helix, multiple antibiotic resistance protein (MA structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.04A {Oenococcus oeni} SCOP: a.4.5.28 Back     alignment and structure
>3ech_A MEXR, multidrug resistance operon repressor; winged helix, helix-turn-helix, protein-peptide complex; 1.80A {Pseudomonas aeruginosa} SCOP: a.4.5.28 PDB: 1lnw_A 3mex_A Back     alignment and structure
>3r0a_A Putative transcriptional regulator; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.31A {Methanosarcina mazei} Back     alignment and structure
>3tgn_A ADC operon repressor ADCR; helix-turn-helix, transcriptional regulator, transcription; 2.00A {Streptococcus pneumoniae} Back     alignment and structure
>2cyy_A Putative HTH-type transcriptional regulator PH151; structural genomics, pyrococcus horikosii OT3, NPPSFA; HET: MSE GLN; 1.80A {Pyrococcus horikoshii} SCOP: a.4.5.32 d.58.4.2 Back     alignment and structure
>2cg4_A Regulatory protein ASNC; DNA binding, FFRP, LRP family, transcription, DNA- binding, transcription regulation; 2.4A {Escherichia coli} SCOP: a.4.5.32 d.58.4.2 Back     alignment and structure
>2jn6_A Protein CGL2762, transposase; GFT PSI-2, protein structure, structural genomics, protein structure initiative; NMR {Corynebacterium glutamicum} SCOP: a.4.1.19 Back     alignment and structure
>2w25_A Probable transcriptional regulatory protein; transcription regulation, mutant, RV3291C, Glu104Ala, DNA-binding; 2.15A {Mycobacterium tuberculosis} PDB: 2vbw_A* 2vbx_A* 2vby_A* 2vbz_A* 2vc0_A 2vc1_A 2w24_A 2ivm_A 2w29_A 2qz8_A Back     alignment and structure
>2p5v_A Transcriptional regulator, LRP/ASNC family; NMB0573, structu genomics; 1.99A {Neisseria meningitidis} PDB: 2p6s_A 2p6t_A Back     alignment and structure
>3eco_A MEPR; mutlidrug efflux pump regulator winged helix-turn-helix motif, DNA-binding, transcription, transcription regulation; 2.40A {Staphylococcus aureus} SCOP: a.4.5.0 Back     alignment and structure
>2zkz_A Transcriptional repressor PAGR; protein-DNA, HTH motif, dimer, DN binding, transcription regulation; 2.00A {Bacillus anthracis} Back     alignment and structure
>1sfx_A Conserved hypothetical protein AF2008; structural genomics, HTH MOT protein structure initiative, midwest center for structural genomics; 1.55A {Archaeoglobus fulgidus} SCOP: a.4.5.50 Back     alignment and structure
>1i1g_A Transcriptional regulator LRPA; helix-turn-helix, LRP/ASNC family; 2.90A {Pyrococcus furiosus} SCOP: a.4.5.32 d.58.4.2 Back     alignment and structure
>3bpv_A Transcriptional regulator; MARR, DNA binding, transcription factor, winged helix motif, DNA-binding; 1.40A {Methanobacterium thermoautotrophicum} PDB: 3bpx_A* Back     alignment and structure
>2x4h_A Hypothetical protein SSO2273; transcription; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2gxg_A 146AA long hypothetical transcriptional regulator; winged helix; 1.45A {Sulfolobus tokodaii} PDB: 2eb7_A 2yr2_A 3gez_A 3gf2_A* 3gfi_A 3gfm_A 3gfj_A 3gfl_A Back     alignment and structure
>2pn6_A ST1022, 150AA long hypothetical transcriptional regulator; LRP/ASNC family Gln binding, structural genomics, NPPSFA; HET: GLN; 1.44A {Sulfolobus tokodaii} PDB: 2efn_A* 2e7x_A* 2e7w_A* 2yx4_A* 2efq_A* 2pmh_A* 2yx7_A* 2efp_A* 2efo_A* Back     alignment and structure
>3cuo_A Uncharacterized HTH-type transcriptional regulato; DNA-binding transcriptional regulator, structural genomics, MCSG; 2.00A {Escherichia coli K12} Back     alignment and structure
>3bdd_A Regulatory protein MARR; putative multiple antibiotic-resistance repressor, structura genomics, joint center for structural genomics, JCSG; 2.20A {Streptococcus suis} Back     alignment and structure
>3pqk_A Biofilm growth-associated repressor; helix-turn-helix motif, winged-helix fold, transcriptional R DNA binding, transcription; 2.09A {Xylella fastidiosa} PDB: 3pqj_A Back     alignment and structure
>2k27_A Paired box protein PAX-8; paired domain, solution structure, triple frequency, 3D NMR, induced FIT, alternative splicing, developmental protein; NMR {Homo sapiens} Back     alignment and structure
>3i4p_A Transcriptional regulator, ASNC family; PSI, structural genom protein structure initiative, midwest center for structural genomics; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>2fa5_A Transcriptional regulator MARR/EMRR family; multiple antibiotics resistance repressor, XCC structural genomics, X-RAY diffraction; 1.80A {Xanthomonas campestris} Back     alignment and structure
>2lkp_A Transcriptional regulator, ARSR family; symmetric homodimer, NI(II) binding protein, DNA binding Pro transcription regulator; NMR {Mycobacterium tuberculosis} Back     alignment and structure
>2nnn_A Probable transcriptional regulator; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.40A {Pseudomonas aeruginosa} Back     alignment and structure
>3jth_A Transcription activator HLYU; transcription factor, RTXA, DNA-binding, transcription regulation; 2.00A {Vibrio vulnificus} Back     alignment and structure
>3iwf_A Transcription regulator RPIR family; transcriptional, N-terminal, PSI, MCSG, structural genomics, midwest center structural genomics; 1.40A {Staphylococcus epidermidis} Back     alignment and structure
>4hbl_A Transcriptional regulator, MARR family; HTH, transcription factor, DNA binding; 2.50A {Staphylococcus epidermidis} Back     alignment and structure
>3cdh_A Transcriptional regulator, MARR family; helix-turn-hleix, structura genomics, PSI-2, protein structure initiative; 2.69A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>2oqg_A Possible transcriptional regulator, ARSR family P; winged-helix-turn-helix, structural genomics, PSI-2, protein structure initiative; 1.54A {Rhodococcus SP} Back     alignment and structure
>2qww_A Transcriptional regulator, MARR family; YP_013417.1, multiple antibiotic-resistance repressor (MARR) structural genomics; HET: MSE; 2.07A {Listeria monocytogenes str} Back     alignment and structure
>2l0k_A Stage III sporulation protein D; SPOIIID, solution structure, DNA binding, bacillus subti transcription factor, transcription; NMR {Bacillus subtilis} Back     alignment and structure
>1uxc_A FRUR (1-57), fructose repressor; DNA-binding protein, LACI family, transc regulation; NMR {Escherichia coli} SCOP: a.35.1.5 PDB: 1uxd_A Back     alignment and structure
>2rdp_A Putative transcriptional regulator MARR; PFAM PF01047, winged-helix binding motif, structural genomics, PSI-2; 2.30A {Geobacillus stearothermophilus} Back     alignment and structure
>1ku9_A Hypothetical protein MJ223; putative transcription factor, homodimeric winged-helix fold, structural genomics, PSI; 2.80A {Methanocaldococcus jannaschii} SCOP: a.4.5.36 Back     alignment and structure
>2ia0_A Putative HTH-type transcriptional regulator PF086; ASNC, PSI, structural genomics, southeast collaboratory for structural genomics; 2.37A {Pyrococcus furiosus} Back     alignment and structure
>1jgs_A Multiple antibiotic resistance protein MARR; transcription regulation, DNA-binding, repressor, transcription; HET: SAL; 2.30A {Escherichia coli} SCOP: a.4.5.28 Back     alignment and structure
>1r1t_A Transcriptional repressor SMTB; zinc, transcriptional regulation, winged HTH protein, DNA binding, transcription repressor; 1.70A {Synechococcus elongatus pcc 7942} SCOP: a.4.5.5 PDB: 1r23_A 1smt_A 1r22_A Back     alignment and structure
>3cjn_A Transcriptional regulator, MARR family; silicibacter pomeroy structural genomics, PSI-2, protein structure initiative; 1.95A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>1sfu_A 34L protein; protein/Z-DNA complex, DNA binding protein/DNA complex; 2.00A {Yaba-like disease virus} SCOP: a.4.5.19 Back     alignment and structure
>3hsr_A HTH-type transcriptional regulator SARZ; helix-turn-helix, cysteine disulfide, MARR-family transcript regulator, DNA-binding; 1.90A {Staphylococcus aureus subsp} PDB: 3hse_A 3hrm_A 4gxo_A Back     alignment and structure
>3frw_A Putative Trp repressor protein; structural genomics, APC21159, PSI-2, P structure initiative; 2.05A {Ruminococcus obeum atcc 29174} PDB: 3g1c_A Back     alignment and structure
>3fm5_A Transcriptional regulator; MCSG, PF04017, PSI, MARR, structu genomics, protein structure initiative, midwest center for structural genomics; HET: GOL; 2.00A {Rhodococcus jostii} Back     alignment and structure
>1s3j_A YUSO protein; structural genomics, MARR transcriptional regulator family, PSI, protein structure initiative; HET: MSE; 2.25A {Bacillus subtilis} SCOP: a.4.5.28 Back     alignment and structure
>3f3x_A Transcriptional regulator, MARR family, putative; DNA binding protein, DNA-binding, transcription regulation; 1.90A {Sulfolobus solfataricus} Back     alignment and structure
>3bj6_A Transcriptional regulator, MARR family; helix-turn-helix, trasnscription regulator, STR genomics, PSI-2, protein structure initiative; 2.01A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>2qvo_A Uncharacterized protein AF_1382; PSI, structural genomics, southeast collaboratory for structural genomics; 1.85A {Archaeoglobus fulgidus dsm 4304} PDB: 3o3k_A 3ov8_A Back     alignment and structure
>2nyx_A Probable transcriptional regulatory protein, RV14; alpha/beta, structural genomics, PSI-2; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>2kko_A Possible transcriptional regulatory protein (possibly ARSR-family); NESG, DNA-binding, transcription regulation, WHTH, homodimer; NMR {Mycobacterium bovis} PDB: 3gw2_A Back     alignment and structure
>3oop_A LIN2960 protein; protein structure initiative, PSI-2, structural genomics, MI center for structural genomics, MCSG, unknown function; 1.78A {Listeria innocua} Back     alignment and structure
>3qbm_A TETR transcriptional regulator; DNA/RNA-binding three-helical bundle, structural genomics, J center for structural genomics, JCSG; HET: MSE PGE; 1.80A {Chloroflexus aurantiacus} Back     alignment and structure
>3nrv_A Putative transcriptional regulator (MARR/EMRR FAM; PSI-2, protein structure initiati structural genomics; HET: MSE; 2.00A {Acinetobacter SP} Back     alignment and structure
>1zug_A Phage 434 CRO protein; gene regulating protein, transcription regulation; NMR {Phage 434} SCOP: a.35.1.2 PDB: 2cro_A 3cro_L* Back     alignment and structure
>1r69_A Repressor protein CI; gene regulating protein; 2.00A {Phage 434} SCOP: a.35.1.2 PDB: 1pra_A 1per_L 1rpe_L* 2or1_L* 1r63_A 2r63_A 1sq8_A Back     alignment and structure
>2fbh_A Transcriptional regulator PA3341; MARR, transcription regulator, APC5857, structural genomics, protein structure initiative; 1.80A {Pseudomonas aeruginosa} SCOP: a.4.5.28 Back     alignment and structure
>3ppb_A Putative TETR family transcription regulator; DNA-binding, helix-turn-helix motif, HTH motif, DNA/RNA-BIND helical bundle fold; HET: MSE PG4; 2.10A {Shewanella loihica} Back     alignment and structure
>2xi8_A Putative transcription regulator; HTH DNA-binding motif; HET: GOL; 1.21A {Enterococcus faecalis} PDB: 2gzu_A 1utx_A* 2xj3_A 2xiu_A Back     alignment and structure
>3kz3_A Repressor protein CI; five helix bundle, DNA-binding, transcription, transcription regulation; 1.64A {Enterobacteria phage lambda} Back     alignment and structure
>3qq6_A HTH-type transcriptional regulator SINR; helix-turn-helix motif, biofilm, repressor, SINI; 1.90A {Bacillus subtilis} Back     alignment and structure
>1jhf_A LEXA repressor; LEXA SOS repressor, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.2 b.87.1.1 PDB: 1jhh_A 3jso_A* 3jsp_A* 3k3r_E* 1jhc_A 1jhe_A 1lea_A 1leb_A Back     alignment and structure
>2a6c_A Helix-turn-helix motif; putative transcriptional regulator, structural genomics, JOI for structural genomics, JCSG; HET: CIT; 1.90A {Nitrosomonas europaea} SCOP: a.35.1.13 Back     alignment and structure
>2htj_A P fimbrial regulatory protein KS71A; winged helix-turn-helix, PAP PILI, transcription activator; NMR {Escherichia coli} SCOP: a.4.5.73 Back     alignment and structure
>3dcf_A Transcriptional regulator of the TETR/ACRR family; YP_290855.1, structural genomics, joint center for structural genomics, JCSG; 2.50A {Thermobifida fusca YX} Back     alignment and structure
>3kp7_A Transcriptional regulator TCAR; multiple drug resistance, biofilm, transcription regulation, binding, transcription regulator; 2.30A {Staphylococcus epidermidis RP62A} PDB: 3kp3_A* 3kp4_A* 3kp5_A* 3kp2_A* 3kp6_A Back     alignment and structure
>1uly_A Hypothetical protein PH1932; helix-turn-helix, structural genomics, DNA binding protein; 2.50A {Pyrococcus horikoshii} SCOP: a.4.5.58 PDB: 2cwe_A Back     alignment and structure
>3k0l_A Repressor protein; helix-turn-helix, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.35A {Acinetobacter SP} Back     alignment and structure
>1u2w_A CADC repressor, cadmium efflux system accessory protein; LEAD, SOFT metal ION resistance, ARSR/SM family, DNA binding protein; 1.90A {Staphylococcus aureus} SCOP: a.4.5.5 PDB: 3f72_A Back     alignment and structure
>3g3z_A NMB1585, transcriptional regulator, MARR family; transcription factor, structur genomics, oxford protein production facility; 2.10A {Neisseria meningitidis serogroup B} Back     alignment and structure
>3s2w_A Transcriptional regulator, MARR family; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics; 2.45A {Methanosarcina mazei} Back     alignment and structure
>2a61_A Transcriptional regulator TM0710; APC4350, MCSG, midwest center for structural genomics, PSI, protein structure initiative, MARR; 1.80A {Thermotoga maritima} SCOP: a.4.5.28 Back     alignment and structure
>1y7y_A C.AHDI; helix-turn-helix, DNA-binding protein, transcriptional regulator, transcription regulator; 1.69A {Aeromonas hydrophila} SCOP: a.35.1.3 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 473
d1ttya_87 a.4.13.2 (A:) Sigma70 (SigA, RpoD) {Thermotoga mar 4e-20
d1siga_334 a.177.1.1 (A:) Sigma70 {Escherichia coli [TaxId: 5 1e-18
d1ku2a2180 a.177.1.1 (A:93-272) Sigma factor SigA {Thermus aq 7e-18
d2p7vb168 a.4.13.2 (B:546-613) Sigma70 (SigA, RpoD) {Escheri 2e-16
d1ku3a_61 a.4.13.2 (A:) Sigma70 (SigA, RpoD) {Thermus aquati 9e-16
d1rp3a387 a.177.1.1 (A:0-86) Sigma factor sigma-28 (FliA) {A 3e-13
d1rp3a271 a.4.13.2 (A:164-234) Sigma factor sigma-28 (FliA) 2e-09
d1or7a168 a.4.13.2 (A:120-187) SigmaE factor (RpoE) {Escheri 1e-04
>d1ttya_ a.4.13.2 (A:) Sigma70 (SigA, RpoD) {Thermotoga maritima [TaxId: 2336]} Length = 87 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Sigma3 and sigma4 domains of RNA polymerase sigma factors
family: Sigma4 domain
domain: Sigma70 (SigA, RpoD)
species: Thermotoga maritima [TaxId: 2336]
 Score = 82.5 bits (204), Expect = 4e-20
 Identities = 30/80 (37%), Positives = 51/80 (63%)

Query: 393 VQKQLMRQHVRNLLTLLNPKERCIVRLRFGIEDGKPKSLSEVGNIFGLSKERVRQLESRA 452
             + LMR+ +  +L  L+P+E  ++R+R+G+ DGKPK+L EVG  F +++ER+RQ+E +A
Sbjct: 3   AMRMLMREELEKVLKTLSPREAMVLRMRYGLLDGKPKTLEEVGQYFNVTRERIRQIEVKA 62

Query: 453 LYRLKQSLGGKASYGYADLL 472
           L +L+     K       L+
Sbjct: 63  LRKLRHPSRSKYLKSLLSLM 82


>d1siga_ a.177.1.1 (A:) Sigma70 {Escherichia coli [TaxId: 562]} Length = 334 Back     information, alignment and structure
>d1ku2a2 a.177.1.1 (A:93-272) Sigma factor SigA {Thermus aquaticus [TaxId: 271]} Length = 180 Back     information, alignment and structure
>d2p7vb1 a.4.13.2 (B:546-613) Sigma70 (SigA, RpoD) {Escherichia coli [TaxId: 562]} Length = 68 Back     information, alignment and structure
>d1ku3a_ a.4.13.2 (A:) Sigma70 (SigA, RpoD) {Thermus aquaticus [TaxId: 271]} Length = 61 Back     information, alignment and structure
>d1rp3a3 a.177.1.1 (A:0-86) Sigma factor sigma-28 (FliA) {Aquifex aeolicus [TaxId: 63363]} Length = 87 Back     information, alignment and structure
>d1rp3a2 a.4.13.2 (A:164-234) Sigma factor sigma-28 (FliA) {Aquifex aeolicus [TaxId: 63363]} Length = 71 Back     information, alignment and structure
>d1or7a1 a.4.13.2 (A:120-187) SigmaE factor (RpoE) {Escherichia coli [TaxId: 562]} Length = 68 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query473
d1ku2a2180 Sigma factor SigA {Thermus aquaticus [TaxId: 271]} 99.8
d1ttya_87 Sigma70 (SigA, RpoD) {Thermotoga maritima [TaxId: 99.53
d2p7vb168 Sigma70 (SigA, RpoD) {Escherichia coli [TaxId: 562 99.49
d1ku3a_61 Sigma70 (SigA, RpoD) {Thermus aquaticus [TaxId: 27 99.43
d1rp3a271 Sigma factor sigma-28 (FliA) {Aquifex aeolicus [Ta 99.42
d1or7a168 SigmaE factor (RpoE) {Escherichia coli [TaxId: 562 99.28
d1siga_334 Sigma70 {Escherichia coli [TaxId: 562]} 99.09
d1rp3a387 Sigma factor sigma-28 (FliA) {Aquifex aeolicus [Ta 98.93
d1xsva_106 Hypothetical protein SAV1236 {Staphylococcus aureu 98.85
d1s7oa_106 Hypothetical protein SPy1201 {Streptococcus pyogen 98.82
d1or7a2113 SigmaE factor (RpoE) {Escherichia coli [TaxId: 562 98.34
d1yioa170 Response regulatory protein StyR, C-terminal domai 98.29
d1rp3a177 Sigma factor sigma-28 (FliA) {Aquifex aeolicus [Ta 98.26
d1l0oc_57 SigmaF {Bacillus stearothermophilus [TaxId: 1422]} 98.21
d1a04a167 Nitrate/nitrite response regulator (NarL) {Escheri 98.11
d1l3la165 Quorum-sensing transcription factor TraR, C-termin 97.95
d1fsea_67 Germination protein GerE {Bacillus subtilis [TaxId 97.9
d1ku2a160 Sigma factor SigA {Thermus aquaticus [TaxId: 271]} 97.75
d1p4wa_87 Transcriptional regulator RcsB {Erwinia amylovora 97.57
d1h3la_75 Sigma factor SigR {Streptomyces coelicolor a3(2) [ 97.54
d1jhfa171 LexA repressor, N-terminal DNA-binding domain {Esc 95.84
d1rp3a387 Sigma factor sigma-28 (FliA) {Aquifex aeolicus [Ta 95.61
d1ijwc_47 HIN recombinase (DNA-binding domain) {Synthetic} 93.94
d2cfxa163 Transcriptional regulator LrpC {Bacillus subtilis 92.11
d2cg4a163 Regulatory protein AsnC {Escherichia coli [TaxId: 92.06
d1i1ga160 LprA {Archaeon Pyrococcus furiosus [TaxId: 2261]} 91.88
d1hlva166 DNA-binding domain of centromere binding protein B 91.54
d1gdta143 gamma,delta resolvase (C-terminal domain) {Escheri 90.75
d2cyya160 Putative transcriptional regulator PH1519 {Archaeo 90.49
d2jn6a189 Uncharacterized protein Cgl2762 {Corynebacterium g 89.85
d1stza187 Heat-inducible transcription repressor HrcA, N-ter 89.33
d1pdnc_123 Paired protein (prd) {Fruit fly (Drosophila melano 88.88
d1l0oc_57 SigmaF {Bacillus stearothermophilus [TaxId: 1422]} 88.17
d1ku9a_151 DNA-binding protein Mj223 {Archaeon Methanococcus 87.51
d2ppxa162 Uncharacterized protein Atu1735 {Agrobacterium tum 87.49
d2isya163 Iron-dependent regulator IdeR {Mycobacterium tuber 87.16
d1dpua_69 C-terminal domain of RPA32 {Human (Homo sapiens) [ 86.7
d1rp3a177 Sigma factor sigma-28 (FliA) {Aquifex aeolicus [Ta 86.64
d1r1ta_98 SmtB repressor {Cyanobacteria (Synechococcus), pcc 86.4
d1r1ua_94 Metal-sensing transcriptional repressor CzrA {Stap 86.21
d3broa1135 Transcriptional regulator OEOE1854 {Oenococcus oen 86.02
d2a6ca169 HTH-motif protein NE1354 {Nitrosomonas europaea [T 85.48
d1biaa163 Biotin repressor, N-terminal domain {Escherichia c 85.13
d1utxa_66 Putative transcription regulator CylR2 {Enterococc 85.02
d1z05a171 Transcriptional regulator VC2007 N-terminal domain 84.87
d2o38a189 Hypothetical protein RPA3824 {Rhodopseudomonas pal 84.76
d1ku2a2180 Sigma factor SigA {Thermus aquaticus [TaxId: 271]} 84.62
d1yz8p160 Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 84.55
d2o3fa183 Putative transcriptional regulator YbbH {Bacillus 84.36
d1k78a163 Pax-5 {Human (Homo sapiens) [TaxId: 9606]} 84.27
d2d1ha1109 Hypothetical transcriptional regulator ST1889 {Sul 83.67
d1r69a_63 434 C1 repressor, DNA-binding domain {Bacteriophag 83.23
d2auwa167 Hypothetical protein NE0471 C-terminal domain {Nit 83.13
d1y7ya169 Restriction-modification controller protein C.AhdI 83.07
d1nr3a_122 DNA-binding protein Tfx {Archaeon Methanobacterium 82.92
d1lmb3_87 lambda C1 repressor, DNA-binding domain {Bacteriop 82.83
d2croa_65 cro 434 {Bacteriophage 434 [TaxId: 10712]} 82.46
d2ecca176 Homeobox-leucine zipper protein Homez {Human (Homo 82.3
d1r71a_114 Transcriptional repressor protein KorB DNA-binding 82.18
d1siga_334 Sigma70 {Escherichia coli [TaxId: 562]} 81.96
d1jhfa171 LexA repressor, N-terminal DNA-binding domain {Esc 81.72
d1fjla_65 Paired protein {Fruit fly (Drosophila melanogaster 81.71
d1sfxa_109 Hypothetical protein AF2008 {Archaeoglobus fulgidu 81.7
d1le8a_53 Mating type protein A1 Homeodomain {Baker's yeast 81.57
d1z6ra170 Mlc protein N-terminal domain {Escherichia coli [T 81.06
d1ig7a_58 Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10 80.9
d1ulya_ 190 Hypothetical protein PH1932 {Pyrococcus horikoshii 80.37
d1qpza157 Purine repressor (PurR), N-terminal domain {Escher 80.13
>d1ku2a2 a.177.1.1 (A:93-272) Sigma factor SigA {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
class: All alpha proteins
fold: Sigma2 domain of RNA polymerase sigma factors
superfamily: Sigma2 domain of RNA polymerase sigma factors
family: Sigma2 domain of RNA polymerase sigma factors
domain: Sigma factor SigA
species: Thermus aquaticus [TaxId: 271]
Probab=99.80  E-value=5.4e-21  Score=175.43  Aligned_cols=135  Identities=33%  Similarity=0.507  Sum_probs=105.3

Q ss_pred             ChhHHhhhcccCccCCCChHHHHHHHHHHHHHHHHHHHHHHHH------------------HHhCCCCC---------HH
Q 011992          254 NDPLRLFLWGPETRKLLTADEEFELIAQIQDLIRLEKEKSKLQ------------------SQFGREPT---------LI  306 (473)
Q Consensus       254 ~~~lR~~~~~pr~~~lLT~eEE~~L~~~iq~l~kle~a~~~L~------------------~~lGRePT---------~e  306 (473)
                      .||+|.|++.++++|+||+|||++|+++|+....+.....+..                  ...++.|.         ..
T Consensus         1 tDpVr~YLreig~v~LLT~EEEieLAr~Ie~g~~~~~~~~e~~~~~~~l~~e~~~~~~~~~~~~~~~~~~~e~~~~~~~~   80 (180)
T d1ku2a2           1 SDPVRQYLHEIGQVPLLTLEEEIDLARKVEEGMEAIKKLSEATGLDQELIREVVRAKILGTARIQKIPGLKEKPDPKTVE   80 (180)
T ss_dssp             CHHHHHHHHHHTTSCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHTTCSSCCCTTSCCSSCTTTHH
T ss_pred             CCcHHHHHHHhcCcCCCCHHHHHHHHHHHHHHHHHHHHHHHhhhccHHHHHHHHHHHhhhHHHHhcchhhHHHhhHHHHH
Confidence            3699999999999999999999999999988665433322211                  01222222         23


Q ss_pred             HHHHHcCCC---HHHHHHHHhhcchHHHHHHHHHHHHHHHHHHHhhcCCcchhhHhhhhHHHHHHHhhhhCccCCCcccc
Q 011992          307 EWAKAIGLS---CRDLKSELHSGNSSREKLINANLRLVVHVAKQYQGRGISLHDLLQEGSMGLMKSVEKFKPQAGCRFAN  383 (473)
Q Consensus       307 EiA~~lGms---~eeL~~~l~~g~~A~e~Li~~yl~lV~sIA~ry~~~~~saEDLiQEg~lgL~kAiekFDp~kg~~FsT  383 (473)
                      ++.......   ...+......|..|+++||..|+++|+++|++|.+.+.+++||+|+|++||++|+++|||++|++|+|
T Consensus        81 ~~~~~~~~~~~el~~l~~~~~~~~~a~~~li~~~~~lv~~~a~~~~~~~~~~~dl~q~g~~gl~~a~~~fd~~~g~~f~t  160 (180)
T d1ku2a2          81 EVDGKLKSLPKELKRYLHIAREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGLIRAVEKFEYKRRFKFST  160 (180)
T ss_dssp             HHHHHHHSCCHHHHHHHHHHHHHHHHHHHHHHTTHHHHHHHHHTTCSSSSCHHHHHHHHHHHHHHHHHHCCGGGCSCHHH
T ss_pred             HHHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcccCCCcCHHHHHHHHHHHHHHHHHHcCCCCCCCHHH
Confidence            333333332   34456677778899999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCC
Q 011992          384 TGVEI  388 (473)
Q Consensus       384 ~~~~~  388 (473)
                      +..++
T Consensus       161 ya~~~  165 (180)
T d1ku2a2         161 YATWW  165 (180)
T ss_dssp             HHHHH
T ss_pred             HHHHH
Confidence            76544



>d1ttya_ a.4.13.2 (A:) Sigma70 (SigA, RpoD) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2p7vb1 a.4.13.2 (B:546-613) Sigma70 (SigA, RpoD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ku3a_ a.4.13.2 (A:) Sigma70 (SigA, RpoD) {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1rp3a2 a.4.13.2 (A:164-234) Sigma factor sigma-28 (FliA) {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1or7a1 a.4.13.2 (A:120-187) SigmaE factor (RpoE) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1siga_ a.177.1.1 (A:) Sigma70 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rp3a3 a.177.1.1 (A:0-86) Sigma factor sigma-28 (FliA) {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1xsva_ a.4.13.3 (A:) Hypothetical protein SAV1236 {Staphylococcus aureus, strain Mu50 / ATCC 700699 [TaxId: 1280]} Back     information, alignment and structure
>d1s7oa_ a.4.13.3 (A:) Hypothetical protein SPy1201 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1yioa1 a.4.6.2 (A:131-200) Response regulatory protein StyR, C-terminal domain {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1rp3a1 a.4.13.1 (A:87-163) Sigma factor sigma-28 (FliA) {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1l0oc_ a.4.13.2 (C:) SigmaF {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1a04a1 a.4.6.2 (A:150-216) Nitrate/nitrite response regulator (NarL) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l3la1 a.4.6.2 (A:170-234) Quorum-sensing transcription factor TraR, C-terminal domain {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1fsea_ a.4.6.2 (A:) Germination protein GerE {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ku2a1 a.4.13.1 (A:273-332) Sigma factor SigA {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1p4wa_ a.4.6.2 (A:) Transcriptional regulator RcsB {Erwinia amylovora [TaxId: 552]} Back     information, alignment and structure
>d1h3la_ a.177.1.1 (A:) Sigma factor SigR {Streptomyces coelicolor a3(2) [TaxId: 100226]} Back     information, alignment and structure
>d1jhfa1 a.4.5.2 (A:2-72) LexA repressor, N-terminal DNA-binding domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rp3a3 a.177.1.1 (A:0-86) Sigma factor sigma-28 (FliA) {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ijwc_ a.4.1.2 (C:) HIN recombinase (DNA-binding domain) {Synthetic} Back     information, alignment and structure
>d2cfxa1 a.4.5.32 (A:1-63) Transcriptional regulator LrpC {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2cg4a1 a.4.5.32 (A:4-66) Regulatory protein AsnC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i1ga1 a.4.5.32 (A:2-61) LprA {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1hlva1 a.4.1.7 (A:1-66) DNA-binding domain of centromere binding protein B (CENP-B) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gdta1 a.4.1.2 (A:141-183) gamma,delta resolvase (C-terminal domain) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cyya1 a.4.5.32 (A:5-64) Putative transcriptional regulator PH1519 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2jn6a1 a.4.1.19 (A:1-89) Uncharacterized protein Cgl2762 {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d1stza1 a.4.5.51 (A:14-100) Heat-inducible transcription repressor HrcA, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pdnc_ a.4.1.5 (C:) Paired protein (prd) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1l0oc_ a.4.13.2 (C:) SigmaF {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ku9a_ a.4.5.36 (A:) DNA-binding protein Mj223 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2ppxa1 a.35.1.3 (A:30-91) Uncharacterized protein Atu1735 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2isya1 a.4.5.24 (A:2-64) Iron-dependent regulator IdeR {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1dpua_ a.4.5.16 (A:) C-terminal domain of RPA32 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rp3a1 a.4.13.1 (A:87-163) Sigma factor sigma-28 (FliA) {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1r1ta_ a.4.5.5 (A:) SmtB repressor {Cyanobacteria (Synechococcus), pcc7942 [TaxId: 1129]} Back     information, alignment and structure
>d1r1ua_ a.4.5.5 (A:) Metal-sensing transcriptional repressor CzrA {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d3broa1 a.4.5.28 (A:3-137) Transcriptional regulator OEOE1854 {Oenococcus oeni [TaxId: 1247]} Back     information, alignment and structure
>d2a6ca1 a.35.1.13 (A:1-69) HTH-motif protein NE1354 {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d1biaa1 a.4.5.1 (A:1-63) Biotin repressor, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1utxa_ a.35.1.3 (A:) Putative transcription regulator CylR2 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1z05a1 a.4.5.63 (A:10-80) Transcriptional regulator VC2007 N-terminal domain {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2o38a1 a.35.1.13 (A:28-116) Hypothetical protein RPA3824 {Rhodopseudomonas palustris [TaxId: 1076]} Back     information, alignment and structure
>d1ku2a2 a.177.1.1 (A:93-272) Sigma factor SigA {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2o3fa1 a.4.1.20 (A:1-83) Putative transcriptional regulator YbbH {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1k78a1 a.4.1.5 (A:19-81) Pax-5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d1ha1 a.4.5.50 (A:1-109) Hypothetical transcriptional regulator ST1889 {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1r69a_ a.35.1.2 (A:) 434 C1 repressor, DNA-binding domain {Bacteriophage 434 [TaxId: 10712]} Back     information, alignment and structure
>d2auwa1 a.35.1.10 (A:88-154) Hypothetical protein NE0471 C-terminal domain {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d1y7ya1 a.35.1.3 (A:5-73) Restriction-modification controller protein C.AhdI {Aeromonas hydrophila [TaxId: 644]} Back     information, alignment and structure
>d1nr3a_ d.236.1.1 (A:) DNA-binding protein Tfx {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1lmb3_ a.35.1.2 (3:) lambda C1 repressor, DNA-binding domain {Bacteriophage lambda [TaxId: 10710]} Back     information, alignment and structure
>d2croa_ a.35.1.2 (A:) cro 434 {Bacteriophage 434 [TaxId: 10712]} Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r71a_ a.4.14.1 (A:) Transcriptional repressor protein KorB DNA-binding domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1siga_ a.177.1.1 (A:) Sigma70 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jhfa1 a.4.5.2 (A:2-72) LexA repressor, N-terminal DNA-binding domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1sfxa_ a.4.5.50 (A:) Hypothetical protein AF2008 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z6ra1 a.4.5.63 (A:12-81) Mlc protein N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ulya_ a.4.5.58 (A:) Hypothetical protein PH1932 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1qpza1 a.35.1.5 (A:2-58) Purine repressor (PurR), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure