Citrus Sinensis ID: 012055

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470--
MLILMFLIMTEEAHCIAYKGFADCIRLLLFLDAYRGRQDKEGCTPLHWAAIRGNLEACTVLVQAGKKEDLMVTDNTGLTPAQLASDKNHRQVAFFLGNARRLLDKRCDGNSPIGKISKLGLAPALWCVILLMLVTYMHSVIMASNLPKLTAGFGLLAWSGVFLATGGLVLFYRCSRKDPGYIRMNVHDPQNMKDDEPLLKIEMNNPALLAGNWSQLCATCKIVRPLRAKHCSTCDRCVEQFDHHCPWVSNCIGKKNKWDFFLFLVLEVSAMLVTGAVTVIRVFTDPVAPSSFGAWMSYASTHHIGALSFLIADFSLFFGVAVLTAVQASQISRNITTNEMANALRYNYLRGAGGRFRNPYDHGCKRNCSDFLINGFNEDVECVEDSAGTEGIGMMHMSRNSNLQNGDGHIHHANGNGHVAINVNSNNTNSHHGHLHSSHCNHSNHGKSKTDSVPLGLGLGLGRSSARSVVAS
cHHHHHHHHccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHHccHHHHHHHHHccccccccccccccccHHHHHHHcccccHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHEEEEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHcccHHHcccccccccccccHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
cEEEHHEHcccHHHHHHHHccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccEEEcccccccHHHHHHHcccHHHHHHHHHHcccccccccccEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccEEcccEEEEEcccEEEEcccccccccHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHccccHccccccccccccccHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccEEEEEcccccccccccEEcccccccccccccccccccccccccccccccEEccc
MLILMFLIMTEEAHCIAYKGFADCIRLLLFLDAyrgrqdkegctplhwAAIRGNLEACTVLVQagkkedlmvtdntgltpaqlasdkNHRQVAFFLGNARRLLdkrcdgnspigkisklglaPALWCVILLMLVTYMHSVIMasnlpkltagFGLLAWSGVFLATGGLVLFYrcsrkdpgyirmnvhdpqnmkddepllkiemnnpallagnwSQLCATckivrplrakhcstcdrcveqfdhhcpwvsncigkknkwDFFLFLVLEVSAMLVTGAVTVIRVftdpvapssfgAWMSYASTHHIGALSFLIADFSLFFGVAVLTAVQASQISRNITTNEMANALRYNYLRgaggrfrnpydhgckrncsdflingfnedvecvedsagtegiGMMHmsrnsnlqngdghihhangNGHVAINVnsnntnshhghlhsshcnhsnhgksktdsvplglglglgrssarsvvas
MLILMFLIMTEEAHCIAYKGFADCIRLLLFLDAYRGRQDKEGCTPLHWAAIRGNLEACTVLVQAGKKEDLMVTDNTGLtpaqlasdknhRQVAFFLGNARRLLDKRCDGNSPigkisklglaPALWCVILLMLVTYMHSVIMASNLPKLTAGFGLLAWSGVFLATGGLVLFYRCSRKDPGYIRMNVHDPQNMKDDEPLLKIEMNNPALLAGNWSQLCATCKIVRPLRAKHCSTCDRCVEQFDHHCPWVSNCIGKKNKWDFFLFLVLEVSAMLVTGAVTVIRVFTDPVAPSSFGAWMSYASTHHIGALSFLIADFSLFFGVAVLTAVQasqisrnittnemANALRYNYLRGAGGRFRNPYDHGCKRNCSDFLINGFNEDVECVEDSAGTEGIGMMHMSRNSNLQNGDGHIHHANGNGHVAINVNSNNTNSHHGHLHSSHCNHSNHGKSKTDSVPLGlglglgrssarsvvas
MLILMFLIMTEEAHCIAYKGFADCIRLLLFLDAYRGRQDKEGCTPLHWAAIRGNLEACTVLVQAGKKEDLMVTDNTGLTPAQLASDKNHRQVAFFLGNARRLLDKRCDGNSPIGKISKLGLAPALWCVILLMLVTYMHSVIMASNLPKLTAGFGLLAWSGVFLATGGLVLFYRCSRKDPGYIRMNVHDPQNMKDDEPLLKIEMNNPALLAGNWSQLCATCKIVRPLRAKHCSTCDRCVEQFDHHCPWVSNCIGKKNKWDFFLFLVLEVSAMLVTGAVTVIRVFTDPVAPSSFGAWMSYASTHHIGALSFLIADFSLFFGVAVLTAVQASQISRNITTNEMANALRYNYLRGAGGRFRNPYDHGCKRNCSDFLINGFNEDVECVEDSAGTEGIGMMHMSRNSNLQNGDGHIHHANGNGHVAInvnsnntnshhghlhsshcnhsnhGKSKTDSVPlglglglgRSSARSVVAS
*LILMFLIMTEEAHCIAYKGFADCIRLLLFLDAYRGRQDKEGCTPLHWAAIRGNLEACTVLVQAGKKEDLMVTDNTGLTPAQLA*DKNHRQVAFFLGNARRLLDKRCDGNSPIGKISKLGLAPALWCVILLMLVTYMHSVIMASNLPKLTAGFGLLAWSGVFLATGGLVLFYRCSRKDPGYIRMNV***********LLKIEMNNPALLAGNWSQLCATCKIVRPLRAKHCSTCDRCVEQFDHHCPWVSNCIGKKNKWDFFLFLVLEVSAMLVTGAVTVIRVFTDPVAPSSFGAWMSYASTHHIGALSFLIADFSLFFGVAVLTAVQASQISRNITTNEMANALRYNYLRGAGGRFRNPYDHGCKRNCSDFLINGFNEDVECVED***************************************************************************************
MLILMFLIMTEEAHCIAYKGFADCIRLLLFLDAYRGRQDKEGCTPLHWAAIRGNLEACTVLVQAGKKE***************ASDKNHRQVAFFLGNARRLLDKRCDGNSPIGKISKLGLAPALWCVILLMLVTYMHSVIMASNLPKLTAGFGLLAWSGVFLATGGLVLFYRCSRKDPGYIRMNVH*************IEMNNPALLAGNWSQLCATCKIVRPLRAKHCSTCDRCVEQFDHHCPWVSNCIGKKNKWDFFLFLVLEVSAMLVTGAVTVIRVFTDPVAPSSFGAWMSYASTHHIGALSFLIADFSLFFGVAVLTAVQASQISRNITTNEMANALRYNYLRGA*GRFRNPYDHGCKRNCSDFLINGFNEDVECVE****************************************************************************************
MLILMFLIMTEEAHCIAYKGFADCIRLLLFLDAYRGRQDKEGCTPLHWAAIRGNLEACTVLVQAGKKEDLMVTDNTGLTPAQLASDKNHRQVAFFLGNARRLLDKRCDGNSPIGKISKLGLAPALWCVILLMLVTYMHSVIMASNLPKLTAGFGLLAWSGVFLATGGLVLFYRCSRKDPGYIRMNVHDPQNMKDDEPLLKIEMNNPALLAGNWSQLCATCKIVRPLRAKHCSTCDRCVEQFDHHCPWVSNCIGKKNKWDFFLFLVLEVSAMLVTGAVTVIRVFTDPVAPSSFGAWMSYASTHHIGALSFLIADFSLFFGVAVLTAVQASQISRNITTNEMANALRYNYLRGAGGRFRNPYDHGCKRNCSDFLINGFNEDVECVEDSAGTEGIGMMHMSRNSNLQNGDGHIHHANGNGHVAINVNSNNTN***********************VPLGLGLGLG**********
MLILMFLIMTEEAHCIAYKGFADCIRLLLFLDAYRGRQDKEGCTPLHWAAIRGNLEACTVLVQAGKKEDLMVTDNTGLTPAQLASDKNHRQVAFFLGNARRLLDKRCDGNSPIGKISKLGLAPALWCVILLMLVTYMHSVIMASNLPKLTAGFGLLAWSGVFLATGGLVLFYRCSRKDPGYIRMNV********DEPLLKIEMNNPALLAGNWSQLCATCKIVRPLRAKHCSTCDRCVEQFDHHCPWVSNCIGKKNKWDFFLFLVLEVSAMLVTGAVTVIRVFTDPVAPSSFGAWMSYASTHHIGALSFLIADFSLFFGVAVLTAVQASQISRNITTNEMANALRYNYLRGAGGRFRNPYDHGCKRNCSDFLINGFNEDVEC********GIG****SRNSNLQNGDGHIHHANGNGHVAINVNS******************************G****************
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLILMFLIMTEEAHCIAYKGFADCIRLLLFLDAYRGRQDKEGCTPLHWAAIRGNLEACTVLVQAGKKEDLMVTDNTGLTPAQLASDKNHRQVAFFLGNARRLLDKRCDGNSPIGKISKLGLAPALWCVILLMLVTYMHSVIMASNLPKLTAGFGLLAWSGVFLATGGLVLFYRCSRKDPGYIRMNVHDPQNMKDDEPLLKIEMNNPALLAGNWSQLCATCKIVRPLRAKHCSTCDRCVEQFDHHCPWVSNCIGKKNKWDFFLFLVLEVSAMLVTGAVTVIRVFTDPVAPSSFGAWMSYASTHHIGALSFLIADFSLFFGVAVLTAVQASQISRNITTNEMANALRYNYLRGAGGRFRNPYDHGCKRNCSDFLINGFNEDVECVEDSAGTEGIGMMHMSRNSNLQNGDGHIHHANGNGHVAINVNSNNTNSHHGHLHSSHCNHSNHGKSKTDSVPLGLGLGLGRSSARSVVAS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query472 2.2.26 [Sep-21-2011]
Q52T38620 S-acyltransferase TIP1 OS yes no 0.949 0.722 0.756 0.0
Q3EC11536 Probable S-acyltransferas no no 0.788 0.694 0.482 1e-103
Q9UVH3559 Palmitoyltransferase AKR1 N/A no 0.675 0.570 0.278 5e-28
Q8IUH5632 Palmitoyltransferase ZDHH yes no 0.716 0.534 0.264 3e-25
P0CS66776 Palmitoyltransferase AKR1 yes no 0.834 0.507 0.258 4e-25
P0CS67776 Palmitoyltransferase AKR1 N/A no 0.834 0.507 0.258 4e-25
Q80TN5632 Palmitoyltransferase ZDHH yes no 0.716 0.534 0.264 7e-25
Q4P6L3 844 Palmitoyltransferase AKR1 N/A no 0.830 0.464 0.253 1e-22
Q4X251738 Palmitoyltransferase akr1 yes no 0.633 0.405 0.267 3e-22
Q7Z8U2737 Palmitoyltransferase akr1 yes no 0.627 0.401 0.273 7e-22
>sp|Q52T38|ZDH22_ARATH S-acyltransferase TIP1 OS=Arabidopsis thaliana GN=TIP1 PE=2 SV=1 Back     alignment and function desciption
 Score =  710 bits (1832), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/460 (75%), Positives = 399/460 (86%), Gaps = 12/460 (2%)

Query: 14  HCIAYKGFADCIRLLLFLDAYRGRQDKEGCTPLHWAAIRGNLEACTVLVQAGKKEDLMVT 73
           H  AYKGFAD IRLLLFLDAYRGRQDKEGCTPLHWAAIRGNLEACTVLVQAGKKEDLM+T
Sbjct: 170 HWAAYKGFADSIRLLLFLDAYRGRQDKEGCTPLHWAAIRGNLEACTVLVQAGKKEDLMIT 229

Query: 74  DNTGLTPAQLASDKNHRQVAFFLGNARRLLDKRCDGNSPIGKISKLGLAPALWCVILLML 133
           D TGLTPAQLA++KNHRQV+FFLGNAR LL+KRCDG+SP+G++SKLGLAP LW +ILL+L
Sbjct: 230 DKTGLTPAQLAAEKNHRQVSFFLGNARSLLEKRCDGSSPLGRLSKLGLAPVLWIMILLLL 289

Query: 134 VTYMHSVIMASNLPKLTAGFGLLAWSGVFLATGGLVLFYRCSRKDPGYIRMNVHDPQNMK 193
           + Y +SV++ASNLPKLT G G LAW G  LAT GL LFYRCSRKDPGYIRMN+HDPQ MK
Sbjct: 290 LVYTNSVVLASNLPKLTTGIGALAWLGFILATAGLFLFYRCSRKDPGYIRMNIHDPQTMK 349

Query: 194 DDEPLLKIEMNNPALLAGNWSQLCATCKIVRPLRAKHCSTCDRCVEQFDHHCPWVSNCIG 253
           DDEPLLKIE+NNPALLAGNW+QLCATCKI+RPLRAKHCSTCDRCVEQFDHHCPWVSNC+G
Sbjct: 350 DDEPLLKIELNNPALLAGNWTQLCATCKIIRPLRAKHCSTCDRCVEQFDHHCPWVSNCVG 409

Query: 254 KKNKWDFFLFLVLEVSAMLVTGAVTVIRVFTDPVAPSSFGAWMSYASTHHIGALSFLIAD 313
           KKNKW+FFLFL+LEV AML+TG VT+ RV +DP APSSFGAWMS+ +++H+GALSFL+ +
Sbjct: 410 KKNKWEFFLFLLLEVLAMLITGGVTLARVLSDPSAPSSFGAWMSHVASNHVGALSFLLVE 469

Query: 314 FSLFFGVAVLTAVQASQISRNITTNEMANALRYNYLRGAGGRFRNPYDHGCKRNCSDFLI 373
           F LFF VAVLT +QASQISRNITTNEMANALRY+YLRG GGRFRNPYD GC+RNCSDFL+
Sbjct: 470 FCLFFSVAVLTVIQASQISRNITTNEMANALRYSYLRGPGGRFRNPYDLGCRRNCSDFLV 529

Query: 374 NGFNEDVECVEDSAGT--EGIGMMHMSRNSNLQNGDGHIHHANGNGHVAINVNSNNTNSH 431
            G+NED+EC E+ A    EGI MM M RN NLQ         NGNGHVAI+VN  + NS 
Sbjct: 530 KGYNEDIECHEEDATQRPEGISMMQMQRNPNLQ---------NGNGHVAIDVNPTH-NSQ 579

Query: 432 HGHLHSSHCNHSNHGKSKTDSVPLGLGLGLGRSSARSVVA 471
             H+HS++C+HS++ KSK+D+VPLGLGLGL R+  R VV+
Sbjct: 580 SAHVHSANCSHSHNSKSKSDNVPLGLGLGLSRNPTRPVVS 619
Palmitoyltransferase involved in cell growth regulation.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 3EC: .EC: 1EC: .EC: -
>sp|Q3EC11|ZDHC2_ARATH Probable S-acyltransferase At2g14255 OS=Arabidopsis thaliana GN=At2g14255 PE=2 SV=2 Back     alignment and function description
>sp|Q9UVH3|AKR1_MORAP Palmitoyltransferase AKR1 (Fragment) OS=Mortierella alpina PE=3 SV=1 Back     alignment and function description
>sp|Q8IUH5|ZDH17_HUMAN Palmitoyltransferase ZDHHC17 OS=Homo sapiens GN=ZDHHC17 PE=1 SV=2 Back     alignment and function description
>sp|P0CS66|AKR1_CRYNJ Palmitoyltransferase AKR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=AKR1 PE=3 SV=1 Back     alignment and function description
>sp|P0CS67|AKR1_CRYNB Palmitoyltransferase AKR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=AKR1 PE=3 SV=1 Back     alignment and function description
>sp|Q80TN5|ZDH17_MOUSE Palmitoyltransferase ZDHHC17 OS=Mus musculus GN=Zdhhc17 PE=1 SV=2 Back     alignment and function description
>sp|Q4P6L3|AKR1_USTMA Palmitoyltransferase AKR1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=AKR1 PE=3 SV=1 Back     alignment and function description
>sp|Q4X251|AKR1_ASPFU Palmitoyltransferase akr1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=akr1 PE=3 SV=2 Back     alignment and function description
>sp|Q7Z8U2|AKR1_ASPOR Palmitoyltransferase akr1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=akr1 PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query472
224144084497 predicted protein [Populus trichocarpa] 0.970 0.921 0.830 0.0
356562922 633 PREDICTED: S-acyltransferase TIP1-like [ 0.968 0.721 0.796 0.0
225446195 635 PREDICTED: S-acyltransferase TIP1 [Vitis 0.963 0.716 0.806 0.0
449443019 632 PREDICTED: S-acyltransferase TIP1-like [ 0.972 0.726 0.812 0.0
357478389 642 S-acyltransferase TIP1 [Medicago truncat 0.963 0.708 0.777 0.0
224120466 608 predicted protein [Populus trichocarpa] 0.902 0.700 0.773 0.0
79517230 620 S-acyltransferase TIP1 [Arabidopsis thal 0.949 0.722 0.756 0.0
312282023 619 unnamed protein product [Thellungiella h 0.851 0.649 0.782 0.0
357123214 638 PREDICTED: S-acyltransferase TIP1-like [ 0.947 0.700 0.656 0.0
413954646 639 hypothetical protein ZEAMMB73_866253 [Ze 0.949 0.701 0.685 0.0
>gi|224144084|ref|XP_002325180.1| predicted protein [Populus trichocarpa] gi|222866614|gb|EEF03745.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  798 bits (2060), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/460 (83%), Positives = 419/460 (91%), Gaps = 2/460 (0%)

Query: 14  HCIAYKGFADCIRLLLFLDAYRGRQDKEGCTPLHWAAIRGNLEACTVLVQAGKKEDLMVT 73
           H  AYKGF DCIRLLLFLD+YRGRQD+EGCTPLHWAAIRGNLEACTVLVQAGKKEDLMVT
Sbjct: 39  HWAAYKGFPDCIRLLLFLDSYRGRQDREGCTPLHWAAIRGNLEACTVLVQAGKKEDLMVT 98

Query: 74  DNTGLTPAQLASDKNHRQVAFFLGNARRLLDKRCDGNSPIGKISKLGLAPALWCVILLML 133
           DNTGLTPAQLASDKNHRQVAFFLGNARRLLDK+CDGNS +G++SKLGLAP LW +ILL+L
Sbjct: 99  DNTGLTPAQLASDKNHRQVAFFLGNARRLLDKQCDGNSRLGRLSKLGLAPVLWFIILLLL 158

Query: 134 VTYMHSVIMASNLPKLTAGFGLLAWSGVFLATGGLVLFYRCSRKDPGYIRMNVHDPQNMK 193
           VTY+H+VI+ASNLPKLTAGFGLLAW  VFL T GLV+FYRCSRKDPGYIRMNVHDPQNMK
Sbjct: 159 VTYVHAVILASNLPKLTAGFGLLAWLAVFLVTAGLVMFYRCSRKDPGYIRMNVHDPQNMK 218

Query: 194 DDEPLLKIEMNNPALLAGNWSQLCATCKIVRPLRAKHCSTCDRCVEQFDHHCPWVSNCIG 253
           DDEPLLKIE+NNPALL GNWSQLCATCKIVRPLRAKHCSTCDRCVEQFDHHCPWVSNCIG
Sbjct: 219 DDEPLLKIEINNPALLTGNWSQLCATCKIVRPLRAKHCSTCDRCVEQFDHHCPWVSNCIG 278

Query: 254 KKNKWDFFLFLVLEVSAMLVTGAVTVIRVFTDPVAPSSFGAWMSYASTHHIGALSFLIAD 313
           KKNKW+FF FLVLEVSAML+TG VT+ RV TDP+APSS GAW+++A +HHIGA+SFLI D
Sbjct: 279 KKNKWEFFAFLVLEVSAMLITGGVTLTRVLTDPLAPSSLGAWINHAVSHHIGAISFLIMD 338

Query: 314 FSLFFGVAVLTAVQASQISRNITTNEMANALRYNYLRGAGGRFRNPYDHGCKRNCSDFLI 373
           F LFFGVAVLT VQASQISRNITTNEMAN LRY+YLRG GGRFRNP+DHGCK+NCSDFLI
Sbjct: 339 FFLFFGVAVLTIVQASQISRNITTNEMANVLRYSYLRGPGGRFRNPFDHGCKKNCSDFLI 398

Query: 374 NGFNEDVECVEDSAGTEGIGMMHMSRNSNLQNGDGHIHHANGNGHVAINVNSNNTNSHHG 433
           NG+NEDVE  EDS  +EGIGMMHMSRNSNLQNGD H HH NGNGHV+INVNS  +  HHG
Sbjct: 399 NGYNEDVEYFEDSPHSEGIGMMHMSRNSNLQNGDAHSHHMNGNGHVSINVNS-ESKIHHG 457

Query: 434 HLHSSHCNHSNHGKSKTDSVP-LGLGLGLGRSSARSVVAS 472
           H+HSSHC+H + G+SK+D+ P    GLGLGRSSAR+V A+
Sbjct: 458 HVHSSHCSHDHQGRSKSDTEPLGLGGLGLGRSSARTVAAA 497

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356562922|ref|XP_003549717.1| PREDICTED: S-acyltransferase TIP1-like [Glycine max] Back     alignment and taxonomy information
>gi|225446195|ref|XP_002262878.1| PREDICTED: S-acyltransferase TIP1 [Vitis vinifera] gi|296084544|emb|CBI25565.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449443019|ref|XP_004139278.1| PREDICTED: S-acyltransferase TIP1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|357478389|ref|XP_003609480.1| S-acyltransferase TIP1 [Medicago truncatula] gi|355510535|gb|AES91677.1| S-acyltransferase TIP1 [Medicago truncatula] Back     alignment and taxonomy information
>gi|224120466|ref|XP_002331055.1| predicted protein [Populus trichocarpa] gi|222872985|gb|EEF10116.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|79517230|ref|NP_197535.2| S-acyltransferase TIP1 [Arabidopsis thaliana] gi|75282678|sp|Q52T38.1|ZDH22_ARATH RecName: Full=S-acyltransferase TIP1; AltName: Full=Ankyrin repeat-containing S-palmitoyltransferase; AltName: Full=Palmitoyltransferase TIP1; AltName: Full=Protein TIP GROWTH DEFECTIVE 1; AltName: Full=Zinc finger DHHC domain-containing protein TIP1 gi|62632827|gb|AAX89384.1| ankryin repeat S-palmitoyl transferase [Arabidopsis thaliana] gi|110737119|dbj|BAF00511.1| ankyrin-repeat protein [Arabidopsis thaliana] gi|332005451|gb|AED92834.1| S-acyltransferase TIP1 [Arabidopsis thaliana] gi|385137892|gb|AFI41207.1| ankyrin protein, partial [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|312282023|dbj|BAJ33877.1| unnamed protein product [Thellungiella halophila] Back     alignment and taxonomy information
>gi|357123214|ref|XP_003563307.1| PREDICTED: S-acyltransferase TIP1-like [Brachypodium distachyon] Back     alignment and taxonomy information
>gi|413954646|gb|AFW87295.1| hypothetical protein ZEAMMB73_866253 [Zea mays] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query472
TAIR|locus:2149309620 TIP1 "TIP GROWTH DEFECTIVE 1" 0.949 0.722 0.719 6e-183
TAIR|locus:1006230134536 AT2G14255 "AT2G14255" [Arabido 0.786 0.692 0.489 3.7e-96
FB|FBgn0029137585 Patsas "Patsas" [Drosophila me 0.703 0.567 0.316 6.4e-35
UNIPROTKB|J9P6L2494 ZDHHC17 "Uncharacterized prote 0.423 0.404 0.331 7.3e-28
UNIPROTKB|F1N9E7601 ZDHHC17 "Uncharacterized prote 0.423 0.332 0.336 2.2e-27
ZFIN|ZDB-GENE-070424-194620 zdhhc17 "zinc finger, DHHC-typ 0.413 0.314 0.331 2.5e-27
UNIPROTKB|F1PRB8604 ZDHHC17 "Uncharacterized prote 0.423 0.331 0.331 3e-27
UNIPROTKB|Q8IUH5632 ZDHHC17 "Palmitoyltransferase 0.423 0.316 0.331 3.9e-27
UNIPROTKB|E1BJK1634 ZDHHC17 "Uncharacterized prote 0.423 0.315 0.331 3.9e-27
UNIPROTKB|E9PTT0622 Zdhhc17 "Protein Zdhhc17" [Rat 0.423 0.321 0.331 6.6e-27
TAIR|locus:2149309 TIP1 "TIP GROWTH DEFECTIVE 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1775 (629.9 bits), Expect = 6.0e-183, P = 6.0e-183
 Identities = 331/460 (71%), Positives = 374/460 (81%)

Query:    14 HCIAYKGFADCIRLLLFLDAYRGRQDKEGCTPLHWAAIRGNLEACTVLVQAGKKEDLMVT 73
             H  AYKGFAD IRLLLFLDAYRGRQDKEGCTPLHWAAIRGNLEACTVLVQAGKKEDLM+T
Sbjct:   170 HWAAYKGFADSIRLLLFLDAYRGRQDKEGCTPLHWAAIRGNLEACTVLVQAGKKEDLMIT 229

Query:    74 DNTGLTPAQLASDKNHRQVAFFLGNARRLLDKRCDGNSPIGKISKLGLAPALWCVILLML 133
             D TGLTPAQLA++KNHRQV+FFLGNAR LL+KRCDG+SP+G++SKLGLAP LW +ILL+L
Sbjct:   230 DKTGLTPAQLAAEKNHRQVSFFLGNARSLLEKRCDGSSPLGRLSKLGLAPVLWIMILLLL 289

Query:   134 VTYMHSVIMASNLPKLTAGFGLLAWSGVFLATGGLVLFYRCSRKDPGYIRMNVHDPQNMK 193
             + Y +SV++ASNLPKLT G G LAW G  LAT GL LFYRCSRKDPGYIRMN+HDPQ MK
Sbjct:   290 LVYTNSVVLASNLPKLTTGIGALAWLGFILATAGLFLFYRCSRKDPGYIRMNIHDPQTMK 349

Query:   194 DDEPLLKIEMNNPALLAGNWSQLCATCKIVRPLRAKHCSTCDRCVEQFDHHCPWVSNCIG 253
             DDEPLLKIE+NNPALLAGNW+QLCATCKI+RPLRAKHCSTCDRCVEQFDHHCPWVSNC+G
Sbjct:   350 DDEPLLKIELNNPALLAGNWTQLCATCKIIRPLRAKHCSTCDRCVEQFDHHCPWVSNCVG 409

Query:   254 KKNKWDFFLFLVLEVSAMLVTGAVTVIRVFTDPVAPSSFGAWMSYASTHHIGALSFLIAD 313
             KKNKW+FFLFL+LEV AML+TG VT+ RV +DP APSSFGAWMS+ +++H+GALSFL+ +
Sbjct:   410 KKNKWEFFLFLLLEVLAMLITGGVTLARVLSDPSAPSSFGAWMSHVASNHVGALSFLLVE 469

Query:   314 FSLFFGVAVLTAVQASQISRNITTNEMANALRYNYLRGAGGRFRNPYDHGCKRNCSDFLI 373
             F LFF VAVLT +QASQISRNITTNEMANALRY+YLRG GGRFRNPYD GC+RNCSDFL+
Sbjct:   470 FCLFFSVAVLTVIQASQISRNITTNEMANALRYSYLRGPGGRFRNPYDLGCRRNCSDFLV 529

Query:   374 NGFNEDVECVEDSAGT--EGIGMMHMSRNSNLQNGDGHIHHANGNGHVAIXXXXXXXXXX 431
              G+NED+EC E+ A    EGI MM M RN NLQNG         NGHVAI          
Sbjct:   530 KGYNEDIECHEEDATQRPEGISMMQMQRNPNLQNG---------NGHVAIDVNPTHNSQS 580

Query:   432 XXXXXXXXXXXXXXGKSKTDSVPXXXXXXXXRSSARSVVA 471
                            KSK+D+VP        R+  R VV+
Sbjct:   581 AHVHSANCSHSHNS-KSKSDNVPLGLGLGLSRNPTRPVVS 619
GO:0008270 "zinc ion binding" evidence=IEA
GO:0000035 "acyl binding" evidence=IDA
GO:0016417 "S-acyltransferase activity" evidence=IGI
GO:0005794 "Golgi apparatus" evidence=IDA
GO:0000902 "cell morphogenesis" evidence=RCA
GO:0006623 "protein targeting to vacuole" evidence=RCA
GO:0006635 "fatty acid beta-oxidation" evidence=RCA
GO:0006944 "cellular membrane fusion" evidence=RCA
GO:0016049 "cell growth" evidence=RCA
GO:0016192 "vesicle-mediated transport" evidence=RCA
GO:0016558 "protein import into peroxisome matrix" evidence=RCA
GO:0048193 "Golgi vesicle transport" evidence=RCA
GO:0005768 "endosome" evidence=IDA
GO:0005802 "trans-Golgi network" evidence=IDA
GO:0009932 "cell tip growth" evidence=IMP
TAIR|locus:1006230134 AT2G14255 "AT2G14255" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
FB|FBgn0029137 Patsas "Patsas" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|J9P6L2 ZDHHC17 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1N9E7 ZDHHC17 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-070424-194 zdhhc17 "zinc finger, DHHC-type containing 17" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1PRB8 ZDHHC17 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q8IUH5 ZDHHC17 "Palmitoyltransferase ZDHHC17" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1BJK1 ZDHHC17 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E9PTT0 Zdhhc17 "Protein Zdhhc17" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q52T38ZDH22_ARATH2, ., 3, ., 1, ., -0.75650.94910.7225yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.3.10.691

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query472
pfam01529167 pfam01529, zf-DHHC, DHHC palmitoyltransferase 1e-31
COG5273309 COG5273, COG5273, Uncharacterized protein containi 2e-28
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 1e-12
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 6e-12
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 4e-09
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 4e-08
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 9e-08
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 8e-06
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 3e-05
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 8e-05
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 3e-04
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 4e-04
pfam0002333 pfam00023, Ank, Ankyrin repeat 5e-04
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 0.001
>gnl|CDD|216554 pfam01529, zf-DHHC, DHHC palmitoyltransferase Back     alignment and domain information 
 Score =  119 bits (299), Expect = 1e-31
 Identities = 46/176 (26%), Positives = 82/176 (46%), Gaps = 12/176 (6%)

Query: 168 LVLFYRCSRKDPGYIRMNVHDPQNMKDDEPLLKIEMNNPALLAGNWSQLCATCKIVRPLR 227
           L  +++    DPGY+      P+N  + E   + +  +      +  + C+TC I++P R
Sbjct: 1   LWSYFKTIFTDPGYV------PKNPTEKEQEKQPDEESEEGDEEDELKFCSTCNIIKPPR 54

Query: 228 AKHCSTCDRCVEQFDHHCPWVSNCIGKKN-KWDFFLFLVLEVSAMLVTGAVTVIRVFTDP 286
           + HC  C+RCV +FDHHCPW++NCIG++N K+ F LFL+     +++   ++   +    
Sbjct: 55  SHHCRVCNRCVLRFDHHCPWLNNCIGRRNHKY-FLLFLLYLTLYLILLLVLSFYYLVYLI 113

Query: 287 VAPSSFGAWMSYASTHHIGALSFLIADFSLFFGVAVLTAVQASQISRNITTNEMAN 342
                F   +         ++  L+        ++ L       I +NITT E   
Sbjct: 114 RNIELFFFLILSL----FSSIILLVLSLFFLLFLSFLLFFHLYLILKNITTYEYIK 165

This family includes the well known DHHC zinc binding domain as well as three of the four conserved transmembrane regions found in this family of palmitoyltransferase enzymes. Length = 167
>gnl|CDD|227598 COG5273, COG5273, Uncharacterized protein containing DHHC-type Zn finger [General function prediction only] Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 472
KOG0509600 consensus Ankyrin repeat and DHHC-type Zn-finger d 100.0
KOG1315307 consensus Predicted DHHC-type Zn-finger protein [G 100.0
KOG1314414 consensus DHHC-type Zn-finger protein [General fun 100.0
KOG1311299 consensus DHHC-type Zn-finger proteins [General fu 100.0
PF01529174 zf-DHHC: DHHC palmitoyltransferase; InterPro: IPR0 100.0
KOG1313309 consensus DHHC-type Zn-finger proteins [General fu 100.0
COG5273309 Uncharacterized protein containing DHHC-type Zn fi 100.0
KOG1312341 consensus DHHC-type Zn-finger proteins [General fu 99.96
KOG0509600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.91
KOG4412226 consensus 26S proteasome regulatory complex, subun 99.8
KOG4412226 consensus 26S proteasome regulatory complex, subun 99.74
PHA02791284 ankyrin-like protein; Provisional 99.59
PHA02741169 hypothetical protein; Provisional 99.56
KOG0195448 consensus Integrin-linked kinase [Signal transduct 99.55
PHA02743166 Viral ankyrin protein; Provisional 99.55
PHA02791284 ankyrin-like protein; Provisional 99.55
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.55
PHA02874434 ankyrin repeat protein; Provisional 99.52
KOG0508615 consensus Ankyrin repeat protein [General function 99.52
PHA02741169 hypothetical protein; Provisional 99.52
PHA02859209 ankyrin repeat protein; Provisional 99.52
PHA02884300 ankyrin repeat protein; Provisional 99.51
PHA02859209 ankyrin repeat protein; Provisional 99.51
PHA02878477 ankyrin repeat protein; Provisional 99.51
PHA02875413 ankyrin repeat protein; Provisional 99.5
KOG0510 929 consensus Ankyrin repeat protein [General function 99.5
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.49
PHA02736154 Viral ankyrin protein; Provisional 99.49
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.48
PHA02878477 ankyrin repeat protein; Provisional 99.46
PHA02743166 Viral ankyrin protein; Provisional 99.46
PHA02946446 ankyin-like protein; Provisional 99.43
KOG0514452 consensus Ankyrin repeat protein [General function 99.42
PHA03095471 ankyrin-like protein; Provisional 99.42
PHA02795437 ankyrin-like protein; Provisional 99.41
PHA02875413 ankyrin repeat protein; Provisional 99.41
PHA03100480 ankyrin repeat protein; Provisional 99.41
PHA02874434 ankyrin repeat protein; Provisional 99.41
KOG0508615 consensus Ankyrin repeat protein [General function 99.4
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 99.4
PLN03192823 Voltage-dependent potassium channel; Provisional 99.39
PHA02884300 ankyrin repeat protein; Provisional 99.39
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.39
PHA02716764 CPXV016; CPX019; EVM010; Provisional 99.37
PHA02736154 Viral ankyrin protein; Provisional 99.37
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.36
PHA03095471 ankyrin-like protein; Provisional 99.36
PHA02798489 ankyrin-like protein; Provisional 99.35
PHA02798489 ankyrin-like protein; Provisional 99.34
PLN03192823 Voltage-dependent potassium channel; Provisional 99.34
PHA02730 672 ankyrin-like protein; Provisional 99.34
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 99.33
PHA02946446 ankyin-like protein; Provisional 99.33
PHA02876682 ankyrin repeat protein; Provisional 99.33
PHA03100480 ankyrin repeat protein; Provisional 99.33
KOG0514452 consensus Ankyrin repeat protein [General function 99.33
KOG0510 929 consensus Ankyrin repeat protein [General function 99.32
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.31
PHA02795437 ankyrin-like protein; Provisional 99.29
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.29
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.29
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.28
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 99.26
PHA02989494 ankyrin repeat protein; Provisional 99.26
PHA02989494 ankyrin repeat protein; Provisional 99.26
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.25
PHA02876682 ankyrin repeat protein; Provisional 99.25
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.25
PHA02730672 ankyrin-like protein; Provisional 99.23
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.19
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.19
PHA02917661 ankyrin-like protein; Provisional 99.18
KOG1710396 consensus MYND Zn-finger and ankyrin repeat protei 99.15
PHA02917661 ankyrin-like protein; Provisional 99.13
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.13
KOG0505527 consensus Myosin phosphatase, regulatory subunit [ 99.12
PHA02792631 ankyrin-like protein; Provisional 99.11
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.09
KOG0195448 consensus Integrin-linked kinase [Signal transduct 99.08
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.03
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.03
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.02
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.0
PHA02792631 ankyrin-like protein; Provisional 98.97
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 98.96
KOG3676782 consensus Ca2+-permeable cation channel OSM-9 and 98.95
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 98.93
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 98.89
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 98.83
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.81
TIGR00870743 trp transient-receptor-potential calcium channel p 98.78
KOG0818669 consensus GTPase-activating proteins of the GIT fa 98.71
KOG0505527 consensus Myosin phosphatase, regulatory subunit [ 98.68
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.67
PTZ00322664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 98.67
KOG1710396 consensus MYND Zn-finger and ankyrin repeat protei 98.64
PF1360630 Ank_3: Ankyrin repeat 98.51
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 98.49
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.49
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.31
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.3
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.29
PF1360630 Ank_3: Ankyrin repeat 98.25
KOG0522560 consensus Ankyrin repeat protein [General function 98.24
KOG0521785 consensus Putative GTPase activating proteins (GAP 98.07
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 98.07
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 97.97
KOG0705749 consensus GTPase-activating protein Centaurin gamm 97.95
KOG0783 1267 consensus Uncharacterized conserved protein, conta 97.95
KOG0818669 consensus GTPase-activating proteins of the GIT fa 97.77
KOG2384223 consensus Major histocompatibility complex protein 97.71
KOG0522560 consensus Ankyrin repeat protein [General function 97.65
KOG0511516 consensus Ankyrin repeat protein [General function 97.64
KOG2384223 consensus Major histocompatibility complex protein 97.45
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 97.17
KOG0520975 consensus Uncharacterized conserved protein, conta 96.87
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 96.85
KOG0520975 consensus Uncharacterized conserved protein, conta 96.79
KOG0511516 consensus Ankyrin repeat protein [General function 96.5
KOG2505591 consensus Ankyrin repeat protein [General function 96.49
KOG0521785 consensus Putative GTPase activating proteins (GAP 96.3
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 96.27
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 95.3
KOG2505591 consensus Ankyrin repeat protein [General function 94.51
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 93.34
KOG1311299 consensus DHHC-type Zn-finger proteins [General fu 89.9
COG5273309 Uncharacterized protein containing DHHC-type Zn fi 88.69
PF01529174 zf-DHHC: DHHC palmitoyltransferase; InterPro: IPR0 88.11
KOG1315307 consensus Predicted DHHC-type Zn-finger protein [G 86.09
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 80.25
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information 
Probab=100.00  E-value=2.2e-49  Score=400.30  Aligned_cols=357  Identities=27%  Similarity=0.390  Sum_probs=221.8

Q ss_pred             hCchHHHHHHHcCCHHHHHHHHHCCCCCCCCCCCCCcHHHHHHHcCCHHHHHHHHHcCCCCccccccCCCCCHhhhhhhc
Q 012055            8 IMTEEAHCIAYKGFADCIRLLLFLDAYRGRQDKEGCTPLHWAAIRGNLEACTVLVQAGKKEDLMVTDNTGLTPAQLASDK   87 (472)
Q Consensus         8 ~G~TpLh~Aa~~g~~~~v~~Ll~~gad~n~~d~~g~TpLh~A~~~g~~~~v~~Ll~~g~~~~~~~~d~~g~TpL~~A~~~   87 (472)
                      +|.|||||||++|++.++.+|+++|||++.+|.+|.+|||.|++.|+...+.+|+..|  +|++.+|.+|+|||++|+.+
T Consensus       111 l~stPLHWAar~G~~~vv~lLlqhGAdpt~~D~~G~~~lHla~~~~~~~~vayll~~~--~d~d~~D~~grTpLmwAayk  188 (600)
T KOG0509|consen  111 LGSTPLHWAARNGHISVVDLLLQHGADPTLKDKQGLTPLHLAAQFGHTALVAYLLSKG--ADIDLRDNNGRTPLMWAAYK  188 (600)
T ss_pred             CCCCcchHHHHcCcHHHHHHHHHcCCCCceecCCCCcHHHHHHHhCchHHHHHHHHhc--ccCCCcCCCCCCHHHHHHHh
Confidence            5689999999999999999999999999999999999999999999999999999988  88888888888888888888


Q ss_pred             CchhHHHHHHhhhhhcc-cC-CCCCCCCccccc----------------------cCcchh-------------------
Q 012055           88 NHRQVAFFLGNARRLLD-KR-CDGNSPIGKISK----------------------LGLAPA-------------------  124 (472)
Q Consensus        88 ~~~~i~~~L~~~~~~~~-~~-~~~~tpl~~~~k----------------------~g~~p~-------------------  124 (472)
                      ++...+..|++-++.+. .+ .+|.||||....                      .|.+|+                   
T Consensus       189 g~~~~v~~LL~f~a~~~~~d~~~g~TpLHwa~~~gN~~~v~Ll~~g~~~~d~~~~~g~tp~~LA~~~~~~~~~~h~~~~~  268 (600)
T KOG0509|consen  189 GFALFVRRLLKFGASLLLTDDNHGNTPLHWAVVGGNLTAVKLLLEGGADLDKTNTNGKTPFDLAQERKLVAALHHDVVER  268 (600)
T ss_pred             cccHHHHHHHHhcccccccccccCCchHHHHHhcCCcceEehhhhcCCcccccccCCCCHHHHHHHhhhHHHhhccHHHh
Confidence            88775666655544433 22 456666654111                      011110                   


Q ss_pred             -----------------HHHHHHHHhh----h----eeeeEE------------------------eecc-Cchh-----
Q 012055          125 -----------------LWCVILLMLV----T----YMHSVI------------------------MASN-LPKL-----  149 (472)
Q Consensus       125 -----------------l~~iii~ll~----~----yi~~~~------------------------~~~~-l~~~-----  149 (472)
                                       .+.+ ++..+    .    ++..+.                        .... .+..     
T Consensus       269 ~~~~~~K~~~~~~~~~~~~f~-~~~~~~~~~~~~~g~i~~~~~~w~i~~~~L~~~~~~~~~~~~~~~~~~~~~~~~~~~~  347 (600)
T KOG0509|consen  269 LGKVVKKWFLGSKLAALIFFI-FLGLFYFISSWLPGVIFLINSLWLIKGLALGKLVLTCLCATRKIVGFLLRPPLLSGFF  347 (600)
T ss_pred             hcccccchhhhhHHHHHHHHH-HHHHHHHHHhhccchhhhhhhHHHHhhhhhhhhhhheeccchhhccccccchhHHHHH
Confidence                             0110 00000    0    000000                        0000 0110     


Q ss_pred             --hHHHHHHHHHH-------------HHH-HHHHHHHHhhhhccCCCccccCCCCCCCCCCChhhhhhhccCcchhcCcc
Q 012055          150 --TAGFGLLAWSG-------------VFL-ATGGLVLFYRCSRKDPGYIRMNVHDPQNMKDDEPLLKIEMNNPALLAGNW  213 (472)
Q Consensus       150 --~~~~~~~~~~~-------------~~l-~~~~l~~~~~~~~~dPG~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  213 (472)
                        +....+..|+.             .++ .+..++++++...+|||++|......  .+...++.+....       +.
T Consensus       348 ~~~~fw~~~~w~~~i~~~~~~~~~~~~i~~~l~~~~~f~~~~rsDPg~i~~~~~~~--~~tIs~l~d~gkf-------~~  418 (600)
T KOG0509|consen  348 LSTLFWFYYFWFSKITPYTLFDFHYCFIISVLAYFITFGLFLRSDPGFIPTSTEVG--RETISQLIDFGKF-------DL  418 (600)
T ss_pred             HHHHHHHHHhhheeccchhhhhhHHHHHHHHHHHHHHHHHHhccCCCCCCCchhhH--HHHHHHhhccccc-------cc
Confidence              01111112222             112 22334467778889999999864322  1111122211111       12


Q ss_pred             c-ccccccccccCCCCccCccccchhccccCcCcccCcccccCChHHHHHHHHHHHHHHHHHHHHhhhhhhcCCCCCCCc
Q 012055          214 S-QLCATCKIVRPLRAKHCSTCDRCVEQFDHHCPWVSNCIGKKNKWDFFLFLVLEVSAMLVTGAVTVIRVFTDPVAPSSF  292 (472)
Q Consensus       214 ~-~~C~~C~~~kP~Rs~HC~~C~~CV~r~DHHC~w~~nCIG~~N~r~F~~fl~~~~~~~~~~~~~~~~~~~~~~~~~~~~  292 (472)
                      . +||.+|.++||+|||||++|+|||.||||||||++||||.+|||+|+.|++.....+.++...+.+.+..........
T Consensus       419 en~FC~~clirKp~rSkhc~vcnrcVarfDHhCPwi~ncVG~kNh~~F~~Fl~~l~~~~~~~l~~~~~y~~~~~~~~~~~  498 (600)
T KOG0509|consen  419 ENRFCLTCLIRKPLRSKHCSVCNRCVARFDHHCPWIGNCVGLKNHRLFVFFLLTLLTVIVFYLYLCLYYIMNLENASTIY  498 (600)
T ss_pred             cccceeeeeeecCCccchhhhhHHHHhccccCCCccccccCccchHHHHHHHHHHHHHHHHHHHHHHHHHhhcchhHHHH
Confidence            3 699999999999999999999999999999999999999999999999998776666555555444443221110000


Q ss_pred             cc-c--cccccccccchhhhhhhhHH-HHHHHHHHHHHHHHHHhhchhhHHhHhhhhhhhhhcCCCCccCCCCHhHHHHH
Q 012055          293 GA-W--MSYASTHHIGALSFLIADFS-LFFGVAVLTAVQASQISRNITTNEMANALRYNYLRGAGGRFRNPYDHGCKRNC  368 (472)
Q Consensus       293 ~~-~--~~~~~~~~~~~~~~~~~~~~-~~~~~~~l~~~~~~~i~~n~Tt~E~~~~~r~~~~~~~~~~~~npy~~G~~~N~  368 (472)
                      .. +  ++.......+...++...-+ .........+.|-..++.++||+|.++..||+++..+....++|++.|+.+|+
T Consensus       499 ~~~l~~~~~~~~~~~~~~~~~~n~~~~~t~~~~~~~~~~~~~~c~~~tt~e~~n~~r~~~~~~~~~~~~~~~s~g~~~Nl  578 (600)
T KOG0509|consen  499 VGFLIAVQAFRIPKPVTGNLLGNEDLNPTWGSTSTKCQHYNCACLHLTTNEQINVKRYEHLGIKRGPTRSPFSPGPIRNL  578 (600)
T ss_pred             HHHHHHHHHHhCCccceeeeeeccccccccccccccccccceeeecccHHHHHHHHHhhccccccCcCCCCCCchhhhcc
Confidence            00 0  00000000000000000000 00111122233445688899999999999999998888888999999999999


Q ss_pred             HHhccCCc
Q 012055          369 SDFLINGF  376 (472)
Q Consensus       369 ~~f~~~~~  376 (472)
                      .+|+....
T Consensus       579 ~df~~~~~  586 (600)
T KOG0509|consen  579 VDFFLCSD  586 (600)
T ss_pred             hheeeccc
Confidence            99998664

>KOG1315 consensus Predicted DHHC-type Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG1314 consensus DHHC-type Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG1311 consensus DHHC-type Zn-finger proteins [General function prediction only] Back     alignment and domain information
>PF01529 zf-DHHC: DHHC palmitoyltransferase; InterPro: IPR001594 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG1313 consensus DHHC-type Zn-finger proteins [General function prediction only] Back     alignment and domain information
>COG5273 Uncharacterized protein containing DHHC-type Zn finger [General function prediction only] Back     alignment and domain information
>KOG1312 consensus DHHC-type Zn-finger proteins [General function prediction only] Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG1311 consensus DHHC-type Zn-finger proteins [General function prediction only] Back     alignment and domain information
>COG5273 Uncharacterized protein containing DHHC-type Zn finger [General function prediction only] Back     alignment and domain information
>PF01529 zf-DHHC: DHHC palmitoyltransferase; InterPro: IPR001594 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG1315 consensus Predicted DHHC-type Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query472
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 5e-08
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 1e-07
2bkk_B169 Crystal Structure Of Aminoglycoside Phosphotransfer 3e-07
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 4e-07
3nog_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 4e-07
2xeh_A157 Structural Determinants For Improved Thermal Stabil 4e-07
2xee_A157 Structural Determinants For Improved Thermal Stabil 4e-07
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 6e-07
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 6e-07
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 6e-07
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 1e-06
3noc_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 1e-06
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 1e-06
2j8s_D169 Drug Export Pathway Of Multidrug Exporter Acrb Reve 2e-06
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 3e-06
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 3e-06
2v5q_C167 Crystal Structure Of Wild-type Plk-1 Kinase Domain 4e-06
2y1l_E169 Caspase-8 In Complex With Darpin-8.4 Length = 169 5e-06
2bkg_A166 Crystal Structure Of E3_19 An Designed Ankyrin Repe 7e-06
3zuv_B136 Crystal Structure Of A Designed Selected Ankyrin Re 7e-06
3q9u_C158 In Silico And In Vitro Co-Evolution Of A High Affin 1e-05
1n11_A437 D34 Region Of Human Ankyrin-R And Linker Length = 4 3e-05
2xzt_G136 Caspase-3 In Complex With Darpin-3.4_i78s Length = 3e-05
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 3e-05
1svx_A169 Crystal Structure Of A Designed Selected Ankyrin Re 3e-05
4grg_A135 Crystal Structure Of Ige Complexed With E2_79, An A 7e-05
1bd8_A156 Structure Of Cdk Inhibitor P19ink4d Length = 156 9e-05
2xzd_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4 9e-05
1bi8_B166 Mechanism Of G1 Cyclin Dependent Kinase Inhibition 1e-04
2xen_A91 Structural Determinants For Improved Thermal Stabil 1e-04
2y0b_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4_ 2e-04
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 2e-04
1ap7_A168 P19-Ink4d From Mouse, Nmr, 20 Structures Length = 1 3e-04
1blx_B166 P19ink4dCDK6 COMPLEX Length = 166 3e-04
2zgd_A110 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 3e-04
4dui_A169 Darpin D1 Binding To Tubulin Beta Chain (not In Com 4e-04
4drx_E169 Gtp-Tubulin In Complex With A Darpin Length = 169 4e-04
2jab_A136 A Designed Ankyrin Repeat Protein Evolved To Picomo 4e-04
2zgg_A92 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 5e-04
3hg0_D136 Crystal Structure Of A Darpin In Complex With Orf49 7e-04
2v4h_C136 Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 7e-04
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure 
Iteration: 1

 Score = 55.8 bits (133), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 33/83 (39%), Positives = 44/83 (53%), Gaps = 2/83 (2%)
Query: 14  HCIAYKGFADCIRLLLFLDAYRGRQDKEGCTPLHWAAIRGNLEACTVLVQAGKKEDLMVT 73
           H  A KG  + + +LL   A     DK G TPLH AA+ G+LE   VL++ G   D+  T
Sbjct: 52  HLAAIKGHLEIVEVLLKHGADVNAADKMGDTPLHLAALYGHLEIVEVLLKNGA--DVNAT 109
Query: 74  DNTGLTPAQLASDKNHRQVAFFL 96
           D  G TP  LA+D  H ++   L
Sbjct: 110 DTYGFTPLHLAADAGHLEIVEVL 132
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 Back     alignment and structure
>pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 Back     alignment and structure
>pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 Back     alignment and structure
>pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 Back     alignment and structure
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure
>pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 Back     alignment and structure
>pdb|4GRG|A Chain A, Crystal Structure Of Ige Complexed With E2_79, An Anti-Ige Inhibitor Length = 135 Back     alignment and structure
>pdb|1BD8|A Chain A, Structure Of Cdk Inhibitor P19ink4d Length = 156 Back     alignment and structure
>pdb|2XZD|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4 Length = 136 Back     alignment and structure
>pdb|1BI8|B Chain B, Mechanism Of G1 Cyclin Dependent Kinase Inhibition From The Structures Cdk6-P19ink4d Inhibitor Complex Length = 166 Back     alignment and structure
>pdb|2XEN|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module Length = 91 Back     alignment and structure
>pdb|2Y0B|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4_s76r Length = 136 Back     alignment and structure
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure
>pdb|1AP7|A Chain A, P19-Ink4d From Mouse, Nmr, 20 Structures Length = 168 Back     alignment and structure
>pdb|1BLX|B Chain B, P19ink4dCDK6 COMPLEX Length = 166 Back     alignment and structure
>pdb|2ZGD|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 110 Back     alignment and structure
>pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 Back     alignment and structure
>pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 Back     alignment and structure
>pdb|2JAB|A Chain A, A Designed Ankyrin Repeat Protein Evolved To Picomolar Affinity To Her2 Length = 136 Back     alignment and structure
>pdb|2ZGG|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 92 Back     alignment and structure
>pdb|3HG0|D Chain D, Crystal Structure Of A Darpin In Complex With Orf49 From Lactococcal Phage Tp901-1 Length = 136 Back     alignment and structure
>pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query472
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 7e-12
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 3e-10
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 3e-09
3v31_A167 Ankyrin repeat family A protein 2; structural geno 8e-12
3v31_A167 Ankyrin repeat family A protein 2; structural geno 9e-12
3v31_A167 Ankyrin repeat family A protein 2; structural geno 2e-10
3v31_A167 Ankyrin repeat family A protein 2; structural geno 2e-07
3v31_A167 Ankyrin repeat family A protein 2; structural geno 5e-06
3v30_A172 DNA-binding protein rfxank; structural genomics co 9e-12
3v30_A172 DNA-binding protein rfxank; structural genomics co 8e-11
3v30_A172 DNA-binding protein rfxank; structural genomics co 2e-10
3v30_A172 DNA-binding protein rfxank; structural genomics co 5e-09
3v30_A172 DNA-binding protein rfxank; structural genomics co 2e-07
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-11
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 3e-10
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 6e-09
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 8e-09
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 3e-08
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 1e-07
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 2e-11
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 2e-09
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 7e-09
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 9e-08
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 1e-06
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 1e-04
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-11
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-11
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 4e-11
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-10
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-10
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-10
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-10
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-10
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 6e-08
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 8e-08
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 3e-11
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 9e-10
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 3e-09
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 4e-07
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 3e-05
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 3e-11
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 7e-10
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 2e-09
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 1e-04
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 3e-11
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 4e-09
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 8e-09
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 1e-04
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 3e-11
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 9e-10
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 8e-09
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 5e-08
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-07
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-05
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 5e-05
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 5e-11
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 1e-07
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 7e-07
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 5e-11
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 4e-08
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 5e-11
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 1e-10
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 2e-07
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 4e-06
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 6e-11
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-09
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-09
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 5e-09
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-08
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-08
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-04
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 7e-11
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 3e-10
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 5e-10
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 4e-04
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 7e-04
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 7e-11
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-10
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-09
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-09
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 8e-08
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 8e-07
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 1e-10
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 3e-10
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 4e-09
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 2e-07
1awc_B153 Protein (GA binding protein beta 1); complex (tran 1e-10
1awc_B153 Protein (GA binding protein beta 1); complex (tran 1e-09
1awc_B153 Protein (GA binding protein beta 1); complex (tran 1e-08
1awc_B153 Protein (GA binding protein beta 1); complex (tran 1e-05
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 1e-10
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 1e-09
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 8e-09
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 1e-08
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 7e-07
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 2e-05
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 1e-10
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 1e-10
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 4e-10
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 7e-10
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 1e-09
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 8e-09
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 3e-06
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 1e-10
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 4e-10
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 9e-10
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 1e-06
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 2e-04
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 2e-10
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 1e-08
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 1e-06
3deo_A183 Signal recognition particle 43 kDa protein; chloro 2e-10
3deo_A183 Signal recognition particle 43 kDa protein; chloro 7e-09
3deo_A183 Signal recognition particle 43 kDa protein; chloro 1e-07
3deo_A183 Signal recognition particle 43 kDa protein; chloro 3e-06
3deo_A183 Signal recognition particle 43 kDa protein; chloro 5e-05
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-10
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-10
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 3e-10
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 6e-09
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-08
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 3e-08
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 6e-05
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 3e-10
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 7e-10
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 7e-09
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 7e-09
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 3e-06
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 6e-05
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 3e-10
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 5e-08
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 7e-08
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 3e-10
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 3e-08
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 4e-08
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 5e-08
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 3e-07
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-05
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 4e-05
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 3e-10
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 9e-10
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 1e-09
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 3e-09
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 1e-08
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 4e-06
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 4e-10
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 3e-09
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-08
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-08
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-07
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 8e-05
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 4e-10
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 2e-08
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 3e-07
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 2e-06
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 3e-04
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 6e-10
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 6e-10
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 3e-08
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 1e-07
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 9e-07
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-06
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 7e-05
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 3e-04
2pnn_A273 Transient receptor potential cation channel subfa 7e-10
2pnn_A273 Transient receptor potential cation channel subfa 2e-06
2pnn_A273 Transient receptor potential cation channel subfa 8e-06
2pnn_A273 Transient receptor potential cation channel subfa 3e-04
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 1e-09
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 1e-09
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 1e-09
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-08
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 5e-08
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 1e-07
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 1e-09
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 7e-09
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 6e-06
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 6e-04
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 1e-09
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 4e-09
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 6e-09
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 7e-09
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 5e-08
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 5e-08
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 1e-07
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 1e-07
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 1e-06
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-09
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-09
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-09
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-09
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 5e-09
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-08
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-06
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 4e-04
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 2e-09
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 4e-09
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 5e-09
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 6e-08
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 2e-04
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 2e-09
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 1e-08
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 2e-07
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 1e-06
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-09
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-09
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 1e-07
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-07
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 1e-06
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 4e-04
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 2e-09
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 1e-08
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 4e-06
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 5e-06
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 1e-04
3hra_A201 Ankyrin repeat family protein; structural protein; 2e-09
3hra_A201 Ankyrin repeat family protein; structural protein; 4e-09
3hra_A201 Ankyrin repeat family protein; structural protein; 3e-07
3hra_A201 Ankyrin repeat family protein; structural protein; 8e-07
3hra_A201 Ankyrin repeat family protein; structural protein; 2e-06
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 4e-09
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 5e-09
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 7e-05
2rfa_A232 Transient receptor potential cation channel subfa 5e-09
2rfa_A232 Transient receptor potential cation channel subfa 4e-08
2rfa_A232 Transient receptor potential cation channel subfa 4e-06
2rfa_A232 Transient receptor potential cation channel subfa 2e-05
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 1e-08
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 1e-08
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 4e-08
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 1e-06
2etb_A256 Transient receptor potential cation channel subfam 6e-08
2etb_A256 Transient receptor potential cation channel subfam 3e-06
2etb_A256 Transient receptor potential cation channel subfam 9e-06
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 7e-08
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 8e-07
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 4e-06
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 3e-04
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 1e-07
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 1e-07
1sw6_A327 Regulatory protein SWI6; transcription regulation, 3e-07
1sw6_A327 Regulatory protein SWI6; transcription regulation, 7e-07
1sw6_A327 Regulatory protein SWI6; transcription regulation, 4e-06
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 6e-07
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 2e-06
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 3e-05
3jxi_A260 Vanilloid receptor-related osmotically activated p 7e-07
3jxi_A260 Vanilloid receptor-related osmotically activated p 5e-06
3jxi_A260 Vanilloid receptor-related osmotically activated p 4e-05
3jxi_A260 Vanilloid receptor-related osmotically activated p 1e-04
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 3e-06
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 1e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-05
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 2e-04
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
 Score = 61.3 bits (150), Expect = 7e-12
 Identities = 20/79 (25%), Positives = 31/79 (39%), Gaps = 2/79 (2%)

Query: 14  HCIAYKGFADCIRLLLFLDAYRGRQDKEGCTPLHWAAIRGNLEACTVLVQAGKKEDLMVT 73
           H  A  G  + +  LL   A     DK   TPL  A   G++    +L+  G   D  V 
Sbjct: 45  HYAADCGQLEILEFLLLKGADINAPDKHHITPLLSAVYEGHVSCVKLLLSKGA--DKTVK 102

Query: 74  DNTGLTPAQLASDKNHRQV 92
              GLT  +   ++  + +
Sbjct: 103 GPDGLTAFEATDNQAIKAL 121
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query472
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.79
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.78
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.77
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.75
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.75
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.74
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.73
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.72
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.71
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.71
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.71
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.7
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.7
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.69
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.69
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.68
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.68
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.68
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.68
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.68
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.67
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.67
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 99.67
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.67
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.67
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 99.67
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.67
2etb_A256 Transient receptor potential cation channel subfam 99.67
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.66
2pnn_A273 Transient receptor potential cation channel subfa 99.66
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.66
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 99.66
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.65
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.65
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.65
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.65
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.65
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.65
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.65
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.65
2rfa_A232 Transient receptor potential cation channel subfa 99.64
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 99.64
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.64
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 99.64
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.64
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 99.64
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 99.63
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 99.62
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 99.62
2rfa_A232 Transient receptor potential cation channel subfa 99.62
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.62
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.62
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 99.61
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 99.61
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.61
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.61
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.61
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 99.61
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.61
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.61
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 99.6
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 99.6
3hra_A201 Ankyrin repeat family protein; structural protein; 99.6
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.6
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.6
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.6
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.6
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 99.6
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 99.59
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.59
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 99.59
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 99.59
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 99.58
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 99.58
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 99.58
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.58
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.58
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 99.58
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 99.57
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 99.57
2etb_A256 Transient receptor potential cation channel subfam 99.57
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 99.57
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.57
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 99.56
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 99.56
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.56
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 99.56
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.55
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 99.55
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.55
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.54
3hra_A201 Ankyrin repeat family protein; structural protein; 99.54
2pnn_A273 Transient receptor potential cation channel subfa 99.54
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 99.54
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 99.53
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.53
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.52
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.51
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 99.51
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.49
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 99.49
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.48
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.48
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 99.48
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 99.47
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 99.45
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 99.45
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 99.42
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.32
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.29
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.26
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.25
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.25
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.09
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
Probab=99.79  E-value=3.7e-19  Score=142.53  Aligned_cols=91  Identities=36%  Similarity=0.480  Sum_probs=87.4

Q ss_pred             CchHHHHHHHcCCHHHHHHHHHCCCCCCCCCCCCCcHHHHHHHcCCHHHHHHHHHcCCCCccccccCCCCCHhhhhhhcC
Q 012055            9 MTEEAHCIAYKGFADCIRLLLFLDAYRGRQDKEGCTPLHWAAIRGNLEACTVLVQAGKKEDLMVTDNTGLTPAQLASDKN   88 (472)
Q Consensus         9 G~TpLh~Aa~~g~~~~v~~Ll~~gad~n~~d~~g~TpLh~A~~~g~~~~v~~Ll~~g~~~~~~~~d~~g~TpL~~A~~~~   88 (472)
                      |+||||+|+..|+.+++++|++.|++++.+|..|+||||+|+..|+.+++++|+++|  ++++.+|..|.||||+|+..+
T Consensus         2 g~t~L~~A~~~~~~~~v~~Ll~~g~~~n~~d~~g~t~L~~A~~~~~~~~v~~Ll~~g--a~~~~~d~~g~t~l~~A~~~~   79 (93)
T 1n0q_A            2 GRTPLHLAARNGHLEVVKLLLEAGADVNAKDKNGRTPLHLAARNGHLEVVKLLLEAG--ADVNAKDKNGRTPLHLAARNG   79 (93)
T ss_dssp             -CCHHHHHHHHTCHHHHHHHHHTTCCTTCCCTTSCCHHHHHHHTTCHHHHHHHHHTT--CCTTCCCTTSCCHHHHHHHTT
T ss_pred             CCcHHHHHHHcCCHHHHHHHHHcCCCCcccCCCCCCHHHHHHHcCCHHHHHHHHHcC--CCCCccCCCCCCHHHHHHHcC
Confidence            789999999999999999999999999999999999999999999999999999999  899999999999999999999


Q ss_pred             chhHHHHHHhhhh
Q 012055           89 HRQVAFFLGNARR  101 (472)
Q Consensus        89 ~~~i~~~L~~~~~  101 (472)
                      +.+++++|.+.++
T Consensus        80 ~~~~~~~Ll~~ga   92 (93)
T 1n0q_A           80 HLEVVKLLLEAGA   92 (93)
T ss_dssp             CHHHHHHHHHTTC
T ss_pred             CHHHHHHHHHcCC
Confidence            9999999988764
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 472
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-10
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 5e-10
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-06
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 6e-06
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-05
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 6e-05
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 6e-04
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 9e-04
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 0.002
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 1e-08
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 3e-05
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 4e-04
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 4e-08
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 7e-04
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 0.004
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 6e-08
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 6e-05
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 0.002
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 3e-07
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 6e-07
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 0.004
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 3e-07
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 8e-05
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 4e-04
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 4e-04
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 3e-06
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 4e-05
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 4e-05
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 4e-05
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 7e-05
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 8e-04
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 1e-04
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 0.002
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 7e-04
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 0.002
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 0.001
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 0.002
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 60.8 bits (146), Expect = 1e-10
 Identities = 20/83 (24%), Positives = 31/83 (37%), Gaps = 2/83 (2%)

Query: 14 HCIAYKGFADCIRLLLFLDAYRGRQDKEGCTPLHWAAIRGNLEACTVLVQAGKKEDLMVT 73
          H  ++ G    ++ LL   A     + +  TPLH AA  G+ E    L+Q      +   
Sbjct: 5  HVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKA--KVNAK 62

Query: 74 DNTGLTPAQLASDKNHRQVAFFL 96
               TP   A+   H  +   L
Sbjct: 63 AKDDQTPLHCAARIGHTNMVKLL 85
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query472
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.79
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.72
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.71
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.66
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.61
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.6
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.6
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.59
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.58
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.57
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.55
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.54
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.53
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.53
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.53
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.52
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.51
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.49
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.49
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.49
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.46
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.46
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.45
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.45
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.44
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.43
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.43
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.42
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.41
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.41
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.39
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.38
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.37
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.37
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.34
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.32
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.05
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 98.84
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Myotrophin
species: Rat (Rattus norvegicus) [TaxId: 10116]

Probab=99.79  E-value=7e-20  Score=152.12  Aligned_cols=107  Identities=23%  Similarity=0.208  Sum_probs=100.7

Q ss_pred             CchHHHHHHHcCCHHHHHHHHHCCCCCCCCCCCCCcHHHHHHHcCCHHHHHHHHHcCCCCccccccCCCCCHhhhhhhcC
Q 012055            9 MTEEAHCIAYKGFADCIRLLLFLDAYRGRQDKEGCTPLHWAAIRGNLEACTVLVQAGKKEDLMVTDNTGLTPAQLASDKN   88 (472)
Q Consensus         9 G~TpLh~Aa~~g~~~~v~~Ll~~gad~n~~d~~g~TpLh~A~~~g~~~~v~~Ll~~g~~~~~~~~d~~g~TpL~~A~~~~   88 (472)
                      -.|||+||+..|+.+++++|++.|+|++.+|..|+||||+|+..|+.+++++|+++|  ++++.+|..|.||||+|+..+
T Consensus         2 c~tpL~~A~~~g~~~~v~~Ll~~g~d~n~~~~~g~t~lh~A~~~~~~~~~~~ll~~g--~din~~d~~g~tpLh~A~~~~   79 (118)
T d1myoa_           2 CDKEFMWALKNGDLDEVKDYVAKGEDVNRTLEGGRKPLHYAADCGQLEILEFLLLKG--ADINAPDKHHITPLLSAVYEG   79 (118)
T ss_dssp             CHHHHHHHHHTTCHHHHHHHHTTTCCCCCCSSSSCCTTHHHHHHSTTTHHHHHHHSS--CTTTCCSSSCSCHHHHHHTTT
T ss_pred             CChHHHHHHHCCCHHHHHHHHHhhhcccccccccccccccccccccccccccccccc--ceeeecccccccchhhhhhcC
Confidence            379999999999999999999999999999999999999999999999999999999  899999999999999999999


Q ss_pred             chhHHHHHHhhhhhcc-cCCCCCCCCcccc
Q 012055           89 HRQVAFFLGNARRLLD-KRCDGNSPIGKIS  117 (472)
Q Consensus        89 ~~~i~~~L~~~~~~~~-~~~~~~tpl~~~~  117 (472)
                      +.+++++|.+.++.++ ++.+|.||++...
T Consensus        80 ~~~~v~~Ll~~Gad~~~~d~~G~t~l~~a~  109 (118)
T d1myoa_          80 HVSCVKLLLSKGADKTVKGPDGLTALEATD  109 (118)
T ss_dssp             CCHHHHHHHTTCCCSSSSSSSTCCCCCTCS
T ss_pred             chhhhhhhhcccccceeeCCCCCCHHHHHh
Confidence            9999999999887766 6788999998654
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure