Citrus Sinensis ID: 012184


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------47
MLLRCSIRNYTLLEGVVMVFDLRSLAWSNLRLETELDADKTEDSGLLEVLPPMSDHCMVKWGTKLLILGGHYKKSSDSMIVRFIDLETNLCGVMETSGKVPVARGGHSVTLVGSRLIIFGGEDRSRKLLNDVHFLDLETMTWDAVEVTQTPPAPRYDHSAALHANRYLIVFGGCSHSIFFNDLHVLDLQTNEWSQPEIKGDLVTGRAGHAGITIDENWYIVGGGDNNNGCQETIVLNMTKLAWSILTSVKGRNPLASEGLSVCSAIIEGEHHLVAFGGYNGKYNNEVFVMRLKPRDIPRPKIFQSPAAAAAAASVTAAYALAKSEKLDIPKTLSSKFAGIGNDLSEKDVRTDIDAIKEDKRVLELSLTEVRTENSRFREKIDEVNSTHSELSKELSSVQGQLVAERSRCFKLEAQIAELQKMLESSQTIENEVQILRQQKSAFEQEMERATSVQTQGSGGVWRWIAGGQ
ccEEEEEccccEEcccEEEEEccccEEEEEEccccccccccccccccccccccccEEEEEEccEEEEEccccccccccEEEEEEEcccccEEEEcccccccccccccEEEEEccEEEEEccccccccccccEEEEEccccEEEEEEEcccccccccccEEEEEcccEEEEEcccccccccccEEEEEcccccEEEEEcccccccccccccEEEEccEEEEEEccccccccccEEEEEcccccEEEEcccccccccccccccEEEEEEEcccEEEEEccccccccccEEEEEccccccccccccccccccccccEEEcccccccccEEEcccccccccccccccccccccccccccccccHHHHHHcHHHHcccccHHHHHHHHHHccccccHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEEccc
cccEccccccEEEcccEEEEEccccEEEEcccccccccccccccccccccccccccEEEEEccEEEEEEccccccccccEEEEEcccccEEEEcccccccccccccEEEEEEccEEEEEEccccccccccEEEEEcccccEEEEccccccccccccccEEEEEcccEEEEEEccccccccccEEEEcccccEEEEccccccccccccccEEEEEccEEEEEEccccccccccEEEEcccccEEEEEccccccccccccccccEEEEEEEccEEEEEEcccccccccEEEEcccccccccccccccccccccEEEEccEEEEEcccccccccccccccccccccccccccccHHHHHcccccHccccHHHHcccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHEEEccc
mllrcsirnyTLLEGVVMVFDLRSLAWSNLRLEteldadktedsgllevlppmsdhcmvkWGTKLLILgghykkssdSMIVRFIDLETNlcgvmetsgkvpvargghsvTLVGSRLIifggedrsrkllndvhfldletmtwdavevtqtppaprydhsaalHANRYLIVFGgcshsiffndlhvldlqtnewsqpeikgdlvtgraghagitidenwyivgggdnnngcQETIVLNMTKLAWSILTSvkgrnplaseglSVCSAIIEGEHHLVAfggyngkynnEVFVMrlkprdiprpkifqspAAAAAAASVTAAYALAKsekldipktlsskfagigndlsekdvrTDIDAIKEDKRVLELSLTEVRTENSRFREKIDEVNSTHSELSKELSSVQGQLVAERSRCFKLEAQIAELQKMLESSQTIENEVQILRQQKSAFEQEMERATSVQTQGSGGVWRWIAGGQ
mllrcsirnytLLEGVVMVFDLRSLAWSNLRLEteldadktedSGLLEVLPPMSDHCMVKWGTKLLILGGHYKKSSDSMIVRFIDLETNLCGVMETSGkvpvargghsvtlVGSRLIIFGGEDRSRKLLNDVHFLDLETMTWDAVEVTQTPPAPRYDHSAALHANRYLIVFGGCSHSIFFNDLHVLDLQTNEWSQPEIKGDLVTGRAGHAGITIDENWYIVGGGDNNNGCQETIVLNMTKLAWSILTSVKGRNPLASEGLSVCSAIIEGEHHLVAFGGYNGKYNNEVFVMRLKPRDIPRPKIFQSPAAAAAAASVTAAYALAKsekldipktlsskfagigndlsekdvrtdidaikedkrvlelsltevrtensrfrekideVNSTHSELSKELSSVQGQLVAERSRCFKLEAQIAELQKMLESSQTIENEVQILRQQKSAFEQEMERAtsvqtqgsggvWRWIAGGQ
MLLRCSIRNYTLLEGVVMVFDLRSLAWSNLRLETELDADKTEDSGLLEVLPPMSDHCMVKWGTKLLILGGHYKKSSDSMIVRFIDLETNLCGVMETSGKVPVARGGHSVTLVGSRLIIFGGEDRSRKLLNDVHFLDLETMTWDAVEVTQTPPAPRYDHSAALHANRYLIVFGGCSHSIFFNDLHVLDLQTNEWSQPEIKGDLVTGRAGHAGITIDENWYIVGGGDNNNGCQETIVLNMTKLAWSILTSVKGRNPLASEGLSVCSAIIEGEHHLVAFGGYNGKYNNEVFVMRLKPRDIPRPKIFQSPaaaaaaasvtaayalaKSEKLDIPKTLSSKFAGIGNDLSEKDVRTDIDAIKEDKRVLELSLTEVRTENSRFREKIDEVNSTHSELSKELSSVQGQLVAERSRCFKLEAQIAELQKMLESSQTIENEVQILRQQKSAFEQEMERATSVQTQGSGGVWRWIAGGQ
**LRCSIRNYTLLEGVVMVFDLRSLAWSNLRLETELDAD***DSGLLEVLPPMSDHCMVKWGTKLLILGGHYKKSSDSMIVRFIDLETNLCGVMETSGKVPVARGGHSVTLVGSRLIIFGGEDRSRKLLNDVHFLDLETMTWDAVEVTQTPPAPRYDHSAALHANRYLIVFGGCSHSIFFNDLHVLDLQTNEWSQPEIKGDLVTGRAGHAGITIDENWYIVGGGDNNNGCQETIVLNMTKLAWSILTSVKGRNPLASEGLSVCSAIIEGEHHLVAFGGYNGKYNNEVFVMRLKPRDIPRPKIFQSPAAAAAAASVTAAYALAKS**LDI*******FAGI*******************************************************************RCFKLEAQI*******************************************GVWRWI****
MLLRCSIRNYTLLEGVVMVFDLRSLAWSNLRLETEL********GLLEVLPPMSDHCMVKWGTKLLILGGHYKKSSDSMIVRFIDLETNLCGVMETSGKVPVARGGHSVTLVGSRLIIFGGEDRSRKLLNDVHFLDLETMTWDAVEVTQTPPAPRYDHSAALHANRYLIVFGGCSHSIFFNDLHVLDLQTNEWSQPEIKGDLVTGRAGHAGITIDENWYIVGGGDNNNGCQETIVLNMTKLAWSILTSVKGRNPLASEGLSVCSAIIEGEHHLVAFGGYNGKYNNEVFVMRLKPRDIPR*******************YALAKSEKLDIPKTLSSKFAGIGNDLSEKDVRTDIDAI**********************************************************************************************************RWIAGG*
MLLRCSIRNYTLLEGVVMVFDLRSLAWSNLRLETELDADKTEDSGLLEVLPPMSDHCMVKWGTKLLILGGHYKKSSDSMIVRFIDLETNLCGVMETSGKVPVARGGHSVTLVGSRLIIFGGEDRSRKLLNDVHFLDLETMTWDAVEVTQTPPAPRYDHSAALHANRYLIVFGGCSHSIFFNDLHVLDLQTNEWSQPEIKGDLVTGRAGHAGITIDENWYIVGGGDNNNGCQETIVLNMTKLAWSILTSVKGRNPLASEGLSVCSAIIEGEHHLVAFGGYNGKYNNEVFVMRLKPRDIPRPKIFQ************AAYALAKSEKLDIPKTLSSKFAGIGNDLSEKDVRTDIDAIKEDKRVLELSLTEVRTENSRFREKIDE*******************VAERSRCFKLEAQIAELQKMLESSQTIENEVQILRQQKS****************SGGVWRWIAGGQ
*LLRCSIRNYTLLEGVVMVFDLRSLAWSNLRLETEL*******SGLLEVLPPMSDHCMVKWGTKLLILGGHYKKSSDSMIVRFIDLETNLCGVMETSGKVPVARGGHSVTLVGSRLIIFGGEDRSRKLLNDVHFLDLETMTWDAVEVTQTPPAPRYDHSAALHANRYLIVFGGCSHSIFFNDLHVLDLQTNEWSQPEIKGDLVTGRAGHAGITIDENWYIVGGGDNNNGCQETIVLNMTKLAWSILTSVKGRNPLASEGLSVCSAIIEGEHHLVAFGGYNGKYNNEVFVMRLKPRDIPRPKIFQSPAAAAAAASVTAAYALAKSEKLDI**TLSSKFAGIGNDLSEKDVRTDIDAIKEDKRVLELSLTEVRTENSRFREKIDEVNSTHSELSKELSSVQGQLVAERSRCFKLEAQIAELQKMLESSQTIENEVQILRQQKSAFEQEMERATS******GGV********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLLRCSIRNYTLLEGVVMVFDLRSLAWSNLRLETELDADKTEDSGLLEVLPPMSDHCMVKWGTKLLILGGHYKKSSDSMIVRFIDLETNLCGVMETSGKVPVARGGHSVTLVGSRLIIFGGEDRSRKLLNDVHFLDLETMTWDAVEVTQTPPAPRYDHSAALHANRYLIVFGGCSHSIFFNDLHVLDLQTNEWSQPEIKGDLVTGRAGHAGITIDENWYIVGGGDNNNGCQETIVLNMTKLAWSILTSVKGRNPLASEGLSVCSAIIEGEHHLVAFGGYNGKYNNEVFVMRLKPRDIPRPKIFQSPAAAAAAASVTAAYALAKSEKLDIPKTLSSKFAGIGNDLSEKDVRTDIDAIKEDKRVLELSLTEVRTExxxxxxxxxxxxxxxxxxxxxLSSVQGQLVAERSRCFKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxQTQGSGGVWRWIAGGQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query469 2.2.26 [Sep-21-2011]
Q9MA55668 Acyl-CoA-binding domain-c no no 0.950 0.667 0.457 1e-113
Q8RWD9648 Acyl-CoA-binding domain-c no no 0.923 0.668 0.445 1e-106
Q7M3S9 943 RING finger protein B OS= no no 0.366 0.182 0.383 1e-22
P87061 1147 Tip elongation aberrant p yes no 0.520 0.212 0.268 7e-20
A8JAM0 1159 Coiled-coil domain-contai N/A no 0.409 0.165 0.304 1e-17
P80197737 Actin-fragmin kinase OS=P N/A no 0.345 0.219 0.313 8e-17
Q5EA50372 Rab9 effector protein wit yes no 0.383 0.483 0.270 2e-16
Q5ZJ37371 Rab9 effector protein wit yes no 0.430 0.544 0.267 1e-15
Q80YG3406 Kelch domain-containing p yes no 0.473 0.546 0.280 2e-15
O14248 1125 Tip elongation aberrant p no no 0.345 0.144 0.283 5e-15
>sp|Q9MA55|ACBP4_ARATH Acyl-CoA-binding domain-containing protein 4 OS=Arabidopsis thaliana GN=ACBP4 PE=1 SV=1 Back     alignment and function desciption
 Score =  408 bits (1049), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 209/457 (45%), Positives = 306/457 (66%), Gaps = 11/457 (2%)

Query: 15  GVVMVFDLRSLAWSNLRLETELDADKTEDSGLLEVLPPMSDHCMVKWGTKLLILGGHYKK 74
           G + V DL+S  WS  R+ET++ A +++++    +L P + H ++ W  KLL +GGH K 
Sbjct: 209 GDLHVLDLKSWTWS--RVETKV-ATESQETSTPTLLAPCAGHSLIAWDNKLLSIGGHTKD 265

Query: 75  SSDSMIVRFIDLETNLCGVMETSGKVPVARGGHSVTLVGSRLIIFGGEDRSRKLLNDVHF 134
            S+SM V+  D  T    +++T GK PV+RGG SVT+VG  L+IFGG+D  R LLND+H 
Sbjct: 266 PSESMQVKVFDPHTITWSMLKTYGKPPVSRGGQSVTMVGKTLVIFGGQDAKRSLLNDLHI 325

Query: 135 LDLETMTWDAVEVTQTPPAPRYDHSAALHANRYLIVFGGCSHSIFFNDLHVLDLQTNEWS 194
           LDL+TMTWD ++     P+PR DH+AA+HA R+L++FGG SH+  F+DLHVLDLQT EWS
Sbjct: 326 LDLDTMTWDEIDAVGVSPSPRSDHAAAVHAERFLLIFGGGSHATCFDDLHVLDLQTMEWS 385

Query: 195 QPEIKGDLVTGRAGHAGITIDENWYIVGGGDNNNGCQETIVLNMTKLAWSILTSVKGRNP 254
           +P  +GD  T RAGHAG+TI ENW+IVGGGDN +G  E++VLNM+ LAWS++ SV+GR P
Sbjct: 386 RPAQQGDAPTPRAGHAGVTIGENWFIVGGGDNKSGASESVVLNMSTLAWSVVASVQGRVP 445

Query: 255 LASEGLSVCSAIIEGEHHLVAFGGYNGKYNNEVFVMRLKPRDIPRPKIFQSPAAAAAAAS 314
           LASEGLS+  +   GE  LVAFGGYNG+YNNE+ +++   +   + K  ++P   + +A 
Sbjct: 446 LASEGLSLVVSSYNGEDVLVAFGGYNGRYNNEINLLKPSHKSTLQTKTLEAPLPGSLSAV 505

Query: 315 VTAAYALAKSEKLDIPKTLSSKFAGIGN----DLSEKDVRTDIDAIKEDKRVLELSLTEV 370
             A     +SE +++ +    +   + N       E +    I  IK +K  LE SL + 
Sbjct: 506 NNATTRDIESE-VEVSQEGRVREIVMDNVNPGSKVEGNSERIIATIKSEKEELEASLNKE 564

Query: 371 RTENSRFREKIDEVNSTHSELSKELSSVQGQLVAERSRCFKLEAQIAELQKMLESSQTIE 430
           R +  + R+++ E    +++L KEL SV+GQL AE+SRCFKLE  +AEL++ L++ +T++
Sbjct: 565 RMQTLQLRQELGEAELRNTDLYKELQSVRGQLAAEQSRCFKLEVDVAELRQKLQTLETLQ 624

Query: 431 NEVQILRQQKSAFEQEMERATSVQTQGSGGVWRWIAG 467
            E+++L++QK+A EQ    A + + QGSGGVW W+AG
Sbjct: 625 KELELLQRQKAASEQA---AMNAKRQGSGGVWGWLAG 658




Binds medium- and long-chain acyl-CoA esters with very high affinity. Can interact in vitro with oleoyl-CoA, barely with palmitoyl-CoA, but not with arachidonyl-CoA. May function as an intracellular carrier of acyl-CoA esters. Plays a role in the biosynthesis of membrane lipids including galactolipids and phospholipids.
Arabidopsis thaliana (taxid: 3702)
>sp|Q8RWD9|ACBP5_ARATH Acyl-CoA-binding domain-containing protein 5 OS=Arabidopsis thaliana GN=ACBP5 PE=1 SV=1 Back     alignment and function description
>sp|Q7M3S9|RNGB_DICDI RING finger protein B OS=Dictyostelium discoideum GN=rngB PE=2 SV=2 Back     alignment and function description
>sp|P87061|TEA1_SCHPO Tip elongation aberrant protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tea1 PE=1 SV=1 Back     alignment and function description
>sp|A8JAM0|CC135_CHLRE Coiled-coil domain-containing protein lobo homolog (Fragment) OS=Chlamydomonas reinhardtii GN=FAP50 PE=2 SV=1 Back     alignment and function description
>sp|P80197|AFK_PHYPO Actin-fragmin kinase OS=Physarum polycephalum PE=1 SV=2 Back     alignment and function description
>sp|Q5EA50|RABEK_BOVIN Rab9 effector protein with kelch motifs OS=Bos taurus GN=RABEPK PE=2 SV=1 Back     alignment and function description
>sp|Q5ZJ37|RABEK_CHICK Rab9 effector protein with kelch motifs OS=Gallus gallus GN=RABEPK PE=2 SV=1 Back     alignment and function description
>sp|Q80YG3|KLDC1_MOUSE Kelch domain-containing protein 1 OS=Mus musculus GN=Klhdc1 PE=2 SV=1 Back     alignment and function description
>sp|O14248|TEA3_SCHPO Tip elongation aberrant protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tea3 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query469
224113141512 predicted protein [Populus trichocarpa] 0.957 0.876 0.756 0.0
225448900508 PREDICTED: acyl-CoA-binding domain-conta 0.959 0.885 0.722 0.0
255583742512 acyl-CoA binding protein, putative [Rici 0.842 0.771 0.770 1e-171
449465316509 PREDICTED: acyl-CoA-binding domain-conta 0.953 0.878 0.665 1e-170
15237715514 kelch repeat-containing protein [Arabido 0.946 0.863 0.664 1e-169
15724206514 AT5g04420/T32M21_20 [Arabidopsis thalian 0.946 0.863 0.662 1e-168
297810527514 kelch repeat-containing protein [Arabido 0.946 0.863 0.664 1e-166
356576361504 PREDICTED: acyl-CoA-binding domain-conta 0.953 0.886 0.632 1e-164
115449833519 Os02g0822800 [Oryza sativa Japonica Grou 0.955 0.863 0.520 1e-126
357137701523 PREDICTED: acyl-CoA-binding domain-conta 0.950 0.852 0.512 1e-121
>gi|224113141|ref|XP_002316404.1| predicted protein [Populus trichocarpa] gi|222865444|gb|EEF02575.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  663 bits (1710), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/451 (75%), Positives = 387/451 (85%), Gaps = 2/451 (0%)

Query: 17  VMVFDLRSLAWSNLRLETELDADKTEDSGLLEVLPPMSDHCMVKWGTKLLILGGHYKKSS 76
           V VFD R L WS+L+L++E D  K+E++G  EVLP  SDH MVKWG KLL+LGGH K +S
Sbjct: 64  VQVFDFRGLVWSSLKLKSEADGGKSEENGAQEVLPATSDHSMVKWGNKLLLLGGHSKTTS 123

Query: 77  DSMIVRFIDLETNLCGVMETSGKVPVARGGHSVTLVGSRLIIFGGEDRSRKLLNDVHFLD 136
           DSM VRFIDLET+ CG +ETSG  PVARGGHSVTLVGSRLIIFGGEDR+R+LLNDV+ LD
Sbjct: 124 DSMTVRFIDLETHACGFIETSGNAPVARGGHSVTLVGSRLIIFGGEDRNRRLLNDVYALD 183

Query: 137 LETMTWDAVEVTQTPPAPRYDHSAALHANRYLIVFGGCSHSIFFNDLHVLDLQTNEWSQP 196
           LETMTWD V   QTPPAPR+DH+AA++   YL++FGGCSHSIFFNDLHVLDLQT EWSQP
Sbjct: 184 LETMTWDVVVARQTPPAPRFDHTAAINREHYLLIFGGCSHSIFFNDLHVLDLQTMEWSQP 243

Query: 197 EIKGDLVTGRAGHAGITIDENWYIVGGGDNNNGCQETIVLNMTKLAWSILTSVKGRNPLA 256
           E++GDLVT RAGHAG+TI ENWYIVGGGDN NGC ET+VLNM+KL WS LTSVK R+PLA
Sbjct: 244 EVQGDLVTPRAGHAGVTIGENWYIVGGGDNKNGCPETLVLNMSKLTWSALTSVKERDPLA 303

Query: 257 SEGLSVCSAIIEGEHHLVAFGGYNGKYNNEVFVMRLKPRDIPRPKIFQSPAAAAAAASVT 316
           SEGLSVCSA+I GE HLVAFGGYNGKYNNEVFVMRLKP D+ RPKIFQSPAAAAAAASVT
Sbjct: 304 SEGLSVCSALINGERHLVAFGGYNGKYNNEVFVMRLKPSDVSRPKIFQSPAAAAAAASVT 363

Query: 317 AAYALAKSEKLDIPKTLSSKFAGIGNDLSEKDVRTDIDAIKEDKRVLELSLTEVRTENSR 376
           AAYALAKSEKLD   +L+    G+GN+ SE D+  +IDA+KE+K+ LEL LTEVR ENSR
Sbjct: 364 AAYALAKSEKLDF-SSLNLNSNGVGNNPSELDLAFEIDALKEEKKELELFLTEVRAENSR 422

Query: 377 FREKIDEVNSTHSELSKELSSVQGQLVAERSRCFKLEAQIAELQKMLESSQTIENEVQIL 436
             EK+DEVN TH+ELSKEL SVQGQL AERSRCFKLEAQIAELQK+LES Q+IENEVQ+L
Sbjct: 423 LTEKVDEVNGTHAELSKELHSVQGQLAAERSRCFKLEAQIAELQKILESLQSIENEVQLL 482

Query: 437 RQQKSAFEQEMERATSVQTQGSGGVWRWIAG 467
           R+QKSA EQE+ER ++ Q QGSGGVWRWIAG
Sbjct: 483 RRQKSALEQEIER-SAAQRQGSGGVWRWIAG 512




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225448900|ref|XP_002264719.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Vitis vinifera] gi|296085942|emb|CBI31383.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255583742|ref|XP_002532624.1| acyl-CoA binding protein, putative [Ricinus communis] gi|223527644|gb|EEF29755.1| acyl-CoA binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449465316|ref|XP_004150374.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like [Cucumis sativus] gi|449523517|ref|XP_004168770.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|15237715|ref|NP_196062.1| kelch repeat-containing protein [Arabidopsis thaliana] gi|79326940|ref|NP_001031832.1| kelch repeat-containing protein [Arabidopsis thaliana] gi|79326969|ref|NP_001031833.1| kelch repeat-containing protein [Arabidopsis thaliana] gi|7406446|emb|CAB85548.1| putative protein [Arabidopsis thaliana] gi|53850551|gb|AAU95452.1| At5g04420 [Arabidopsis thaliana] gi|63003778|gb|AAY25418.1| At5g04420 [Arabidopsis thaliana] gi|222424058|dbj|BAH19990.1| AT5G04420 [Arabidopsis thaliana] gi|332003357|gb|AED90740.1| kelch repeat-containing protein [Arabidopsis thaliana] gi|332003358|gb|AED90741.1| kelch repeat-containing protein [Arabidopsis thaliana] gi|332003359|gb|AED90742.1| kelch repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|15724206|gb|AAL06496.1|AF412043_1 AT5g04420/T32M21_20 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297810527|ref|XP_002873147.1| kelch repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297318984|gb|EFH49406.1| kelch repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|356576361|ref|XP_003556301.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like [Glycine max] Back     alignment and taxonomy information
>gi|115449833|ref|NP_001048563.1| Os02g0822800 [Oryza sativa Japonica Group] gi|48716304|dbj|BAD22917.1| acyl-CoA binding protein-like [Oryza sativa Japonica Group] gi|55773890|dbj|BAD72475.1| acyl-CoA binding protein-like [Oryza sativa Japonica Group] gi|113538094|dbj|BAF10477.1| Os02g0822800 [Oryza sativa Japonica Group] gi|222623936|gb|EEE58068.1| hypothetical protein OsJ_08927 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|357137701|ref|XP_003570438.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like [Brachypodium distachyon] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query469
TAIR|locus:2184352514 AT5G04420 [Arabidopsis thalian 0.946 0.863 0.64 3e-156
TAIR|locus:2143676648 ACBP5 "acyl-CoA binding protei 0.914 0.662 0.432 1.6e-93
TAIR|locus:2183008 708 AT5G18590 [Arabidopsis thalian 0.571 0.378 0.363 6.8e-50
DICTYBASE|DDB_G0280765 777 DDB_G0280765 "Kelch repeat-con 0.417 0.252 0.323 3.9e-23
DICTYBASE|DDB_G0268860 943 rngB "Kelch repeat-containing 0.366 0.182 0.383 5.6e-22
POMBASE|SPCC1223.06 1147 tea1 "cell end marker Tea1" [S 0.520 0.212 0.276 1.3e-19
DICTYBASE|DDB_G0270750485 DDB_G0270750 "Kelch repeat-con 0.373 0.360 0.316 2.6e-18
DICTYBASE|DDB_G0272080 1523 gacHH "RhoGAP domain-containin 0.285 0.087 0.304 6.8e-11
UNIPROTKB|F1SKQ3370 RABEPK "Uncharacterized protei 0.379 0.481 0.284 1e-16
DICTYBASE|DDB_G0268110 514 DDB_G0268110 "SAM domain-conta 0.302 0.276 0.349 2.7e-16
TAIR|locus:2184352 AT5G04420 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1523 (541.2 bits), Expect = 3.0e-156, P = 3.0e-156
 Identities = 288/450 (64%), Positives = 354/450 (78%)

Query:    17 VMVFDLRSLAWSNLRLETELD-ADKT-EDSG--LLEVLPPMSDHCMVKWGTKLLILGGHY 72
             V VFDLRSL WS+L+L+TE   AD   ED G  L E  P +SDH M+KWG KLL++GGH 
Sbjct:    62 VQVFDLRSLTWSSLKLKTESSSADNIQEDDGSSLREAFPAISDHRMIKWGNKLLLIGGHS 121

Query:    73 KKSSDSMIVRFIDLETNLCGVMETSGKVPVARGGHSVTLVGSRLIIFGGEDRSRKLLNDV 132
             KKSSD+M+VRFIDLET+ CGV++  G VP +RGGHS+TLVGSR+++FGGED++R+LLND+
Sbjct:   122 KKSSDNMLVRFIDLETHSCGVIDVFGNVPASRGGHSITLVGSRVLVFGGEDKNRRLLNDL 181

Query:   133 HFLDLETMTWDAVEVTQTPPAPRYDHSAALHANRYLIVFGGCSHSIFFNDLHVLDLQTNE 192
             H L LETMTWD VE  QT P PR+DH+AA H++RYL++FGGCSHSIF++DLH+LDLQT E
Sbjct:   182 HVLHLETMTWDVVETKQTRPVPRFDHTAATHSDRYLLIFGGCSHSIFYSDLHILDLQTME 241

Query:   193 WSQPEIKGDLVTGRAGHAGITIDENWYIVGGGDNNNGCQETIVLNMTKLAWSILTSVKGR 252
             WSQP ++GD+VT RAGHAGITIDENWYIVGGGDN+ GC ET+VLNM+KL WS  T V+ R
Sbjct:   242 WSQPHVQGDVVTPRAGHAGITIDENWYIVGGGDNSTGCLETLVLNMSKLVWSTSTHVEAR 301

Query:   253 NPLASEGLSVCSAIIEGEHHLVAFGGYNGKYNNEVFVMRLKPRDIPRPKIFQSPXXXXXX 312
             +PLASEGLSVCSA + GE+ LVAFGGYNGKYNN++FVMRLKP +   PKIF+SP      
Sbjct:   302 HPLASEGLSVCSASVFGENILVAFGGYNGKYNNDIFVMRLKPGESSHPKIFKSPAAAAAA 361

Query:   313 XXXXXXXXXXKSEKLDIPKTLSSKFAGIGNDLSEKDVRTDIDAIKEDKRVLELSLTEVRT 372
                       KS+K D P   +    G GN L E+D+R  ID IKE+KR LE S+ E + 
Sbjct:   362 ASVTAAYAIAKSDKSDYPPPANPTLNGNGNSLPERDIRNRIDTIKEEKRALESSIAETQV 421

Query:   373 ENSRFREKIDEVNSTHSELSKELSSVQGQLVAERSRCFKLEAQIAELQKMLESSQTIENE 432
             EN++ REKIDEVNS+H+ELS+EL SV+GQL++ERSRCFKLEAQIAELQK LES Q+IE E
Sbjct:   422 ENAKLREKIDEVNSSHTELSQELQSVEGQLISERSRCFKLEAQIAELQKALESGQSIEAE 481

Query:   433 VQILRQQKSAFEQEMERATSVQTQGSGGVW 462
             V++LR+Q+SA ++E E  T VQ QGS GVW
Sbjct:   482 VEMLRRQRSASDEE-EDGT-VQRQGSAGVW 509




GO:0005737 "cytoplasm" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0005634 "nucleus" evidence=IDA
GO:0005829 "cytosol" evidence=IDA
GO:0006869 "lipid transport" evidence=RCA
TAIR|locus:2143676 ACBP5 "acyl-CoA binding protein 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2183008 AT5G18590 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0280765 DDB_G0280765 "Kelch repeat-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0268860 rngB "Kelch repeat-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
POMBASE|SPCC1223.06 tea1 "cell end marker Tea1" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0270750 DDB_G0270750 "Kelch repeat-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0272080 gacHH "RhoGAP domain-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|F1SKQ3 RABEPK "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0268110 DDB_G0268110 "SAM domain-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
gw1.X.2901.1
hypothetical protein (504 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query469
PLN02193470 PLN02193, PLN02193, nitrile-specifier protein 9e-11
pfam1341849 pfam13418, Kelch_4, Galactose oxidase, central dom 3e-10
pfam1341548 pfam13415, Kelch_3, Galactose oxidase, central dom 2e-09
pfam1341849 pfam13418, Kelch_4, Galactose oxidase, central dom 7e-09
PLN02153341 PLN02153, PLN02153, epithiospecifier protein 1e-08
PLN02193470 PLN02193, PLN02193, nitrile-specifier protein 3e-07
pfam1341548 pfam13415, Kelch_3, Galactose oxidase, central dom 4e-07
pfam1396450 pfam13964, Kelch_6, Kelch motif 1e-06
pfam1385442 pfam13854, Kelch_5, Kelch motif 5e-06
TIGR04211198 TIGR04211, SH3_and_anchor, SH3 domain protein 6e-06
pfam0134446 pfam01344, Kelch_1, Kelch motif 9e-06
pfam0764648 pfam07646, Kelch_2, Kelch motif 1e-05
pfam1385442 pfam13854, Kelch_5, Kelch motif 2e-05
TIGR03547346 TIGR03547, muta_rot_YjhT, mutatrotase, YjhT family 5e-05
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 7e-05
pfam14073178 pfam14073, Cep57_CLD, Centrosome localisation doma 2e-04
pfam0764648 pfam07646, Kelch_2, Kelch motif 3e-04
PHA03098534 PHA03098, PHA03098, kelch-like protein; Provisiona 3e-04
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 3e-04
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 4e-04
COG3055381 COG3055, COG3055, Uncharacterized protein conserve 4e-04
PLN02153341 PLN02153, PLN02153, epithiospecifier protein 5e-04
pfam1396450 pfam13964, Kelch_6, Kelch motif 5e-04
pfam0134446 pfam01344, Kelch_1, Kelch motif 5e-04
TIGR03547346 TIGR03547, muta_rot_YjhT, mutatrotase, YjhT family 9e-04
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 0.001
PRK14131376 PRK14131, PRK14131, N-acetylneuraminic acid mutaro 0.001
COG1579239 COG1579, COG1579, Zn-ribbon protein, possibly nucl 0.001
PRK14131376 PRK14131, PRK14131, N-acetylneuraminic acid mutaro 0.002
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 0.002
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 0.002
smart0061247 smart00612, Kelch, Kelch domain 0.002
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 0.003
COG1579239 COG1579, COG1579, Zn-ribbon protein, possibly nucl 0.003
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 0.004
>gnl|CDD|177844 PLN02193, PLN02193, nitrile-specifier protein Back     alignment and domain information
 Score = 63.4 bits (154), Expect = 9e-11
 Identities = 55/182 (30%), Positives = 82/182 (45%), Gaps = 15/182 (8%)

Query: 56  HCMVKWGTKLLILGGHYKKSS--DSMIVRFIDLETNLCGVMETSGKVP-VARGGHSVTLV 112
           H + + G K+   GG +  +   D  +  F DLET    +   +G VP ++  G  +  +
Sbjct: 169 HGIAQVGNKIYSFGGEFTPNQPIDKHLYVF-DLETRTWSISPATGDVPHLSCLGVRMVSI 227

Query: 113 GSRLIIFGGEDRSRKLLNDVHFLDLETMTWDAVEVTQTPPAPRYDHS-AALHANRYLIVF 171
           GS L +FGG D SR+  N  +  D  T  W  +   +  P PR  HS AA   N Y  VF
Sbjct: 228 GSTLYVFGGRDASRQY-NGFYSFDTTTNEWKLLTPVEEGPTPRSFHSMAADEENVY--VF 284

Query: 172 GGCSHSIFFNDLHVLDLQTNEWSQPEIKGDLVTGRAGHAGITIDEN--WYIVGGGDNNNG 229
           GG S +     L   ++   +W      GD  + R G AG+ + +   W + G     NG
Sbjct: 285 GGVSATARLKTLDSYNIVDKKWFHCSTPGDSFSIRGG-AGLEVVQGKVWVVYG----FNG 339

Query: 230 CQ 231
           C+
Sbjct: 340 CE 341


Length = 470

>gnl|CDD|205596 pfam13418, Kelch_4, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|222113 pfam13415, Kelch_3, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|205596 pfam13418, Kelch_4, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|177814 PLN02153, PLN02153, epithiospecifier protein Back     alignment and domain information
>gnl|CDD|177844 PLN02193, PLN02193, nitrile-specifier protein Back     alignment and domain information
>gnl|CDD|222113 pfam13415, Kelch_3, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|206134 pfam13964, Kelch_6, Kelch motif Back     alignment and domain information
>gnl|CDD|222419 pfam13854, Kelch_5, Kelch motif Back     alignment and domain information
>gnl|CDD|234501 TIGR04211, SH3_and_anchor, SH3 domain protein Back     alignment and domain information
>gnl|CDD|201739 pfam01344, Kelch_1, Kelch motif Back     alignment and domain information
>gnl|CDD|116261 pfam07646, Kelch_2, Kelch motif Back     alignment and domain information
>gnl|CDD|222419 pfam13854, Kelch_5, Kelch motif Back     alignment and domain information
>gnl|CDD|234253 TIGR03547, muta_rot_YjhT, mutatrotase, YjhT family Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|206243 pfam14073, Cep57_CLD, Centrosome localisation domain of Cep57 Back     alignment and domain information
>gnl|CDD|116261 pfam07646, Kelch_2, Kelch motif Back     alignment and domain information
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|225597 COG3055, COG3055, Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>gnl|CDD|177814 PLN02153, PLN02153, epithiospecifier protein Back     alignment and domain information
>gnl|CDD|206134 pfam13964, Kelch_6, Kelch motif Back     alignment and domain information
>gnl|CDD|201739 pfam01344, Kelch_1, Kelch motif Back     alignment and domain information
>gnl|CDD|234253 TIGR03547, muta_rot_YjhT, mutatrotase, YjhT family Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|237617 PRK14131, PRK14131, N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>gnl|CDD|224495 COG1579, COG1579, Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>gnl|CDD|237617 PRK14131, PRK14131, N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|128874 smart00612, Kelch, Kelch domain Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|224495 COG1579, COG1579, Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 469
PLN02193470 nitrile-specifier protein 100.0
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 100.0
PLN02193470 nitrile-specifier protein 100.0
PLN02153341 epithiospecifier protein 100.0
KOG4693392 consensus Uncharacterized conserved protein, conta 100.0
KOG4693392 consensus Uncharacterized conserved protein, conta 100.0
PLN02153341 epithiospecifier protein 100.0
PHA02713557 hypothetical protein; Provisional 100.0
KOG0379482 consensus Kelch repeat-containing proteins [Genera 100.0
KOG0379482 consensus Kelch repeat-containing proteins [Genera 100.0
PHA03098534 kelch-like protein; Provisional 100.0
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 100.0
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 100.0
TIGR03547346 muta_rot_YjhT mutatrotase, YjhT family. Members of 100.0
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 100.0
PHA02713557 hypothetical protein; Provisional 100.0
TIGR03547346 muta_rot_YjhT mutatrotase, YjhT family. Members of 100.0
PHA03098534 kelch-like protein; Provisional 100.0
KOG1230521 consensus Protein containing repeated kelch motifs 100.0
KOG4152 830 consensus Host cell transcription factor HCFC1 [Ce 100.0
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 100.0
KOG1230521 consensus Protein containing repeated kelch motifs 100.0
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 100.0
PHA02790480 Kelch-like protein; Provisional 100.0
PHA02790480 Kelch-like protein; Provisional 100.0
KOG4152 830 consensus Host cell transcription factor HCFC1 [Ce 100.0
COG3055381 Uncharacterized protein conserved in bacteria [Fun 99.82
COG3055381 Uncharacterized protein conserved in bacteria [Fun 99.75
KOG2437723 consensus Muskelin [Signal transduction mechanisms 99.66
KOG2437723 consensus Muskelin [Signal transduction mechanisms 99.65
PF1396450 Kelch_6: Kelch motif 99.25
PLN02772398 guanylate kinase 99.23
PF1396450 Kelch_6: Kelch motif 99.18
PLN02772398 guanylate kinase 99.08
PF0134447 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is 99.03
PF1341549 Kelch_3: Galactose oxidase, central domain 99.03
PF1341549 Kelch_3: Galactose oxidase, central domain 99.0
PF03089337 RAG2: Recombination activating protein 2; InterPro 98.99
PF0764649 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is 98.94
PF0764649 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is 98.92
PF1341849 Kelch_4: Galactose oxidase, central domain; PDB: 2 98.92
PF0134447 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is 98.91
PF03089337 RAG2: Recombination activating protein 2; InterPro 98.9
PF1341849 Kelch_4: Galactose oxidase, central domain; PDB: 2 98.84
PF1385442 Kelch_5: Kelch motif 98.79
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 98.71
PF1385442 Kelch_5: Kelch motif 98.68
smart0061247 Kelch Kelch domain. 98.53
smart0061247 Kelch Kelch domain. 98.51
TIGR01640230 F_box_assoc_1 F-box protein interaction domain. Th 98.47
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 98.26
TIGR01640230 F_box_assoc_1 F-box protein interaction domain. Th 98.22
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 97.43
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 97.34
PF09726 697 Macoilin: Transmembrane protein; InterPro: IPR0191 97.34
PF12768281 Rax2: Cortical protein marker for cell polarity 97.28
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 97.28
PF07893342 DUF1668: Protein of unknown function (DUF1668); In 97.24
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 97.14
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 97.0
PF12718143 Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 96.99
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 96.9
PF12768281 Rax2: Cortical protein marker for cell polarity 96.88
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 96.72
KOG2055514 consensus WD40 repeat protein [General function pr 96.71
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 96.68
KOG2055514 consensus WD40 repeat protein [General function pr 96.66
PF02191250 OLF: Olfactomedin-like domain; InterPro: IPR003112 96.52
KOG1029 1118 consensus Endocytic adaptor protein intersectin [S 96.46
PF09726 697 Macoilin: Transmembrane protein; InterPro: IPR0191 96.44
PF12718143 Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 96.38
KOG0646476 consensus WD40 repeat protein [General function pr 96.33
TIGR03075527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 96.27
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 96.23
PRK04922433 tolB translocation protein TolB; Provisional 96.16
PRK00178430 tolB translocation protein TolB; Provisional 96.11
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 96.11
PRK04792448 tolB translocation protein TolB; Provisional 96.1
cd00094194 HX Hemopexin-like repeats.; Hemopexin is a heme-bi 96.03
PF07888 546 CALCOCO1: Calcium binding and coiled-coil domain ( 96.0
PRK04792448 tolB translocation protein TolB; Provisional 95.89
PRK04043419 tolB translocation protein TolB; Provisional 95.86
PRK05137435 tolB translocation protein TolB; Provisional 95.85
PF04156191 IncA: IncA protein; InterPro: IPR007285 Chlamydia 95.81
KOG1029 1118 consensus Endocytic adaptor protein intersectin [S 95.8
COG2433 652 Uncharacterized conserved protein [Function unknow 95.76
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 95.7
PRK10361 475 DNA recombination protein RmuC; Provisional 95.64
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 95.63
PRK04922433 tolB translocation protein TolB; Provisional 95.58
PRK00178430 tolB translocation protein TolB; Provisional 95.52
KOG0995 581 consensus Centromere-associated protein HEC1 [Cell 95.48
PF07888 546 CALCOCO1: Calcium binding and coiled-coil domain ( 95.48
PRK05137435 tolB translocation protein TolB; Provisional 95.46
PF13851201 GAS: Growth-arrest specific micro-tubule binding 95.43
smart00787312 Spc7 Spc7 kinetochore protein. This domain is foun 95.42
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 95.42
PRK03629429 tolB translocation protein TolB; Provisional 95.36
PF04111 314 APG6: Autophagy protein Apg6; InterPro: IPR007243 95.32
PTZ00420568 coronin; Provisional 95.29
PF07893342 DUF1668: Protein of unknown function (DUF1668); In 95.27
PRK11028330 6-phosphogluconolactonase; Provisional 95.26
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 95.22
KOG0804493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 95.22
PRK09039 343 hypothetical protein; Validated 95.16
PF04156191 IncA: IncA protein; InterPro: IPR007285 Chlamydia 95.15
PF04111 314 APG6: Autophagy protein Apg6; InterPro: IPR007243 95.11
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 95.1
PF10186 302 Atg14: UV radiation resistance protein and autopha 95.01
COG4372 499 Uncharacterized protein conserved in bacteria with 94.98
PF08268129 FBA_3: F-box associated domain; InterPro: IPR01318 94.97
PRK04043419 tolB translocation protein TolB; Provisional 94.96
PF11559151 ADIP: Afadin- and alpha -actinin-Binding; InterPro 94.86
KOG0310487 consensus Conserved WD40 repeat-containing protein 94.83
COG2433 652 Uncharacterized conserved protein [Function unknow 94.82
PF10473140 CENP-F_leu_zip: Leucine-rich repeats of kinetochor 94.81
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 94.79
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 94.74
cd00094194 HX Hemopexin-like repeats.; Hemopexin is a heme-bi 94.71
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 94.65
PRK09039 343 hypothetical protein; Validated 94.61
PF08614194 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR 94.55
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 94.52
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 94.39
PF04849306 HAP1_N: HAP1 N-terminal conserved region; InterPro 94.39
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 94.34
PF08268129 FBA_3: F-box associated domain; InterPro: IPR01318 94.3
PF10481 307 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 94.27
TIGR03752 472 conj_TIGR03752 integrating conjugative element pro 94.27
PRK03629429 tolB translocation protein TolB; Provisional 94.2
KOG2321 703 consensus WD40 repeat protein [General function pr 94.19
KOG2129 552 consensus Uncharacterized conserved protein H4 [Fu 94.14
KOG2264 907 consensus Exostosin EXT1L [Signal transduction mec 94.11
PF02191250 OLF: Olfactomedin-like domain; InterPro: IPR003112 94.1
KOG0804493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 94.1
PF09730 717 BicD: Microtubule-associated protein Bicaudal-D; I 94.09
KOG0250 1074 consensus DNA repair protein RAD18 (SMC family pro 94.02
PRK02889427 tolB translocation protein TolB; Provisional 93.85
PF15035182 Rootletin: Ciliary rootlet component, centrosome c 93.84
COG4942 420 Membrane-bound metallopeptidase [Cell division and 93.69
PF09304107 Cortex-I_coil: Cortexillin I, coiled coil; InterPr 93.68
PF00261237 Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop 93.66
PF11932 251 DUF3450: Protein of unknown function (DUF3450); In 93.59
PF11559151 ADIP: Afadin- and alpha -actinin-Binding; InterPro 93.58
PF12128 1201 DUF3584: Protein of unknown function (DUF3584); In 93.57
PF06785 401 UPF0242: Uncharacterised protein family (UPF0242); 93.56
smart00284255 OLF Olfactomedin-like domains. 93.36
PF00769 246 ERM: Ezrin/radixin/moesin family; InterPro: IPR011 93.35
PTZ00421493 coronin; Provisional 93.33
TIGR01005 754 eps_transp_fam exopolysaccharide transport protein 93.3
PF05384159 DegS: Sensor protein DegS; InterPro: IPR008595 Thi 93.29
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 93.28
TIGR03007 498 pepcterm_ChnLen polysaccharide chain length determ 93.23
PF11932 251 DUF3450: Protein of unknown function (DUF3450); In 93.22
PF10473140 CENP-F_leu_zip: Leucine-rich repeats of kinetochor 93.21
PF14662193 CCDC155: Coiled-coil region of CCDC155 93.17
COG4026290 Uncharacterized protein containing TOPRIM domain, 93.12
PF08614194 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR 93.11
COG5185 622 HEC1 Protein involved in chromosome segregation, i 93.05
COG4942 420 Membrane-bound metallopeptidase [Cell division and 93.02
PF15070 617 GOLGA2L5: Putative golgin subfamily A member 2-lik 92.98
KOG0646476 consensus WD40 repeat protein [General function pr 92.94
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 92.92
PF00038312 Filament: Intermediate filament protein; InterPro: 92.9
TIGR03752 472 conj_TIGR03752 integrating conjugative element pro 92.8
PF09755 310 DUF2046: Uncharacterized conserved protein H4 (DUF 92.69
PF12325120 TMF_TATA_bd: TATA element modulatory factor 1 TATA 92.62
PF05335188 DUF745: Protein of unknown function (DUF745); Inte 92.6
COG3064 387 TolA Membrane protein involved in colicin uptake [ 92.42
KOG0999 772 consensus Microtubule-associated protein Bicaudal- 92.37
COG3883 265 Uncharacterized protein conserved in bacteria [Fun 92.34
PF10498359 IFT57: Intra-flagellar transport protein 57 ; Inte 92.33
KOG1853 333 consensus LIS1-interacting protein NUDE [Cytoskele 92.26
PF11180192 DUF2968: Protein of unknown function (DUF2968); In 92.18
KOG0995 581 consensus Centromere-associated protein HEC1 [Cell 92.12
KOG0996 1293 consensus Structural maintenance of chromosome pro 92.08
PF05911769 DUF869: Plant protein of unknown function (DUF869) 92.01
KOG2391365 consensus Vacuolar sorting protein/ubiquitin recep 92.0
PF06785 401 UPF0242: Uncharacterised protein family (UPF0242); 91.99
KOG0161 1930 consensus Myosin class II heavy chain [Cytoskeleto 91.97
PF06818202 Fez1: Fez1; InterPro: IPR009638 This family repres 91.86
PTZ00421493 coronin; Provisional 91.71
COG3883 265 Uncharacterized protein conserved in bacteria [Fun 91.71
KOG0649325 consensus WD40 repeat protein [General function pr 91.71
PF12217367 End_beta_propel: Catalytic beta propeller domain o 91.7
KOG0310487 consensus Conserved WD40 repeat-containing protein 91.68
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 91.64
KOG0996 1293 consensus Structural maintenance of chromosome pro 91.57
TIGR03017444 EpsF chain length determinant protein EpsF. Sequen 91.56
PF07926132 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: 91.54
PF11180192 DUF2968: Protein of unknown function (DUF2968); In 91.53
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 91.53
TIGR03185 650 DNA_S_dndD DNA sulfur modification protein DndD. T 91.49
PHA02562 562 46 endonuclease subunit; Provisional 91.46
TIGR03075527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 91.42
PF15290 305 Syntaphilin: Golgi-localised syntaxin-1-binding cl 91.4
COG4880603 Secreted protein containing C-terminal beta-propel 91.39
PLN00181793 protein SPA1-RELATED; Provisional 91.23
TIGR01843 423 type_I_hlyD type I secretion membrane fusion prote 91.22
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 91.2
TIGR03185 650 DNA_S_dndD DNA sulfur modification protein DndD. T 91.16
COG4026290 Uncharacterized protein containing TOPRIM domain, 91.14
KOG4403 575 consensus Cell surface glycoprotein STIM, contains 91.07
PF09304107 Cortex-I_coil: Cortexillin I, coiled coil; InterPr 91.06
PF15066527 CAGE1: Cancer-associated gene protein 1 family 91.03
PF10168 717 Nup88: Nuclear pore component; InterPro: IPR019321 90.99
KOG4649354 consensus PQQ (pyrrolo-quinoline quinone) repeat p 90.96
KOG0971 1243 consensus Microtubule-associated protein dynactin 90.93
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 90.84
KOG1899 861 consensus LAR transmembrane tyrosine phosphatase-i 90.83
PF13870177 DUF4201: Domain of unknown function (DUF4201) 90.81
KOG4005 292 consensus Transcription factor XBP-1 [Transcriptio 90.73
PF15233134 SYCE1: Synaptonemal complex central element protei 90.69
PF09755 310 DUF2046: Uncharacterized conserved protein H4 (DUF 90.66
PLN00181793 protein SPA1-RELATED; Provisional 90.58
KOG0249 916 consensus LAR-interacting protein and related prot 90.45
PF15619194 Lebercilin: Ciliary protein causing Leber congenit 90.44
PF06637442 PV-1: PV-1 protein (PLVAP); InterPro: IPR009538 Th 90.43
PRK04863 1486 mukB cell division protein MukB; Provisional 90.35
PF00038312 Filament: Intermediate filament protein; InterPro: 90.33
PTZ00420568 coronin; Provisional 90.31
PF10481 307 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 90.3
PF10234267 Cluap1: Clusterin-associated protein-1; InterPro: 90.16
KOG4378 673 consensus Nuclear protein COP1 [Signal transductio 90.06
PF07889126 DUF1664: Protein of unknown function (DUF1664); In 90.04
KOG1962216 consensus B-cell receptor-associated protein and r 90.01
PRK13684334 Ycf48-like protein; Provisional 90.01
PF00769 246 ERM: Ezrin/radixin/moesin family; InterPro: IPR011 90.0
PF0858179 Tup_N: Tup N-terminal; InterPro: IPR013890 The N-t 89.98
KOG4661 940 consensus Hsp27-ERE-TATA-binding protein/Scaffold 89.96
KOG0980 980 consensus Actin-binding protein SLA2/Huntingtin-in 89.95
PF15556252 Zwint: ZW10 interactor 89.86
COG1520370 FOG: WD40-like repeat [Function unknown] 89.86
COG3206458 GumC Uncharacterized protein involved in exopolysa 89.82
PF12217367 End_beta_propel: Catalytic beta propeller domain o 89.76
PF00261237 Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop 89.62
PF12761195 End3: Actin cytoskeleton-regulatory complex protei 89.56
KOG2991330 consensus Splicing regulator [RNA processing and m 89.53
KOG09941758 consensus Extracellular matrix glycoprotein Lamini 89.5
KOG1853 333 consensus LIS1-interacting protein NUDE [Cytoskele 89.49
PF15066527 CAGE1: Cancer-associated gene protein 1 family 89.39
KOG1003205 consensus Actin filament-coating protein tropomyos 89.26
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 89.23
PRK09841 726 cryptic autophosphorylating protein tyrosine kinas 89.12
KOG0243 1041 consensus Kinesin-like protein [Cytoskeleton] 89.07
PF1232974 TMF_DNA_bd: TATA element modulatory factor 1 DNA b 89.07
KOG0266456 consensus WD40 repeat-containing protein [General 89.01
PRK02889427 tolB translocation protein TolB; Provisional 88.99
PF06637442 PV-1: PV-1 protein (PLVAP); InterPro: IPR009538 Th 88.98
PF14282106 FlxA: FlxA-like protein 88.89
PF12128 1201 DUF3584: Protein of unknown function (DUF3584); In 88.83
PF1232974 TMF_DNA_bd: TATA element modulatory factor 1 DNA b 88.82
KOG0971 1243 consensus Microtubule-associated protein dynactin 88.65
PF05667 594 DUF812: Protein of unknown function (DUF812); Inte 88.6
TIGR02680 1353 conserved hypothetical protein TIGR02680. Members 88.56
PRK01742429 tolB translocation protein TolB; Provisional 88.49
COG1382119 GimC Prefoldin, chaperonin cofactor [Posttranslati 88.44
PLN00033398 photosystem II stability/assembly factor; Provisio 88.42
PF0600572 DUF904: Protein of unknown function (DUF904); Inte 88.39
PF10498359 IFT57: Intra-flagellar transport protein 57 ; Inte 88.35
PRK10115 686 protease 2; Provisional 88.26
KOG0946 970 consensus ER-Golgi vesicle-tethering protein p115 88.17
PF06818202 Fez1: Fez1; InterPro: IPR009638 This family repres 88.0
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 87.93
KOG0976 1265 consensus Rho/Rac1-interacting serine/threonine ki 87.9
PF10211189 Ax_dynein_light: Axonemal dynein light chain; Inte 87.89
PF07106169 TBPIP: Tat binding protein 1(TBP-1)-interacting pr 87.85
COG4946 668 Uncharacterized protein related to the periplasmic 87.68
KOG2077 832 consensus JNK/SAPK-associated protein-1 [Signal tr 87.61
PF04012221 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 T 87.54
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 87.43
PF05384159 DegS: Sensor protein DegS; InterPro: IPR008595 Thi 87.28
TIGR00634 563 recN DNA repair protein RecN. All proteins in this 87.19
KOG2048691 consensus WD40 repeat protein [General function pr 87.17
PF10168 717 Nup88: Nuclear pore component; InterPro: IPR019321 87.09
PF03938158 OmpH: Outer membrane protein (OmpH-like); InterPro 86.93
PHA02562 562 46 endonuclease subunit; Provisional 86.91
PF15070 617 GOLGA2L5: Putative golgin subfamily A member 2-lik 86.83
KOG1937 521 consensus Uncharacterized conserved protein [Funct 86.68
PRK11028330 6-phosphogluconolactonase; Provisional 86.58
KOG3915641 consensus Transcription regulator dachshund, conta 86.56
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 86.53
COG1842225 PspA Phage shock protein A (IM30), suppresses sigm 86.41
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 86.32
KOG0933 1174 consensus Structural maintenance of chromosome pro 86.31
COG3823262 Glutamine cyclotransferase [Posttranslational modi 86.21
PRK13684334 Ycf48-like protein; Provisional 86.2
PRK13454181 F0F1 ATP synthase subunit B'; Provisional 86.2
PRK13729 475 conjugal transfer pilus assembly protein TraB; Pro 86.17
PRK11546143 zraP zinc resistance protein; Provisional 86.15
KOG3647 338 consensus Predicted coiled-coil protein [General f 85.98
PRK13182175 racA polar chromosome segregation protein; Reviewe 85.97
PF07926132 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: 85.95
PRK09174204 F0F1 ATP synthase subunit B'; Validated 85.85
PF13088275 BNR_2: BNR repeat-like domain; PDB: 2F11_A 2F0Z_A 85.77
PRK11519 719 tyrosine kinase; Provisional 85.75
PF07058 351 Myosin_HC-like: Myosin II heavy chain-like; InterP 85.72
PF05667 594 DUF812: Protein of unknown function (DUF812); Inte 85.71
KOG1899 861 consensus LAR transmembrane tyrosine phosphatase-i 85.69
PRK03947140 prefoldin subunit alpha; Reviewed 85.67
PF05546207 She9_MDM33: She9 / Mdm33 family; InterPro: IPR0088 85.64
PRK09841 726 cryptic autophosphorylating protein tyrosine kinas 85.62
PRK10929 1109 putative mechanosensitive channel protein; Provisi 85.52
KOG0288 459 consensus WD40 repeat protein TipD [General functi 85.45
PF04849306 HAP1_N: HAP1 N-terminal conserved region; InterPro 85.44
PF12777 344 MT: Microtubule-binding stalk of dynein motor; Int 85.37
PF15290 305 Syntaphilin: Golgi-localised syntaxin-1-binding cl 85.35
PRK10803 263 tol-pal system protein YbgF; Provisional 85.34
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 85.29
KOG2321 703 consensus WD40 repeat protein [General function pr 85.28
PRK1542279 septal ring assembly protein ZapB; Provisional 85.24
PF14817 632 HAUS5: HAUS augmin-like complex subunit 5 85.24
COG1730145 GIM5 Predicted prefoldin, molecular chaperone impl 85.01
PF07321152 YscO: Type III secretion protein YscO; InterPro: I 84.92
PRK0440675 hypothetical protein; Provisional 84.87
KOG0979 1072 consensus Structural maintenance of chromosome pro 84.71
PF11068131 YlqD: YlqD protein; InterPro: IPR021297 This bacte 84.7
KOG0612 1317 consensus Rho-associated, coiled-coil containing p 84.61
KOG0980 980 consensus Actin-binding protein SLA2/Huntingtin-in 84.48
PF12777344 MT: Microtubule-binding stalk of dynein motor; Int 84.44
COG1322 448 Predicted nuclease of restriction endonuclease-lik 84.35
PF10146 230 zf-C4H2: Zinc finger-containing protein ; InterPro 84.31
KOG0249 916 consensus LAR-interacting protein and related prot 84.15
PF09738 302 DUF2051: Double stranded RNA binding protein (DUF2 84.12
KOG0999 772 consensus Microtubule-associated protein Bicaudal- 83.92
PF15358 558 TSKS: Testis-specific serine kinase substrate 83.83
KOG0994 1758 consensus Extracellular matrix glycoprotein Lamini 83.72
PF09789 319 DUF2353: Uncharacterized coiled-coil protein (DUF2 83.6
PRK10780165 periplasmic chaperone; Provisional 83.48
PF10205102 KLRAQ: Predicted coiled-coil domain-containing pro 83.46
PF12761195 End3: Actin cytoskeleton-regulatory complex protei 83.38
PF15525200 DUF4652: Domain of unknown function (DUF4652) 83.37
PRK10698222 phage shock protein PspA; Provisional 83.35
PRK06231205 F0F1 ATP synthase subunit B; Validated 83.34
PF02388406 FemAB: FemAB family; InterPro: IPR003447 The femAB 83.34
KOG0612 1317 consensus Rho-associated, coiled-coil containing p 83.29
KOG3990305 consensus Uncharacterized conserved protein [Funct 83.28
PF09910339 DUF2139: Uncharacterized protein conserved in arch 83.23
KOG1103 561 consensus Predicted coiled-coil protein [Function 83.14
KOG0977 546 consensus Nuclear envelope protein lamin, intermed 83.05
TIGR02977219 phageshock_pspA phage shock protein A. Members of 82.93
KOG1937521 consensus Uncharacterized conserved protein [Funct 82.89
CHL00118156 atpG ATP synthase CF0 B' subunit; Validated 82.87
KOG0649325 consensus WD40 repeat protein [General function pr 82.86
PF07889126 DUF1664: Protein of unknown function (DUF1664); In 82.81
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 82.75
PRK01742429 tolB translocation protein TolB; Provisional 82.6
KOG0964 1200 consensus Structural maintenance of chromosome pro 82.46
PF05335188 DUF745: Protein of unknown function (DUF745); Inte 82.22
TIGR01000 457 bacteriocin_acc bacteriocin secretion accessory pr 82.12
PF1004699 BLOC1_2: Biogenesis of lysosome-related organelles 81.87
KOG3215222 consensus Uncharacterized conserved protein [Funct 81.87
KOG0964 1200 consensus Structural maintenance of chromosome pro 81.62
PF07851 330 TMPIT: TMPIT-like protein; InterPro: IPR012926 A n 81.25
KOG0288 459 consensus WD40 repeat protein TipD [General functi 81.03
PF06476115 DUF1090: Protein of unknown function (DUF1090); In 81.03
PRK13453173 F0F1 ATP synthase subunit B; Provisional 80.95
KOG2129 552 consensus Uncharacterized conserved protein H4 [Fu 80.94
PRK14472175 F0F1 ATP synthase subunit B; Provisional 80.88
TIGR01005 754 eps_transp_fam exopolysaccharide transport protein 80.86
PF06810155 Phage_GP20: Phage minor structural protein GP20; I 80.82
PF06810155 Phage_GP20: Phage minor structural protein GP20; I 80.72
KOG4673 961 consensus Transcription factor TMF, TATA element m 80.7
PF13863126 DUF4200: Domain of unknown function (DUF4200) 80.6
PF10205102 KLRAQ: Predicted coiled-coil domain-containing pro 80.51
PF10267395 Tmemb_cc2: Predicted transmembrane and coiled-coil 80.39
PF08657259 DASH_Spc34: DASH complex subunit Spc34 ; InterPro: 80.38
KOG4603201 consensus TBP-1 interacting protein [Signal transd 80.36
PF09738302 DUF2051: Double stranded RNA binding protein (DUF2 80.26
PF13870177 DUF4201: Domain of unknown function (DUF4201) 80.18
KOG4643 1195 consensus Uncharacterized coiled-coil protein [Fun 80.03
>PLN02193 nitrile-specifier protein Back     alignment and domain information
Probab=100.00  E-value=3.4e-42  Score=345.96  Aligned_cols=304  Identities=20%  Similarity=0.304  Sum_probs=244.1

Q ss_pred             CEEEcccCCCcccCCceEEE--EccC----CceeeeeecccccCCccccCCCCCCCCCCcCeeeEEECCEEEEEccccCC
Q 012184            1 MLLRCSIRNYTLLEGVVMVF--DLRS----LAWSNLRLETELDADKTEDSGLLEVLPPMSDHCMVKWGTKLLILGGHYKK   74 (469)
Q Consensus         1 l~~~GG~~~~~~~~~~~~~~--d~~~----~~W~~~~~~~~~~~~~~~~~~~~~~p~~r~~~~~~~~~~~iy~~GG~~~~   74 (469)
                      |+.|+|.... .++ .+-+|  +|.+    ++|..+.+.+..             |.+|.+|+++++++.||++||....
T Consensus       123 ivgf~G~~~~-~~~-~ig~y~~~~~~~~~~~~W~~~~~~~~~-------------P~pR~~h~~~~~~~~iyv~GG~~~~  187 (470)
T PLN02193        123 IVGFHGRSTD-VLH-SLGAYISLPSTPKLLGKWIKVEQKGEG-------------PGLRCSHGIAQVGNKIYSFGGEFTP  187 (470)
T ss_pred             EEEEeccCCC-cEE-eeEEEEecCCChhhhceEEEcccCCCC-------------CCCccccEEEEECCEEEEECCcCCC
Confidence            3556675433 344 44444  6644    899999887544             8899999999999999999997543


Q ss_pred             C-CCcceEEEEECCCCeEEEeecCCCCCC-CCcceEEEEECCEEEEEeccCCCCCccCcEEEEECCCCeEEEeeeCCCCC
Q 012184           75 S-SDSMIVRFIDLETNLCGVMETSGKVPV-ARGGHSVTLVGSRLIIFGGEDRSRKLLNDVHFLDLETMTWDAVEVTQTPP  152 (469)
Q Consensus        75 ~-~~~~~~~~~d~~t~~W~~~~~~g~~p~-~r~~~~~~~~~~~lyi~GG~~~~~~~~~~v~~~d~~t~~W~~~~~~g~~p  152 (469)
                      . ...+++|+||+.+++|..+++.+++|. +|.+|++++++++||+|||..... .++++++||+.+++|+.+.+.+..|
T Consensus       188 ~~~~~~~v~~yD~~~~~W~~~~~~g~~P~~~~~~~~~v~~~~~lYvfGG~~~~~-~~ndv~~yD~~t~~W~~l~~~~~~P  266 (470)
T PLN02193        188 NQPIDKHLYVFDLETRTWSISPATGDVPHLSCLGVRMVSIGSTLYVFGGRDASR-QYNGFYSFDTTTNEWKLLTPVEEGP  266 (470)
T ss_pred             CCCeeCcEEEEECCCCEEEeCCCCCCCCCCcccceEEEEECCEEEEECCCCCCC-CCccEEEEECCCCEEEEcCcCCCCC
Confidence            3 244679999999999999887766665 467899999999999999987654 5899999999999999998766668


Q ss_pred             CCCCCceEEEEcCcEEEEEecCCCCcccCcEEEEECCCCceEeeeecCCCCCCCcceEEEEECCEEEEEecCCCCCCcce
Q 012184          153 APRYDHSAALHANRYLIVFGGCSHSIFFNDLHVLDLQTNEWSQPEIKGDLVTGRAGHAGITIDENWYIVGGGDNNNGCQE  232 (469)
Q Consensus       153 ~~r~~~~~~~~~~~~l~v~GG~~~~~~~~~i~~~d~~~~~W~~~~~~~~~p~~r~~~~~~~~~~~l~v~GG~~~~~~~~d  232 (469)
                      .+|++|+++++ +++||||||.+....++++++||+.+++|+.+...+.+|.+|..|+++.+++++||+||.++. ..++
T Consensus       267 ~~R~~h~~~~~-~~~iYv~GG~~~~~~~~~~~~yd~~t~~W~~~~~~~~~~~~R~~~~~~~~~gkiyviGG~~g~-~~~d  344 (470)
T PLN02193        267 TPRSFHSMAAD-EENVYVFGGVSATARLKTLDSYNIVDKKWFHCSTPGDSFSIRGGAGLEVVQGKVWVVYGFNGC-EVDD  344 (470)
T ss_pred             CCccceEEEEE-CCEEEEECCCCCCCCcceEEEEECCCCEEEeCCCCCCCCCCCCCcEEEEECCcEEEEECCCCC-ccCc
Confidence            99999999888 678999999987777899999999999999987666678899999999999999999997653 3689


Q ss_pred             EEEEECCCCcEEEeccCCCCCCCCCCCcceEEEEEcCCcEEEEEeccCC----------CCCceEEEEECCCCCCCCccc
Q 012184          233 TIVLNMTKLAWSILTSVKGRNPLASEGLSVCSAIIEGEHHLVAFGGYNG----------KYNNEVFVMRLKPRDIPRPKI  302 (469)
Q Consensus       233 ~~~~d~~~~~W~~~~~~~~~~p~~r~~~s~~~~~~~~~~~l~v~GG~~~----------~~~~~~~~~d~~~~~w~~~~~  302 (469)
                      +++||+.+++|+.++.+ +..|.+|.+|+++.+    +++||||||...          ...+++|+||+.++.|..+..
T Consensus       345 v~~yD~~t~~W~~~~~~-g~~P~~R~~~~~~~~----~~~iyv~GG~~~~~~~~~~~~~~~~ndv~~~D~~t~~W~~~~~  419 (470)
T PLN02193        345 VHYYDPVQDKWTQVETF-GVRPSERSVFASAAV----GKHIVIFGGEIAMDPLAHVGPGQLTDGTFALDTETLQWERLDK  419 (470)
T ss_pred             eEEEECCCCEEEEeccC-CCCCCCcceeEEEEE----CCEEEEECCccCCccccccCccceeccEEEEEcCcCEEEEccc
Confidence            99999999999998754 345678888887766    789999999752          245789999999999998775


Q ss_pred             c------CCCchhhcchhh-----hHHHhhcccccc
Q 012184          303 F------QSPAAAAAAASV-----TAAYALAKSEKL  327 (469)
Q Consensus       303 ~------~~~~~~~~~~~~-----~~~~~~gg~~~~  327 (469)
                      +      |.++.+++++..     ..+++|||....
T Consensus       420 ~~~~~~~P~~R~~~~~~~~~~~~~~~~~~fGG~~~~  455 (470)
T PLN02193        420 FGEEEETPSSRGWTASTTGTIDGKKGLVMHGGKAPT  455 (470)
T ss_pred             CCCCCCCCCCCccccceeeEEcCCceEEEEcCCCCc
Confidence            4      344444432221     348889988643



>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>KOG4693 consensus Uncharacterized conserved protein, contains kelch repeat [General function prediction only] Back     alignment and domain information
>KOG4693 consensus Uncharacterized conserved protein, contains kelch repeat [General function prediction only] Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>KOG0379 consensus Kelch repeat-containing proteins [General function prediction only] Back     alignment and domain information
>KOG0379 consensus Kelch repeat-containing proteins [General function prediction only] Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>KOG1230 consensus Protein containing repeated kelch motifs [General function prediction only] Back     alignment and domain information
>KOG4152 consensus Host cell transcription factor HCFC1 [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>KOG1230 consensus Protein containing repeated kelch motifs [General function prediction only] Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>KOG4152 consensus Host cell transcription factor HCFC1 [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>COG3055 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG3055 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2437 consensus Muskelin [Signal transduction mechanisms] Back     alignment and domain information
>KOG2437 consensus Muskelin [Signal transduction mechanisms] Back     alignment and domain information
>PF13964 Kelch_6: Kelch motif Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>PF13964 Kelch_6: Kelch motif Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF13415 Kelch_3: Galactose oxidase, central domain Back     alignment and domain information
>PF13415 Kelch_3: Galactose oxidase, central domain Back     alignment and domain information
>PF03089 RAG2: Recombination activating protein 2; InterPro: IPR004321 The variable portion of the genes encoding immunoglobulins and T cell receptors are assembled from component V, D, and J DNA segments by a site-specific recombination reaction termed V(D)J recombination Back     alignment and domain information
>PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B Back     alignment and domain information
>PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF03089 RAG2: Recombination activating protein 2; InterPro: IPR004321 The variable portion of the genes encoding immunoglobulins and T cell receptors are assembled from component V, D, and J DNA segments by a site-specific recombination reaction termed V(D)J recombination Back     alignment and domain information
>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B Back     alignment and domain information
>PF13854 Kelch_5: Kelch motif Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>PF13854 Kelch_5: Kelch motif Back     alignment and domain information
>smart00612 Kelch Kelch domain Back     alignment and domain information
>smart00612 Kelch Kelch domain Back     alignment and domain information
>TIGR01640 F_box_assoc_1 F-box protein interaction domain Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>TIGR01640 F_box_assoc_1 F-box protein interaction domain Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF02191 OLF: Olfactomedin-like domain; InterPro: IPR003112 The olfactomedin-domain was first identified in olfactomedin, an extracellular matrix protein of the olfactory neuroepithelium [] Back     alignment and domain information
>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>cd00094 HX Hemopexin-like repeats Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion Back     alignment and domain information
>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG2433 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PRK10361 DNA recombination protein RmuC; Provisional Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF13851 GAS: Growth-arrest specific micro-tubule binding Back     alignment and domain information
>smart00787 Spc7 Spc7 kinetochore protein Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion Back     alignment and domain information
>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking Back     alignment and domain information
>COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] Back     alignment and domain information
>PF08268 FBA_3: F-box associated domain; InterPro: IPR013187 This domain occurs in a diverse superfamily of genes in plants Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>COG2433 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>cd00094 HX Hemopexin-like repeats Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>PF08268 FBA_3: F-box associated domain; InterPro: IPR013187 This domain occurs in a diverse superfamily of genes in plants Back     alignment and domain information
>PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] Back     alignment and domain information
>TIGR03752 conj_TIGR03752 integrating conjugative element protein, PFL_4705 family Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2129 consensus Uncharacterized conserved protein H4 [Function unknown] Back     alignment and domain information
>KOG2264 consensus Exostosin EXT1L [Signal transduction mechanisms] Back     alignment and domain information
>PF02191 OLF: Olfactomedin-like domain; InterPro: IPR003112 The olfactomedin-domain was first identified in olfactomedin, an extracellular matrix protein of the olfactory neuroepithelium [] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] Back     alignment and domain information
>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF15035 Rootletin: Ciliary rootlet component, centrosome cohesion Back     alignment and domain information
>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold) Back     alignment and domain information
>PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch Back     alignment and domain information
>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins Back     alignment and domain information
>PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function Back     alignment and domain information
>smart00284 OLF Olfactomedin-like domains Back     alignment and domain information
>PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>TIGR01005 eps_transp_fam exopolysaccharide transport protein family Back     alignment and domain information
>PF05384 DegS: Sensor protein DegS; InterPro: IPR008595 This is a group of Bacillus DegS proteins Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily Back     alignment and domain information
>PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] Back     alignment and domain information
>PF14662 CCDC155: Coiled-coil region of CCDC155 Back     alignment and domain information
>COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] Back     alignment and domain information
>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] Back     alignment and domain information
>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope Back     alignment and domain information
>TIGR03752 conj_TIGR03752 integrating conjugative element protein, PFL_4705 family Back     alignment and domain information
>PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain Back     alignment and domain information
>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] Back     alignment and domain information
>PF05335 DUF745: Protein of unknown function (DUF745); InterPro: IPR007999 This family consists of several uncharacterised Drosophila melanogaster proteins of unknown function Back     alignment and domain information
>COG3064 TolA Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3883 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms Back     alignment and domain information
>KOG1853 consensus LIS1-interacting protein NUDE [Cytoskeleton] Back     alignment and domain information
>PF11180 DUF2968: Protein of unknown function (DUF2968); InterPro: IPR021350 This family of proteins has no known function Back     alignment and domain information
>KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants Back     alignment and domain information
>KOG2391 consensus Vacuolar sorting protein/ubiquitin receptor VPS23 [Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function Back     alignment and domain information
>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] Back     alignment and domain information
>PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>COG3883 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG0649 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF12217 End_beta_propel: Catalytic beta propeller domain of bacteriophage endosialidase; InterPro: IPR024428 This entry represents the beta propeller domain of endosialidases, which consists of catalytically active part of the enzymes Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR03017 EpsF chain length determinant protein EpsF Back     alignment and domain information
>PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) Back     alignment and domain information
>PF11180 DUF2968: Protein of unknown function (DUF2968); InterPro: IPR021350 This family of proteins has no known function Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>PF15290 Syntaphilin: Golgi-localised syntaxin-1-binding clamp Back     alignment and domain information
>COG4880 Secreted protein containing C-terminal beta-propeller domain distantly related to WD-40 repeats [General function prediction only] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD Back     alignment and domain information
>COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] Back     alignment and domain information
>KOG4403 consensus Cell surface glycoprotein STIM, contains SAM domain [General function prediction only] Back     alignment and domain information
>PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold) Back     alignment and domain information
>PF15066 CAGE1: Cancer-associated gene protein 1 family Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>KOG4649 consensus PQQ (pyrrolo-quinoline quinone) repeat protein [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>KOG1899 consensus LAR transmembrane tyrosine phosphatase-interacting protein liprin [General function prediction only] Back     alignment and domain information
>PF13870 DUF4201: Domain of unknown function (DUF4201) Back     alignment and domain information
>KOG4005 consensus Transcription factor XBP-1 [Transcription] Back     alignment and domain information
>PF15233 SYCE1: Synaptonemal complex central element protein 1 Back     alignment and domain information
>PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0249 consensus LAR-interacting protein and related proteins [General function prediction only] Back     alignment and domain information
>PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease Back     alignment and domain information
>PF06637 PV-1: PV-1 protein (PLVAP); InterPro: IPR009538 This family consists of several PV-1 (PLVAP) proteins, which seem to be specific to mammals Back     alignment and domain information
>PRK04863 mukB cell division protein MukB; Provisional Back     alignment and domain information
>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] Back     alignment and domain information
>PF10234 Cluap1: Clusterin-associated protein-1; InterPro: IPR019366 This protein of 413 amino acids contains a central coiled-coil domain, possibly the region that binds to clusterin Back     alignment and domain information
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information
>PF07889 DUF1664: Protein of unknown function (DUF1664); InterPro: IPR012458 The members of this family are hypothetical plant proteins of unknown function Back     alignment and domain information
>KOG1962 consensus B-cell receptor-associated protein and related proteins [Defense mechanisms] Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] Back     alignment and domain information
>PF08581 Tup_N: Tup N-terminal; InterPro: IPR013890 The N-terminal region of the Tup protein has been shown to interact with the Ssn6 transcriptional co-repressor [] Back     alignment and domain information
>KOG4661 consensus Hsp27-ERE-TATA-binding protein/Scaffold attachment factor (SAF-B) [Transcription] Back     alignment and domain information
>KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] Back     alignment and domain information
>PF15556 Zwint: ZW10 interactor Back     alignment and domain information
>COG1520 FOG: WD40-like repeat [Function unknown] Back     alignment and domain information
>COG3206 GumC Uncharacterized protein involved in exopolysaccharide biosynthesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF12217 End_beta_propel: Catalytic beta propeller domain of bacteriophage endosialidase; InterPro: IPR024428 This entry represents the beta propeller domain of endosialidases, which consists of catalytically active part of the enzymes Back     alignment and domain information
>PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>PF12761 End3: Actin cytoskeleton-regulatory complex protein END3 Back     alignment and domain information
>KOG2991 consensus Splicing regulator [RNA processing and modification] Back     alignment and domain information
>KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] Back     alignment and domain information
>KOG1853 consensus LIS1-interacting protein NUDE [Cytoskeleton] Back     alignment and domain information
>PF15066 CAGE1: Cancer-associated gene protein 1 family Back     alignment and domain information
>KOG1003 consensus Actin filament-coating protein tropomyosin [Cytoskeleton] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>PRK09841 cryptic autophosphorylating protein tyrosine kinase Etk; Provisional Back     alignment and domain information
>KOG0243 consensus Kinesin-like protein [Cytoskeleton] Back     alignment and domain information
>PF12329 TMF_DNA_bd: TATA element modulatory factor 1 DNA binding; InterPro: IPR022092 This is the middle region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes that contains at its N-terminal section a number of leucine zippers that could potentially form coiled coil structures Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF06637 PV-1: PV-1 protein (PLVAP); InterPro: IPR009538 This family consists of several PV-1 (PLVAP) proteins, which seem to be specific to mammals Back     alignment and domain information
>PF14282 FlxA: FlxA-like protein Back     alignment and domain information
>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins Back     alignment and domain information
>PF12329 TMF_DNA_bd: TATA element modulatory factor 1 DNA binding; InterPro: IPR022092 This is the middle region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes that contains at its N-terminal section a number of leucine zippers that could potentially form coiled coil structures Back     alignment and domain information
>KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>TIGR02680 conserved hypothetical protein TIGR02680 Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG1382 GimC Prefoldin, chaperonin cofactor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN00033 photosystem II stability/assembly factor; Provisional Back     alignment and domain information
>PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation Back     alignment and domain information
>PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] Back     alignment and domain information
>PF10211 Ax_dynein_light: Axonemal dynein light chain; InterPro: IPR019347 Axonemal dynein light chain proteins play a dynamic role in flagellar and cilial motility Back     alignment and domain information
>PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>KOG2077 consensus JNK/SAPK-associated protein-1 [Signal transduction mechanisms] Back     alignment and domain information
>PF04012 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 This family includes PspA a protein that suppresses sigma54-dependent transcription Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>PF05384 DegS: Sensor protein DegS; InterPro: IPR008595 This is a group of Bacillus DegS proteins Back     alignment and domain information
>TIGR00634 recN DNA repair protein RecN Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>PF03938 OmpH: Outer membrane protein (OmpH-like); InterPro: IPR005632 This entry includes outer membrane proteins such as OmpH (Skp) among others Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 Back     alignment and domain information
>KOG1937 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG3915 consensus Transcription regulator dachshund, contains SKI/SNO domain [Transcription] Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1842 PspA Phage shock protein A (IM30), suppresses sigma54-dependent transcription [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG3823 Glutamine cyclotransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>PRK13454 F0F1 ATP synthase subunit B'; Provisional Back     alignment and domain information
>PRK13729 conjugal transfer pilus assembly protein TraB; Provisional Back     alignment and domain information
>PRK11546 zraP zinc resistance protein; Provisional Back     alignment and domain information
>KOG3647 consensus Predicted coiled-coil protein [General function prediction only] Back     alignment and domain information
>PRK13182 racA polar chromosome segregation protein; Reviewed Back     alignment and domain information
>PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) Back     alignment and domain information
>PRK09174 F0F1 ATP synthase subunit B'; Validated Back     alignment and domain information
>PF13088 BNR_2: BNR repeat-like domain; PDB: 2F11_A 2F0Z_A 1VCU_B 2F25_B 1SO7_A 2F29_A 1SNT_A 2F13_A 2F28_A 2F27_A Back     alignment and domain information
>PRK11519 tyrosine kinase; Provisional Back     alignment and domain information
>PF07058 Myosin_HC-like: Myosin II heavy chain-like; InterPro: IPR009768 This family represents a conserved region within a number of myosin II heavy chain-like proteins that seem to be specific to Arabidopsis thaliana Back     alignment and domain information
>PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>KOG1899 consensus LAR transmembrane tyrosine phosphatase-interacting protein liprin [General function prediction only] Back     alignment and domain information
>PRK03947 prefoldin subunit alpha; Reviewed Back     alignment and domain information
>PF05546 She9_MDM33: She9 / Mdm33 family; InterPro: IPR008839 Members of this family are mitochondrial inner membrane proteins with a role in inner mitochondrial membrane organisation and biogenesis [] Back     alignment and domain information
>PRK09841 cryptic autophosphorylating protein tyrosine kinase Etk; Provisional Back     alignment and domain information
>PRK10929 putative mechanosensitive channel protein; Provisional Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues Back     alignment and domain information
>PF12777 MT: Microtubule-binding stalk of dynein motor; InterPro: IPR024743 The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases Back     alignment and domain information
>PF15290 Syntaphilin: Golgi-localised syntaxin-1-binding clamp Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK15422 septal ring assembly protein ZapB; Provisional Back     alignment and domain information
>PF14817 HAUS5: HAUS augmin-like complex subunit 5 Back     alignment and domain information
>COG1730 GIM5 Predicted prefoldin, molecular chaperone implicated in de novo protein folding [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07321 YscO: Type III secretion protein YscO; InterPro: IPR009929 This family contains the bacterial type III secretion protein YscO, which is approximately 150 residues long Back     alignment and domain information
>PRK04406 hypothetical protein; Provisional Back     alignment and domain information
>KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>PF11068 YlqD: YlqD protein; InterPro: IPR021297 This bacterial family of proteins has no known function Back     alignment and domain information
>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] Back     alignment and domain information
>PF12777 MT: Microtubule-binding stalk of dynein motor; InterPro: IPR024743 The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases Back     alignment and domain information
>COG1322 Predicted nuclease of restriction endonuclease-like fold, RmuC family [General function prediction only] Back     alignment and domain information
>PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG0249 consensus LAR-interacting protein and related proteins [General function prediction only] Back     alignment and domain information
>PF09738 DUF2051: Double stranded RNA binding protein (DUF2051); InterPro: IPR019139 This entry represents transcriptional repressors which preferentially bind to the GC-rich consensus sequence (5'-AGCCCCCGGCG-3') and may regulate expression of TNF, EGFR and PDGFA Back     alignment and domain information
>KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF15358 TSKS: Testis-specific serine kinase substrate Back     alignment and domain information
>KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] Back     alignment and domain information
>PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function Back     alignment and domain information
>PRK10780 periplasmic chaperone; Provisional Back     alignment and domain information
>PF10205 KLRAQ: Predicted coiled-coil domain-containing protein; InterPro: IPR019343 This entry represents a N-terminal 100 residues long domain, which contains a conserved KLRAQ motif Back     alignment and domain information
>PF12761 End3: Actin cytoskeleton-regulatory complex protein END3 Back     alignment and domain information
>PF15525 DUF4652: Domain of unknown function (DUF4652) Back     alignment and domain information
>PRK10698 phage shock protein PspA; Provisional Back     alignment and domain information
>PRK06231 F0F1 ATP synthase subunit B; Validated Back     alignment and domain information
>PF02388 FemAB: FemAB family; InterPro: IPR003447 The femAB operon codes for two nearly identical approximately 50kDa proteins involved in the formation of the Staphylococcal pentaglycine interpeptide bridge in peptidoglycan [] Back     alignment and domain information
>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG3990 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF09910 DUF2139: Uncharacterized protein conserved in archaea (DUF2139); InterPro: IPR016675 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG1103 consensus Predicted coiled-coil protein [Function unknown] Back     alignment and domain information
>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] Back     alignment and domain information
>TIGR02977 phageshock_pspA phage shock protein A Back     alignment and domain information
>KOG1937 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>CHL00118 atpG ATP synthase CF0 B' subunit; Validated Back     alignment and domain information
>KOG0649 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF07889 DUF1664: Protein of unknown function (DUF1664); InterPro: IPR012458 The members of this family are hypothetical plant proteins of unknown function Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF05335 DUF745: Protein of unknown function (DUF745); InterPro: IPR007999 This family consists of several uncharacterised Drosophila melanogaster proteins of unknown function Back     alignment and domain information
>TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein Back     alignment and domain information
>PF10046 BLOC1_2: Biogenesis of lysosome-related organelles complex-1 subunit 2 ; InterPro: IPR019269 This entry represents a family of proteins that play a role in cellular proliferation, as well as in the biogenesis of specialised organelles of the endosomal-lysosomal system [] Back     alignment and domain information
>KOG3215 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF07851 TMPIT: TMPIT-like protein; InterPro: IPR012926 A number of members of this family are annotated as being transmembrane proteins induced by tumour necrosis factor alpha, but no literature was found to support this Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>PF06476 DUF1090: Protein of unknown function (DUF1090); InterPro: IPR009468 This family consists of several bacterial proteins of unknown function and is known as YqjC in Escherichia coli Back     alignment and domain information
>PRK13453 F0F1 ATP synthase subunit B; Provisional Back     alignment and domain information
>KOG2129 consensus Uncharacterized conserved protein H4 [Function unknown] Back     alignment and domain information
>PRK14472 F0F1 ATP synthase subunit B; Provisional Back     alignment and domain information
>TIGR01005 eps_transp_fam exopolysaccharide transport protein family Back     alignment and domain information
>PF06810 Phage_GP20: Phage minor structural protein GP20; InterPro: IPR009636 This family consists of several phage minor structural protein Gp20 sequences and prophage sequences of around 180 residues in length Back     alignment and domain information
>PF06810 Phage_GP20: Phage minor structural protein GP20; InterPro: IPR009636 This family consists of several phage minor structural protein Gp20 sequences and prophage sequences of around 180 residues in length Back     alignment and domain information
>KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] Back     alignment and domain information
>PF13863 DUF4200: Domain of unknown function (DUF4200) Back     alignment and domain information
>PF10205 KLRAQ: Predicted coiled-coil domain-containing protein; InterPro: IPR019343 This entry represents a N-terminal 100 residues long domain, which contains a conserved KLRAQ motif Back     alignment and domain information
>PF10267 Tmemb_cc2: Predicted transmembrane and coiled-coil 2 protein; InterPro: IPR019394 This family of transmembrane coiled-coil containing proteins is conserved from worms to humans Back     alignment and domain information
>PF08657 DASH_Spc34: DASH complex subunit Spc34 ; InterPro: IPR013966 The DASH complex is a ~10 subunit microtubule-binding complex that is transferred to the kinetochore prior to mitosis [] Back     alignment and domain information
>KOG4603 consensus TBP-1 interacting protein [Signal transduction mechanisms] Back     alignment and domain information
>PF09738 DUF2051: Double stranded RNA binding protein (DUF2051); InterPro: IPR019139 This entry represents transcriptional repressors which preferentially bind to the GC-rich consensus sequence (5'-AGCCCCCGGCG-3') and may regulate expression of TNF, EGFR and PDGFA Back     alignment and domain information
>PF13870 DUF4201: Domain of unknown function (DUF4201) Back     alignment and domain information
>KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query469
2vpj_A301 Crystal Structure Of The Kelch Domain Of Human Klhl 5e-04
>pdb|2VPJ|A Chain A, Crystal Structure Of The Kelch Domain Of Human Klhl12 Length = 301 Back     alignment and structure

Iteration: 1

Score = 42.7 bits (99), Expect = 5e-04, Method: Compositional matrix adjust. Identities = 48/219 (21%), Positives = 89/219 (40%), Gaps = 17/219 (7%) Query: 64 KLLILGGHYKKSSDSMIVRFIDLETNLCGVMETSGKVPVARGGHSVTLVGSRLIIFGGED 123 ++ ++GG+ +S S V +D + GV + + V RG T +G + + GG D Sbjct: 64 RIYVIGGYDGRSRLSS-VECLDYTADEDGVWYSVAPMNVRRGLAGATTLGDMIYVSGGFD 122 Query: 124 RSRKLLNDVHFLDLETMTWDAVEVTQTPPAPRYDHSAALHANRYLIVFGGCSHSIFFNDL 183 SR+ + + D W + QT + + + A+ + GG N + Sbjct: 123 GSRRHTSMERY-DPNIDQWSMLGDMQTAR----EGAGLVVASGVIYCLGGYDGLNILNSV 177 Query: 184 HVLDLQTNEWSQPEIKGDLVTGRAGHAGITIDENWYIVGGGDNNNGCQETIVLNMTKLAW 243 D T W+ + T R+G ++++ Y+VGG D N+ +W Sbjct: 178 EKYDPHTGHWTNVT---PMATKRSGAGVALLNDHIYVVGGFDGTAHLSSVEAYNIRTDSW 234 Query: 244 SILTSVKGRNPLASEGLSVCSAIIEGEHHLVAFGGYNGK 282 + +TS + + V + ++ G L A GY+G Sbjct: 235 TTVTS------MTTPRCYVGATVLRGR--LYAIAGYDGN 265

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query469
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 1e-41
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 1e-34
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 1e-29
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 9e-29
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 8e-23
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 2e-17
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 2e-14
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 5e-09
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 6e-05
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 7e-22
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 2e-17
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 3e-17
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 3e-16
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 9e-15
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 2e-21
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 4e-20
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 1e-16
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 3e-15
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 3e-21
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 1e-18
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 1e-19
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 6e-16
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 4e-17
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 9e-15
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 1e-15
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 2e-13
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 2e-10
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 4e-04
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 6e-06
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 1e-04
3o0z_A168 RHO-associated protein kinase 1; coiled-coil, tran 8e-06
3o0z_A168 RHO-associated protein kinase 1; coiled-coil, tran 6e-04
3o0z_A168 RHO-associated protein kinase 1; coiled-coil, tran 8e-04
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 2e-05
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 5e-05
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 1e-04
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 2e-04
1c1g_A 284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 5e-04
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 5e-04
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure
 Score =  156 bits (395), Expect = 1e-41
 Identities = 48/282 (17%), Positives = 97/282 (34%), Gaps = 31/282 (10%)

Query: 56  HCMVKWGTKLLILGGHYKKSSDSMIVRFIDLETN---LCGVMETSGKVPVARGGHSVTLV 112
             +   G  +  +GG      + ++   + +  +   +  +  +S +VPVAR  H+ T +
Sbjct: 391 GDVDVAGNDVFYMGGSNPYRVNEILQ--LSIHYDKIDMKNIEVSSSEVPVARMCHTFTTI 448

Query: 113 G--SRLIIFGGEDRSRKLLNDVHFLDLETMTWDAVEVTQTPPAPRYDHSAALHANRYLIV 170
              ++L++ GG     + L+D    D++T  W    + ++    R+ HSA    +  +++
Sbjct: 449 SRNNQLLLIGGRKAPHQGLSDNWIFDMKTREW---SMIKSLSHTRFRHSACSLPDGNVLI 505

Query: 171 FGGCSHSIFFNDLHVLDLQTNEWSQPEIKGDLVTGRAGHAGITIDENW---YIVGGGDNN 227
            GG +       + + ++    +     K +        AG+  D       I+GGG  +
Sbjct: 506 LGGVTEG---PAMLLYNVTEEIFKDVTPKDEFFQNSLVSAGLEFDPVSKQGIILGGGFMD 562

Query: 228 NGC----QETIVLNMTKLAWSILTSVKGRNPLASEGLSVCSAIIEGEHHLVAFGGYNG-- 281
                        +       I    K ++PL     S    I      L+  GG +   
Sbjct: 563 QTTVSDKAIIFKYDAENATEPITVIKKLQHPLFQRYGSQIKYI--TPRKLLIVGGTSPSG 620

Query: 282 --KYNNEVFV-----MRLKPRDIPRPKIFQSPAAAAAAASVT 316
                N +         L    I R          A  + V+
Sbjct: 621 LFDRTNSIISLDPLSETLTSIPISRRIWEDHSLMLAGFSLVS 662


>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Length = 656 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Length = 656 Back     alignment and structure
>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Length = 168 Back     alignment and structure
>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Length = 168 Back     alignment and structure
>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Length = 168 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query469
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 100.0
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 100.0
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 100.0
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 100.0
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 100.0
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 100.0
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 100.0
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 100.0
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 100.0
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 100.0
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 100.0
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 100.0
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 100.0
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 100.0
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 100.0
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 100.0
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 100.0
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 99.97
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 98.48
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 98.37
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 98.36
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 98.22
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 98.01
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 97.96
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 97.85
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 97.82
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 97.79
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 97.76
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 97.68
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 97.67
3jrp_A379 Fusion protein of protein transport protein SEC13 97.62
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 97.57
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 97.56
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 97.52
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 97.49
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 97.49
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 97.49
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 97.46
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 97.45
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 97.44
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 97.4
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 97.39
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 97.37
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 97.31
3v9f_A781 Two-component system sensor histidine kinase/RESP 97.31
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 97.29
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 97.28
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 97.21
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 97.17
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 97.15
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 97.14
3jrp_A379 Fusion protein of protein transport protein SEC13 97.1
4a2l_A795 BT_4663, two-component system sensor histidine kin 97.09
3jro_A 753 Fusion protein of protein transport protein SEC13 97.07
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 97.06
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 96.97
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 96.97
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 96.93
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 96.89
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.85
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 96.83
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 96.82
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 96.79
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 96.75
3ow8_A321 WD repeat-containing protein 61; structural genomi 96.73
3ow8_A321 WD repeat-containing protein 61; structural genomi 96.72
3jro_A 753 Fusion protein of protein transport protein SEC13 96.72
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 96.72
4a2l_A795 BT_4663, two-component system sensor histidine kin 96.7
2ad6_A 571 Methanol dehydrogenase subunit 1; PQQ configuratio 96.69
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 96.68
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 96.65
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 96.63
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 96.59
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 96.57
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 96.56
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 96.54
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 96.53
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 96.52
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 96.52
3v9f_A781 Two-component system sensor histidine kinase/RESP 96.5
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 96.48
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 96.45
4e54_B435 DNA damage-binding protein 2; beta barrel, double 96.39
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 96.37
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 96.36
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 96.36
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 96.34
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 96.32
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 96.31
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 96.31
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 96.3
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 96.29
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 96.29
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 96.27
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 96.27
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 96.23
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 96.21
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 96.19
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 96.16
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 96.14
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 96.12
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 96.11
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 96.11
2pm7_B297 Protein transport protein SEC13, protein transport 96.1
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 96.1
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 96.09
3ott_A758 Two-component system sensor histidine kinase; beta 96.07
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 96.07
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 96.01
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 96.01
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 96.01
3u1c_A101 Tropomyosin alpha-1 chain; anti-parallel coiled co 96.01
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 95.99
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 95.99
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 95.96
2v4h_A110 NF-kappa-B essential modulator; transcription, met 95.95
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 95.95
4g56_B357 MGC81050 protein; protein arginine methyltransfera 95.93
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 95.9
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 95.88
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 95.84
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 95.84
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 95.79
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 95.78
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 95.77
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 95.75
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 95.73
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 95.72
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 95.7
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 95.69
4g56_B357 MGC81050 protein; protein arginine methyltransfera 95.69
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 95.67
1w6s_A 599 Methanol dehydrogenase subunit 1; anisotropic, ele 95.64
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 95.63
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 95.61
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 95.58
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 95.56
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 95.55
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 95.54
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 95.54
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 95.51
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 95.51
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 95.49
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 95.47
3u59_A101 Tropomyosin beta chain; muscle contraction, actin, 95.47
2v66_B111 Nuclear distribution protein NUDE-like 1; structur 95.41
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 95.41
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 95.4
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 95.35
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 95.35
2fxo_A129 Myosin heavy chain, cardiac muscle beta isoform; c 95.35
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 95.32
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 95.31
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 95.3
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 95.28
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 95.28
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 95.17
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 95.17
4e54_B435 DNA damage-binding protein 2; beta barrel, double 95.15
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 95.14
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 95.11
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 95.11
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 95.1
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 95.08
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 95.07
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 95.07
3na7_A256 HP0958; flagellar biogenesis, flagellum export, C4 95.05
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 94.99
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 94.96
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 94.96
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 94.96
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 94.95
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 94.92
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 94.92
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 94.92
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 94.88
3o0z_A168 RHO-associated protein kinase 1; coiled-coil, tran 94.85
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 94.76
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 94.75
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 94.71
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 94.69
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 94.66
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 94.59
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 94.53
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 94.5
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 94.5
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 94.45
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 94.39
3q8t_A96 Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90 94.39
3ju4_A670 Endo-N-acetylneuraminidase; endonf, polysia, high- 94.28
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 94.24
2pm7_B297 Protein transport protein SEC13, protein transport 94.2
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 94.14
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 94.09
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 94.0
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 93.97
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 93.97
1itv_A195 MMP9; adaptive molecular recognition, beta propell 93.91
1qhu_A460 Protein (hemopexin); beta propeller, HAEM binding 93.89
1ic2_A81 Tropomyosin alpha chain, skeletal muscle; alpha-he 93.87
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 93.82
1m1j_B 464 Fibrinogen beta chain; coiled coils, disulfide rin 93.73
2xyi_A430 Probable histone-binding protein CAF1; transcripti 93.69
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 93.68
1pex_A207 Collagenase-3, MMP-13; C-terminal hemopexin-like d 93.57
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 93.52
3cvf_A79 Homer-3, homer protein homolog 3; coiled coil, alt 93.5
2efr_A155 General control protein GCN4 and tropomyosin 1 Al; 93.47
3mq9_A471 Bone marrow stromal antigen 2 fused to maltose-BI 93.47
3cve_A72 Homer protein homolog 1; coiled coil, alternative 93.42
3tnu_A131 Keratin, type I cytoskeletal 14; coiled-coil, stru 93.4
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 93.37
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 93.34
2eqb_B97 RAB guanine nucleotide exchange factor SEC2; coile 93.33
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 93.33
3tnu_B129 Keratin, type II cytoskeletal 5; coiled-coil, stru 93.27
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 93.26
3o0z_A168 RHO-associated protein kinase 1; coiled-coil, tran 93.23
3ol1_A119 Vimentin; structural genomics, PSI-2, protein stru 93.23
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 93.2
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 93.19
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 93.14
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 93.13
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 93.13
2xyi_A430 Probable histone-binding protein CAF1; transcripti 93.1
4gkw_A167 Spindle assembly abnormal protein 6; double helix, 93.04
2k48_A107 Nucleoprotein; viral protein; NMR {Andes virus} 92.9
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 92.88
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 92.85
2i1j_A 575 Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, 92.84
3jsv_C94 NF-kappa-B essential modulator; ubiquitin, coiled- 92.79
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 92.73
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 92.72
2eqb_B97 RAB guanine nucleotide exchange factor SEC2; coile 92.66
2v4h_A110 NF-kappa-B essential modulator; transcription, met 92.47
3nmd_A72 CGMP dependent protein kinase; leucine zipper, coi 92.47
1qhu_A460 Protein (hemopexin); beta propeller, HAEM binding 92.42
1x79_B112 RAB GTPase binding effector protein 1; rabaptin5, 92.36
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 92.33
3ott_A 758 Two-component system sensor histidine kinase; beta 92.31
1flg_A 582 Protein (quinoprotein ethanol dehydrogenase); supe 92.31
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 92.15
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 92.07
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 92.03
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 91.98
2jee_A81 YIIU; FTSZ, septum, coiled-coil, cell division, ce 91.96
3tul_A158 Cell invasion protein SIPB; translocator, type thr 91.95
3ghg_A 562 Fibrinogen alpha chain; triple-stranded coiled coi 91.79
1wt6_A81 Myotonin-protein kinase; coiled-coil, kinase activ 91.74
3c7x_A196 Matrix metalloproteinase-14; membrane protein inte 91.72
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 91.49
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 91.48
2no2_A107 HIP-I, huntingtin-interacting protein 1; clathrin 91.39
4fi5_A113 Nucleoprotein; structural genomics, niaid, nationa 91.39
2ymu_A577 WD-40 repeat protein; unknown function, two domain 91.3
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 91.22
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 91.21
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 91.17
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 91.1
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 90.97
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 90.95
1d7m_A101 Cortexillin I; coiled-coil, coiled-coil trigger si 90.88
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 90.86
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 90.77
2efr_A155 General control protein GCN4 and tropomyosin 1 Al; 90.76
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 90.51
4h22_A103 Leucine-rich repeat flightless-interacting protei; 90.5
1su3_A450 Interstitial collagenase; prodomain, hemopexin dom 90.45
2ic6_A78 Nucleocapsid protein; hantavirus, bunyaviridae, ss 90.28
3bas_A89 Myosin heavy chain, striated muscle/general contro 90.2
3iv1_A78 Tumor susceptibility gene 101 protein; coiled_COIL 89.91
1k32_A 1045 Tricorn protease; protein degradation, substrate g 89.65
2ic9_A96 Nucleocapsid protein; hantavirus, bunyaviridae, ss 89.47
3cvf_A79 Homer-3, homer protein homolog 3; coiled coil, alt 89.36
1gen_A218 Gelatinase A; hydrolase, hemopexin domain, metallo 89.19
3i00_A120 HIP-I, huntingtin-interacting protein 1; transcrip 89.15
3ol1_A119 Vimentin; structural genomics, PSI-2, protein stru 89.09
2xdj_A83 Uncharacterized protein YBGF; unknown function; 1. 88.92
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 88.82
3ghg_A 562 Fibrinogen alpha chain; triple-stranded coiled coi 88.68
2no2_A107 HIP-I, huntingtin-interacting protein 1; clathrin 88.2
3a7p_A152 Autophagy protein 16; coiled-coil, coiled coil, cy 88.16
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 87.91
2ocy_A154 RAB guanine nucleotide exchange factor SEC2; RAB, 87.88
3cve_A72 Homer protein homolog 1; coiled coil, alternative 87.87
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 87.72
1f5n_A592 Interferon-induced guanylate-binding protein 1; GB 87.64
3lay_A175 Zinc resistance-associated protein; salmonella typ 87.58
1x8y_A86 Lamin A/C; structural protein, intermediate filame 87.43
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 87.15
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 87.08
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 87.04
3a7p_A152 Autophagy protein 16; coiled-coil, coiled coil, cy 86.87
3ibp_A 302 Chromosome partition protein MUKB; structural main 86.84
2e7s_A135 RAB guanine nucleotide exchange factor SEC2; coile 86.76
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 86.68
2lw1_A89 ABC transporter ATP-binding protein UUP; ABC REG s 86.53
4emc_A190 Monopolin complex subunit CSM1; RWD domain, kineto 86.52
3k6s_A 1095 Integrin alpha-X; cell receptor, adhesion molecule 86.4
3ba0_A365 Macrophage metalloelastase; FULL-length MMP-12, he 86.39
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 86.08
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 86.08
3q8t_A96 Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90 86.01
3vp9_A92 General transcriptional corepressor TUP1; four hel 85.66
1go4_E100 MAD1 (mitotic arrest deficient)-like 1; mitotic sp 85.61
2oxj_A34 Hybrid alpha/beta peptide based on the GCN4-P1 Se 85.45
3m48_A33 General control protein GCN4; leucine zipper, synt 85.42
3mq7_A121 Bone marrow stromal antigen 2; HIV, antiviral prot 85.19
4dci_A150 Uncharacterized protein; PSI-biology, midwest cent 84.97
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 84.92
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 84.89
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 84.62
2fp8_A322 Strictosidine synthase; six bladed beta propeller 84.58
3c3f_A34 Alpha/beta peptide with the GCN4-PLI SIDE chain S 84.49
1itv_A195 MMP9; adaptive molecular recognition, beta propell 84.33
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 84.27
2yy0_A53 C-MYC-binding protein; conserved hypothetical prot 84.13
1l8d_A112 DNA double-strand break repair RAD50 ATPase; zinc 84.03
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 83.98
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 83.8
2zqm_A117 Prefoldin beta subunit 1; chaperone; HET: CIT; 1.9 83.69
3iox_A 497 AGI/II, PA; alpha helix, PPII helix, supersandwich 83.55
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 83.17
1deb_A54 APC protein, adenomatous polyposis coli protein; c 83.01
3ibp_A 302 Chromosome partition protein MUKB; structural main 82.96
2v66_B111 Nuclear distribution protein NUDE-like 1; structur 82.86
2i1j_A 575 Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, 82.83
3mq9_A471 Bone marrow stromal antigen 2 fused to maltose-BI 82.82
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 82.78
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 82.71
2ece_A462 462AA long hypothetical selenium-binding protein; 82.59
2lw1_A89 ABC transporter ATP-binding protein UUP; ABC REG s 82.59
1lwu_C 323 Fibrinogen gamma chain; heterotrimer, protein-pept 82.58
3qh9_A81 Liprin-beta-2; coiled-coil, dimerization, structur 82.28
1kd8_A36 GABH AIV, GCN4 acid base heterodimer acid-D12IA16V 82.24
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 82.12
2bni_A34 General control protein GCN4; four helix bundle, a 81.96
1uo4_A34 General control protein GCN4; four helix bundle, c 81.88
1kd8_B36 GABH BLL, GCN4 acid base heterodimer base-D12LA16L 81.79
2ece_A462 462AA long hypothetical selenium-binding protein; 81.75
4emc_A190 Monopolin complex subunit CSM1; RWD domain, kineto 81.72
1t6f_A37 Geminin; coiled-coil, cell cycle; 1.47A {Synthetic 81.7
4h22_A103 Leucine-rich repeat flightless-interacting protei; 81.57
3iv1_A78 Tumor susceptibility gene 101 protein; coiled_COIL 81.53
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 81.52
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 81.23
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 81.18
2ocy_A154 RAB guanine nucleotide exchange factor SEC2; RAB, 81.07
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 81.03
3c3g_A33 Alpha/beta peptide with the GCN4-PLI SIDE chain S 80.76
1uix_A71 RHO-associated kinase; coiled-coil, transferase; H 80.74
2fp8_A322 Strictosidine synthase; six bladed beta propeller 80.65
1t3j_A96 Mitofusin 1; coiled coil antiparallel, dimer, memb 80.4
2b9c_A147 Striated-muscle alpha tropomyosin; alpha-helix, co 80.4
1deq_A 390 Fibrinogen (alpha chain); coiled-coil, blood clott 80.34
3i00_A120 HIP-I, huntingtin-interacting protein 1; transcrip 80.28
2xdj_A83 Uncharacterized protein YBGF; unknown function; 1. 80.22
1go4_E100 MAD1 (mitotic arrest deficient)-like 1; mitotic sp 80.15
1k32_A 1045 Tricorn protease; protein degradation, substrate g 80.02
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
Probab=100.00  E-value=1.6e-46  Score=359.53  Aligned_cols=277  Identities=18%  Similarity=0.241  Sum_probs=246.0

Q ss_pred             CEEEcccCCCcccCCceEEEEccCCceeeeeecccccCCccccCCCCCCCCCCcCeeeEEECCEEEEEcccc---CCCCC
Q 012184            1 MLLRCSIRNYTLLEGVVMVFDLRSLAWSNLRLETELDADKTEDSGLLEVLPPMSDHCMVKWGTKLLILGGHY---KKSSD   77 (469)
Q Consensus         1 l~~~GG~~~~~~~~~~~~~~d~~~~~W~~~~~~~~~~~~~~~~~~~~~~p~~r~~~~~~~~~~~iy~~GG~~---~~~~~   77 (469)
                      ||+|||. .+..++ ++++||+.+++|..++++                |.+|.+|++++++++||++||..   .....
T Consensus        27 i~v~GG~-~~~~~~-~~~~~d~~~~~W~~~~~~----------------p~~r~~~~~~~~~~~lyv~GG~~~~~~~~~~   88 (308)
T 1zgk_A           27 IYTAGGY-FRQSLS-YLEAYNPSNGTWLRLADL----------------QVPRSGLAGCVVGGLLYAVGGRNNSPDGNTD   88 (308)
T ss_dssp             EEEECCB-SSSBCC-CEEEEETTTTEEEECCCC----------------SSCCBSCEEEEETTEEEEECCEEEETTEEEE
T ss_pred             EEEEeCc-CCCCcc-eEEEEcCCCCeEeECCCC----------------CcccccceEEEECCEEEEECCCcCCCCCCee
Confidence            6999998 567778 999999999999999776                78999999999999999999984   22335


Q ss_pred             cceEEEEECCCCeEEEeecCCCCCCCCcceEEEEECCEEEEEeccCCCCCccCcEEEEECCCCeEEEeeeCCCCCCCCCC
Q 012184           78 SMIVRFIDLETNLCGVMETSGKVPVARGGHSVTLVGSRLIIFGGEDRSRKLLNDVHFLDLETMTWDAVEVTQTPPAPRYD  157 (469)
Q Consensus        78 ~~~~~~~d~~t~~W~~~~~~g~~p~~r~~~~~~~~~~~lyi~GG~~~~~~~~~~v~~~d~~t~~W~~~~~~g~~p~~r~~  157 (469)
                      .+++++||+.+++|+.++   ++|.+|.+|++++++++||++||..... ..+++++||+.+++|+.++   ++|.+|.+
T Consensus        89 ~~~~~~~d~~~~~W~~~~---~~p~~r~~~~~~~~~~~iyv~GG~~~~~-~~~~~~~yd~~~~~W~~~~---~~p~~r~~  161 (308)
T 1zgk_A           89 SSALDCYNPMTNQWSPCA---PMSVPRNRIGVGVIDGHIYAVGGSHGCI-HHNSVERYEPERDEWHLVA---PMLTRRIG  161 (308)
T ss_dssp             CCCEEEEETTTTEEEECC---CCSSCCBTCEEEEETTEEEEECCEETTE-ECCCEEEEETTTTEEEECC---CCSSCCBS
T ss_pred             cceEEEECCCCCeEeECC---CCCcCccccEEEEECCEEEEEcCCCCCc-ccccEEEECCCCCeEeECC---CCCccccc
Confidence            678999999999999998   7899999999999999999999987643 5889999999999999986   77899999


Q ss_pred             ceEEEEcCcEEEEEecCCCCcccCcEEEEECCCCceEeeeecCCCCCCCcceEEEEECCEEEEEecCCCCCCcceEEEEE
Q 012184          158 HSAALHANRYLIVFGGCSHSIFFNDLHVLDLQTNEWSQPEIKGDLVTGRAGHAGITIDENWYIVGGGDNNNGCQETIVLN  237 (469)
Q Consensus       158 ~~~~~~~~~~l~v~GG~~~~~~~~~i~~~d~~~~~W~~~~~~~~~p~~r~~~~~~~~~~~l~v~GG~~~~~~~~d~~~~d  237 (469)
                      |+++++ +++||+|||.+....++++++||+.+++|+.+.   ++|.+|..|+++.++++|||+||.+.....+++++||
T Consensus       162 ~~~~~~-~~~iyv~GG~~~~~~~~~~~~yd~~~~~W~~~~---~~p~~r~~~~~~~~~~~iyv~GG~~~~~~~~~v~~yd  237 (308)
T 1zgk_A          162 VGVAVL-NRLLYAVGGFDGTNRLNSAECYYPERNEWRMIT---AMNTIRSGAGVCVLHNCIYAAGGYDGQDQLNSVERYD  237 (308)
T ss_dssp             CEEEEE-TTEEEEECCBCSSCBCCCEEEEETTTTEEEECC---CCSSCCBSCEEEEETTEEEEECCBCSSSBCCCEEEEE
T ss_pred             eEEEEE-CCEEEEEeCCCCCCcCceEEEEeCCCCeEeeCC---CCCCccccceEEEECCEEEEEeCCCCCCccceEEEEe
Confidence            999998 778999999987777899999999999999975   7899999999999999999999988777789999999


Q ss_pred             CCCCcEEEeccCCCCCCCCCCCcceEEEEEcCCcEEEEEeccCCC-CCceEEEEECCCCCCCCccccCCCchhhcchh
Q 012184          238 MTKLAWSILTSVKGRNPLASEGLSVCSAIIEGEHHLVAFGGYNGK-YNNEVFVMRLKPRDIPRPKIFQSPAAAAAAAS  314 (469)
Q Consensus       238 ~~~~~W~~~~~~~~~~p~~r~~~s~~~~~~~~~~~l~v~GG~~~~-~~~~~~~~d~~~~~w~~~~~~~~~~~~~~~~~  314 (469)
                      +.+++|+.++.+    |.+|.+|+++..    ++.|||+||.++. ..+++++||+.+++|..+..+|.++..+.+++
T Consensus       238 ~~~~~W~~~~~~----p~~r~~~~~~~~----~~~i~v~GG~~~~~~~~~v~~yd~~~~~W~~~~~~p~~r~~~~~~~  307 (308)
T 1zgk_A          238 VETETWTFVAPM----KHRRSALGITVH----QGRIYVLGGYDGHTFLDSVECYDPDTDTWSEVTRMTSGRSGVGVAV  307 (308)
T ss_dssp             TTTTEEEECCCC----SSCCBSCEEEEE----TTEEEEECCBCSSCBCCEEEEEETTTTEEEEEEECSSCCBSCEEEE
T ss_pred             CCCCcEEECCCC----CCCccceEEEEE----CCEEEEEcCcCCCcccceEEEEcCCCCEEeecCCCCCCcccceeEe
Confidence            999999998754    566788887776    7899999998764 57899999999999999999999888776553



>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>2v4h_A NF-kappa-B essential modulator; transcription, metal-binding, NEMO - IKK gamma - NFKB pathwa darpin, transcription regulation; 2.9A {Mus musculus} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} Back     alignment and structure
>2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
>3q8t_A Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90A {Rattus norvegicus} Back     alignment and structure
>3ju4_A Endo-N-acetylneuraminidase; endonf, polysia, high-resolution, glycosidase, hydrolase; HET: SLB; 0.98A {Enterobacteria phage K1F} PDB: 3gvl_A* 3gvj_A* 3gvk_A* 1v0e_A 1v0f_A* Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>1itv_A MMP9; adaptive molecular recognition, beta propeller, dimer, hydrolase; 1.95A {Homo sapiens} SCOP: b.66.1.1 Back     alignment and structure
>1qhu_A Protein (hemopexin); beta propeller, HAEM binding and transport, iron metabolism, binding protein; HET: HEM; 2.30A {Oryctolagus cuniculus} SCOP: b.66.1.1 b.66.1.1 PDB: 1qjs_A* Back     alignment and structure
>1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1 Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>1m1j_B Fibrinogen beta chain; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: d.171.1.1 h.1.8.1 PDB: 1ei3_B* Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>1pex_A Collagenase-3, MMP-13; C-terminal hemopexin-like domain of matrix- metalloproteinase, metalloprotease; 2.70A {Homo sapiens} SCOP: b.66.1.1 Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3cvf_A Homer-3, homer protein homolog 3; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, phosphoprotein, polymorphism; 2.90A {Homo sapiens} Back     alignment and structure
>2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A Back     alignment and structure
>3mq9_A Bone marrow stromal antigen 2 fused to maltose-BI periplasmic protein; HIV, antiviral protein; 2.80A {Escherichia coli} Back     alignment and structure
>3cve_A Homer protein homolog 1; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, postsynaptic cell membrane, synapse; 1.75A {Rattus norvegicus} Back     alignment and structure
>3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
>2eqb_B RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 2.70A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>4gkw_A Spindle assembly abnormal protein 6; double helix, SAS-5, centriole, structural protein; 3.30A {Caenorhabditis elegans} Back     alignment and structure
>2k48_A Nucleoprotein; viral protein; NMR {Andes virus} Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>2i1j_A Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, ezrin, MER actin binding, masking, regulation, SELF-inhibition, cell A membrane protein; 2.10A {Spodoptera frugiperda} PDB: 2i1k_A 1e5w_A Back     alignment and structure
>3jsv_C NF-kappa-B essential modulator; ubiquitin, coiled-coil, cellular signaling, cytoplasm, isopeptide bond, nucleus, phosphoprotein, UBL conjugation; 2.70A {Mus musculus} PDB: 3f89_A 2zvo_B 2zvn_B Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>2eqb_B RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 2.70A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure
>2v4h_A NF-kappa-B essential modulator; transcription, metal-binding, NEMO - IKK gamma - NFKB pathwa darpin, transcription regulation; 2.9A {Mus musculus} Back     alignment and structure
>3nmd_A CGMP dependent protein kinase; leucine zipper, coiled-coil, structural genomics, berkeley S genomics center, BSGC, dimerization; HET: MSE; 2.27A {Homo sapiens} Back     alignment and structure
>1qhu_A Protein (hemopexin); beta propeller, HAEM binding and transport, iron metabolism, binding protein; HET: HEM; 2.30A {Oryctolagus cuniculus} SCOP: b.66.1.1 b.66.1.1 PDB: 1qjs_A* Back     alignment and structure
>1x79_B RAB GTPase binding effector protein 1; rabaptin5, GGA protein, GAT domain, intracellular trafficking, protein transport; 2.41A {Homo sapiens} SCOP: h.1.27.2 Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} Back     alignment and structure
>3tul_A Cell invasion protein SIPB; translocator, type three secretion system, coiled-coil, VIRU cell invasion; 2.79A {Salmonella enterica subsp} Back     alignment and structure
>3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* Back     alignment and structure
>1wt6_A Myotonin-protein kinase; coiled-coil, kinase activation, DMPK, molecular replacement, transferase; 1.60A {Homo sapiens} Back     alignment and structure
>3c7x_A Matrix metalloproteinase-14; membrane protein interaction, Pro-MMP-2, TIMP-2, metastasis, calcium, cleavage on PAIR of basic residues, hydrolase; 1.70A {Homo sapiens} Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>2no2_A HIP-I, huntingtin-interacting protein 1; clathrin light chain binding, HIP1 coiled-coil domain, endocytosis, clathrin SELF-assembly, cell adhesion; 2.80A {Homo sapiens} Back     alignment and structure
>4fi5_A Nucleoprotein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.20A {Hantaan virus} Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>1d7m_A Cortexillin I; coiled-coil, coiled-coil trigger site, alpha helix, dimeriza contractIle protein; 2.70A {Dictyostelium discoideum} SCOP: h.1.10.1 Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4h22_A Leucine-rich repeat flightless-interacting protei; nucleic acid sensor, transcription; 2.89A {Homo sapiens} Back     alignment and structure
>1su3_A Interstitial collagenase; prodomain, hemopexin domain, exocite, structural proteomics in europe, spine, structural genomics, hydrolase; HET: EPE; 2.20A {Homo sapiens} SCOP: a.20.1.2 b.66.1.1 d.92.1.11 PDB: 2clt_A 1fbl_A* Back     alignment and structure
>2ic6_A Nucleocapsid protein; hantavirus, bunyaviridae, ssRNA negative- strand viruses, antiparallel coiled coil, viral protein; 1.15A {Sin nombre virus} Back     alignment and structure
>3bas_A Myosin heavy chain, striated muscle/general control protein GCN4 chimera; alpha-helical coiled coil, disorder, salt links; 2.30A {Argopecten irradians} SCOP: h.1.26.1 PDB: 1nkn_A 3bat_A Back     alignment and structure
>3iv1_A Tumor susceptibility gene 101 protein; coiled_COIL, tumorigenesis, CELL_cycle regulation, alternative splicing, cell cycle, cell division; HET: MSE; 2.50A {Homo sapiens} Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>2ic9_A Nucleocapsid protein; hantavirus, bunyaviridae, ssRNA negative- strand viruses, antiparallel coiled coil, viral protein; 2.00A {Sin nombre virus} Back     alignment and structure
>3cvf_A Homer-3, homer protein homolog 3; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, phosphoprotein, polymorphism; 2.90A {Homo sapiens} Back     alignment and structure
>1gen_A Gelatinase A; hydrolase, hemopexin domain, metalloprotease, hydrolase (metalloprotease); 2.15A {Homo sapiens} SCOP: b.66.1.1 PDB: 1rtg_A Back     alignment and structure
>3i00_A HIP-I, huntingtin-interacting protein 1; transcription; 2.30A {Homo sapiens} PDB: 2qa7_A Back     alignment and structure
>2xdj_A Uncharacterized protein YBGF; unknown function; 1.82A {Escherichia coli} PDB: 2wz7_A Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* Back     alignment and structure
>2no2_A HIP-I, huntingtin-interacting protein 1; clathrin light chain binding, HIP1 coiled-coil domain, endocytosis, clathrin SELF-assembly, cell adhesion; 2.80A {Homo sapiens} Back     alignment and structure
>3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure
>3cve_A Homer protein homolog 1; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, postsynaptic cell membrane, synapse; 1.75A {Rattus norvegicus} Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Back     alignment and structure
>3lay_A Zinc resistance-associated protein; salmonella typhimurium L structural genomics, center for structural genomics of INFE diseases; 2.70A {Salmonella enterica subsp} Back     alignment and structure
>1x8y_A Lamin A/C; structural protein, intermediate filament protein; 2.20A {Homo sapiens} SCOP: h.1.20.1 PDB: 3v5b_A 3v4w_A 3v4q_A Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3ibp_A Chromosome partition protein MUKB; structural maintenance of chromosomes, SMC, condensin, chromosome segregation, hinge, dimerization domain; 3.10A {Escherichia coli} Back     alignment and structure
>2e7s_A RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 3.00A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>2lw1_A ABC transporter ATP-binding protein UUP; ABC REG subfamily, DNA binding protein; NMR {Escherichia coli} Back     alignment and structure
>4emc_A Monopolin complex subunit CSM1; RWD domain, kinetochore-binding, kinetoch replication-replication complex; 3.05A {Saccharomyces cerevisiae} PDB: 3n7n_A 3n4x_A Back     alignment and structure
>3k6s_A Integrin alpha-X; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_A* 3k72_A* Back     alignment and structure
>3ba0_A Macrophage metalloelastase; FULL-length MMP-12, hemopexin domain, catalytic domain, domain interaction., calcium, extracellular matrix; 3.00A {Homo sapiens} PDB: 2jxy_A Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3q8t_A Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90A {Rattus norvegicus} Back     alignment and structure
>3vp9_A General transcriptional corepressor TUP1; four helix bundle; 1.80A {Saccharomyces cerevisiae} PDB: 3vp8_A Back     alignment and structure
>1go4_E MAD1 (mitotic arrest deficient)-like 1; mitotic spindle checkpoint, cell cycle, mitosis, nuclear Pro; 2.05A {Homo sapiens} SCOP: h.1.22.1 Back     alignment and structure
>2oxj_A Hybrid alpha/beta peptide based on the GCN4-P1 Se heptad positions B and F substituted...; helix bundle, foldamer, unknown function; HET: B3K B3D B3E B3S B3Y B3X B3A BAL; 2.00A {Synthetic} PDB: 2oxk_A* Back     alignment and structure
>3m48_A General control protein GCN4; leucine zipper, synthetic peptide, alpha helix, activa amino-acid biosynthesis, DNA-binding, nucleus; 1.45A {Synthetic} PDB: 3i1g_A 2ahp_A* 2o7h_A Back     alignment and structure
>3mq7_A Bone marrow stromal antigen 2; HIV, antiviral protein; 2.28A {Homo sapiens} PDB: 3mqc_A 3mqb_A 3mkx_A 3nwh_A 2xg7_A* 2x7a_A Back     alignment and structure
>4dci_A Uncharacterized protein; PSI-biology, midwest center for structural genomics, MCSG, S genomics, unknown function; 2.82A {Synechococcus SP} Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>3c3f_A Alpha/beta peptide with the GCN4-PLI SIDE chain S AN (alpha-alpha-alpha-beta) backbone...; helix bundle, foldamer, unknown function, de novo protein; HET: B3K B3D B3E BIL B3L BAL; 2.00A {Synthetic} SCOP: h.1.3.1 Back     alignment and structure
>1itv_A MMP9; adaptive molecular recognition, beta propeller, dimer, hydrolase; 1.95A {Homo sapiens} SCOP: b.66.1.1 Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>2yy0_A C-MYC-binding protein; conserved hypothetical protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.40A {Homo sapiens} Back     alignment and structure
>1l8d_A DNA double-strand break repair RAD50 ATPase; zinc finger, DNA repair, recombination, HOOK motif, replication; HET: DNA CIT; 2.20A {Pyrococcus furiosus} SCOP: h.4.12.1 Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2zqm_A Prefoldin beta subunit 1; chaperone; HET: CIT; 1.90A {Thermococcus SP} PDB: 2zdi_A Back     alignment and structure
>3iox_A AGI/II, PA; alpha helix, PPII helix, supersandwich fold, surface adhesin WALL, peptidoglycan-anchor, cell adhesion; HET: PMS; 1.80A {Streptococcus mutans} PDB: 3ipk_A* 1jmm_A Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>1deb_A APC protein, adenomatous polyposis coli protein; coiled coil, tumor suppressor, structural protein; 2.40A {Homo sapiens} SCOP: h.1.18.1 Back     alignment and structure
>3ibp_A Chromosome partition protein MUKB; structural maintenance of chromosomes, SMC, condensin, chromosome segregation, hinge, dimerization domain; 3.10A {Escherichia coli} Back     alignment and structure
>2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens} Back     alignment and structure
>2i1j_A Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, ezrin, MER actin binding, masking, regulation, SELF-inhibition, cell A membrane protein; 2.10A {Spodoptera frugiperda} PDB: 2i1k_A 1e5w_A Back     alignment and structure
>3mq9_A Bone marrow stromal antigen 2 fused to maltose-BI periplasmic protein; HIV, antiviral protein; 2.80A {Escherichia coli} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>2lw1_A ABC transporter ATP-binding protein UUP; ABC REG subfamily, DNA binding protein; NMR {Escherichia coli} Back     alignment and structure
>1lwu_C Fibrinogen gamma chain; heterotrimer, protein-peptide complex, blood clotting; HET: NDG MAN NAG BMA GAL; 2.80A {Petromyzon marinus} SCOP: d.171.1.1 h.1.8.1 PDB: 1n73_C* Back     alignment and structure
>3qh9_A Liprin-beta-2; coiled-coil, dimerization, structural protein; 2.01A {Homo sapiens} Back     alignment and structure
>1kd8_A GABH AIV, GCN4 acid base heterodimer acid-D12IA16V; coiled coil heterodimer, de novo protein; 1.90A {Synthetic} SCOP: h.1.3.1 PDB: 1kdd_A 1kd9_A Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>2bni_A General control protein GCN4; four helix bundle, antiparallel four helix bundle acyl transferase; HET: TYZ; 1.5A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 2ccn_A 1w5k_A* 2ccf_A 2cce_A 1w5j_A* 1uo2_A 1gcl_A 1uo1_A 1unv_A 1uo0_A 1unt_A 1uo5_A 1unz_A 1unx_A 1unu_A 1unw_A 1uo4_A 1uo3_A 1uny_A 1u9f_A* ... Back     alignment and structure
>1uo4_A General control protein GCN4; four helix bundle, cavity, iodobenzene; 1.70A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1uo3_A 1unt_A 1uo5_A 1unu_A 1unv_A 1uo1_A 2ccf_A 2cce_A 1unx_A 1unw_A 1w5j_A* 1w5k_A* 1u9f_A* 3f86_A* 3f87_A* 3hez_A* 3c3f_A* Back     alignment and structure
>1kd8_B GABH BLL, GCN4 acid base heterodimer base-D12LA16L; coiled coil heterodimer, de novo protein; 1.90A {Synthetic} SCOP: h.1.3.1 PDB: 1kd9_B 1kdd_B Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>4emc_A Monopolin complex subunit CSM1; RWD domain, kinetochore-binding, kinetoch replication-replication complex; 3.05A {Saccharomyces cerevisiae} PDB: 3n7n_A 3n4x_A Back     alignment and structure
>1t6f_A Geminin; coiled-coil, cell cycle; 1.47A {Synthetic} SCOP: h.1.28.1 Back     alignment and structure
>4h22_A Leucine-rich repeat flightless-interacting protei; nucleic acid sensor, transcription; 2.89A {Homo sapiens} Back     alignment and structure
>3iv1_A Tumor susceptibility gene 101 protein; coiled_COIL, tumorigenesis, CELL_cycle regulation, alternative splicing, cell cycle, cell division; HET: MSE; 2.50A {Homo sapiens} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3c3g_A Alpha/beta peptide with the GCN4-PLI SIDE chain S AN (alpha-alpha-beta) backbone; helix bundle, foldamer, unknown function protein; HET: HMR B3Q B3D B3E B3L BIL B3K BAL GOL; 1.80A {Synthetic} PDB: 3heu_A* 3het_A* 3hev_A* 3hew_A* 3hey_A* 3hex_A* 3c3h_A* Back     alignment and structure
>1uix_A RHO-associated kinase; coiled-coil, transferase; HET: MSE; 1.80A {Bos taurus} SCOP: h.1.27.1 Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>1t3j_A Mitofusin 1; coiled coil antiparallel, dimer, membrane protein; 2.50A {Mus musculus} SCOP: h.4.16.1 Back     alignment and structure
>2b9c_A Striated-muscle alpha tropomyosin; alpha-helix, coiled coil, alanine, axial stagger, radius, SIDE-chain packing, crystal packing; 2.30A {Rattus norvegicus} SCOP: h.1.5.1 Back     alignment and structure
>3i00_A HIP-I, huntingtin-interacting protein 1; transcription; 2.30A {Homo sapiens} PDB: 2qa7_A Back     alignment and structure
>2xdj_A Uncharacterized protein YBGF; unknown function; 1.82A {Escherichia coli} PDB: 2wz7_A Back     alignment and structure
>1go4_E MAD1 (mitotic arrest deficient)-like 1; mitotic spindle checkpoint, cell cycle, mitosis, nuclear Pro; 2.05A {Homo sapiens} SCOP: h.1.22.1 Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 469
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 6e-10
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 8e-09
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 2e-08
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 1e-07
d1k3ia3387 b.69.1.1 (A:151-537) Galactose oxidase, central do 2e-06
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure

class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: Kelch motif
family: Kelch motif
domain: Kelch-like ECH-associated protein 1, KEAP1
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 57.6 bits (137), Expect = 6e-10
 Identities = 31/160 (19%), Positives = 52/160 (32%), Gaps = 12/160 (7%)

Query: 51  PPMSDHCMVKWGTKLLILGGHYKKSSDSMIVRFIDLETNLCGVMETSGKVPVARGGHSVT 110
                  +      L  +GG    +  +    +         +          R G  V 
Sbjct: 137 TRRIGVGVAVLNRLLYAVGGFDGTNRLNSAECYYPERNEWRMITAM----NTIRSGAGVC 192

Query: 111 LVGSRLIIFGGEDRSRKLLNDVHFLDLETMTWDAVEVTQTPPAPRYDHSAALHANRYLIV 170
           ++ + +   GG D  +  LN V   D+ET TW            R      +H  R + V
Sbjct: 193 VLHNCIYAAGGYDG-QDQLNSVERYDVETETWT---FVAPMKHRRSALGITVHQGR-IYV 247

Query: 171 FGGCSHSIFFNDLHVLDLQTNEWSQPEIKGDLVTGRAGHA 210
            GG     F + +   D  T+ WS+      + +GR+G  
Sbjct: 248 LGGYDGHTFLDSVECYDPDTDTWSE---VTRMTSGRSGVG 284


>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query469
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 100.0
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 100.0
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 99.96
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 99.93
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 97.07
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 96.96
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 96.53
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 96.46
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 96.14
d1su3a2195 Collagenase (MMP1), C-terminal domain {Human (Homo 96.11
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 95.94
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 95.8
d1pexa_192 Collagenase-3 (MMP-13), C-terminal domain {Human ( 95.74
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 95.71
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 95.7
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 95.59
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 95.49
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 95.39
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 95.19
d1itva_195 Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 95.13
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 95.1
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 95.1
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 95.03
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 94.77
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 94.66
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 94.65
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 94.35
d1tbga_340 beta1-subunit of the signal-transducing G protein 94.17
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 94.13
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 94.03
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 93.96
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 92.68
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 92.49
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 92.02
d1tbga_340 beta1-subunit of the signal-transducing G protein 91.71
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 91.23
d1v0ea1516 Endo-alpha-sialidase {Bacteriophage K1F [TaxId: 34 90.97
d1pexa_192 Collagenase-3 (MMP-13), C-terminal domain {Human ( 90.97
d1v0ea1516 Endo-alpha-sialidase {Bacteriophage K1F [TaxId: 34 90.9
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 90.81
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 90.5
d1gena_200 Gelatinase A (MMP-2), C-terminal domain {Human (Ho 89.68
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 89.49
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 89.47
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 89.4
d1qhua1192 Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 89.09
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 87.93
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 87.61
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 87.49
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 87.47
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 87.44
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 86.86
d1fxka_107 Prefoldin beta subunit {Archaeon Methanobacterium 86.05
d1qfma1430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 85.89
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 85.69
d2ad6a1 571 Methanol dehydrogenase, heavy chain {Methylophilus 84.59
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 84.52
d1itva_195 Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 84.12
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 83.5
d1flga_ 582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 82.26
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: Kelch motif
family: Kelch motif
domain: Kelch-like ECH-associated protein 1, KEAP1
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=8.9e-42  Score=320.61  Aligned_cols=277  Identities=18%  Similarity=0.245  Sum_probs=244.0

Q ss_pred             CEEEcccCCCcccCCceEEEEccCCceeeeeecccccCCccccCCCCCCCCCCcCeeeEEECCEEEEEccccCC---CCC
Q 012184            1 MLLRCSIRNYTLLEGVVMVFDLRSLAWSNLRLETELDADKTEDSGLLEVLPPMSDHCMVKWGTKLLILGGHYKK---SSD   77 (469)
Q Consensus         1 l~~~GG~~~~~~~~~~~~~~d~~~~~W~~~~~~~~~~~~~~~~~~~~~~p~~r~~~~~~~~~~~iy~~GG~~~~---~~~   77 (469)
                      ||||||... ..++ ++++||+.+++|+.++++                |.+|.+|++++++++||++||....   ...
T Consensus         7 iyv~GG~~~-~~~~-~~~~yd~~t~~W~~~~~~----------------p~~R~~~~~~~~~~~iyv~GG~~~~~~~~~~   68 (288)
T d1zgka1           7 IYTAGGYFR-QSLS-YLEAYNPSNGTWLRLADL----------------QVPRSGLAGCVVGGLLYAVGGRNNSPDGNTD   68 (288)
T ss_dssp             EEEECCBSS-SBCC-CEEEEETTTTEEEECCCC----------------SSCCBSCEEEEETTEEEEECCEEEETTEEEE
T ss_pred             EEEECCcCC-CCCc-eEEEEECCCCeEEECCCC----------------CCccceeEEEEECCEEEEEeCcccCCCCccc
Confidence            699999864 5688 999999999999999876                7889999999999999999997543   225


Q ss_pred             cceEEEEECCCCeEEEeecCCCCCCCCcceEEEEECCEEEEEeccCCCCCccCcEEEEECCCCeEEEeeeCCCCCCCCCC
Q 012184           78 SMIVRFIDLETNLCGVMETSGKVPVARGGHSVTLVGSRLIIFGGEDRSRKLLNDVHFLDLETMTWDAVEVTQTPPAPRYD  157 (469)
Q Consensus        78 ~~~~~~~d~~t~~W~~~~~~g~~p~~r~~~~~~~~~~~lyi~GG~~~~~~~~~~v~~~d~~t~~W~~~~~~g~~p~~r~~  157 (469)
                      ++++++||+.+++|+.++   ++|.+|.+|++++++++||++||..... ..+.++.||+.+..|....   .++.+|.+
T Consensus        69 ~~~~~~yd~~~~~w~~~~---~~p~~r~~~~~~~~~~~i~~~gg~~~~~-~~~~~~~~~~~~~~~~~~~---~~~~~r~~  141 (288)
T d1zgka1          69 SSALDCYNPMTNQWSPCA---PMSVPRNRIGVGVIDGHIYAVGGSHGCI-HHNSVERYEPERDEWHLVA---PMLTRRIG  141 (288)
T ss_dssp             CCCEEEEETTTTEEEECC---CCSSCCBTCEEEEETTEEEEECCEETTE-ECCCEEEEETTTTEEEECC---CCSSCCBS
T ss_pred             cchhhhcccccccccccc---cccceecceeccccceeeEEecceeccc-ccceeeeeccccCcccccc---cccccccc
Confidence            678999999999999998   8899999999999999999999987654 6888999999999998875   67789999


Q ss_pred             ceEEEEcCcEEEEEecCCCCcccCcEEEEECCCCceEeeeecCCCCCCCcceEEEEECCEEEEEecCCCCCCcceEEEEE
Q 012184          158 HSAALHANRYLIVFGGCSHSIFFNDLHVLDLQTNEWSQPEIKGDLVTGRAGHAGITIDENWYIVGGGDNNNGCQETIVLN  237 (469)
Q Consensus       158 ~~~~~~~~~~l~v~GG~~~~~~~~~i~~~d~~~~~W~~~~~~~~~p~~r~~~~~~~~~~~l~v~GG~~~~~~~~d~~~~d  237 (469)
                      |+++.+ ++.+|++||.......++++.||+.+++|....   ..+.++..|+++.++++++++||.+....+++++.||
T Consensus       142 ~~~~~~-~~~~~~~GG~~~~~~~~~~~~~d~~~~~~~~~~---~~~~~~~~~~~~~~~~~i~i~GG~~~~~~~~~~~~~~  217 (288)
T d1zgka1         142 VGVAVL-NRLLYAVGGFDGTNRLNSAECYYPERNEWRMIT---AMNTIRSGAGVCVLHNCIYAAGGYDGQDQLNSVERYD  217 (288)
T ss_dssp             CEEEEE-TTEEEEECCBCSSCBCCCEEEEETTTTEEEECC---CCSSCCBSCEEEEETTEEEEECCBCSSSBCCCEEEEE
T ss_pred             ceeeee-eecceEecCcccccccceEEEeecccccccccc---ccccccccccccceeeeEEEecCccccccccceeeee
Confidence            999988 667999999987778889999999999999864   6678889999999999999999998888889999999


Q ss_pred             CCCCcEEEeccCCCCCCCCCCCcceEEEEEcCCcEEEEEeccCCC-CCceEEEEECCCCCCCCccccCCCchhhcchh
Q 012184          238 MTKLAWSILTSVKGRNPLASEGLSVCSAIIEGEHHLVAFGGYNGK-YNNEVFVMRLKPRDIPRPKIFQSPAAAAAAAS  314 (469)
Q Consensus       238 ~~~~~W~~~~~~~~~~p~~r~~~s~~~~~~~~~~~l~v~GG~~~~-~~~~~~~~d~~~~~w~~~~~~~~~~~~~~~~~  314 (469)
                      +.+..|..++++    |.+|.+|+++.+    +++|||+||.++. ..+++++||+.+++|..+..+|.++..+++++
T Consensus       218 ~~~~~~~~~~~~----p~~r~~~~~~~~----~~~l~v~GG~~~~~~~~~v~~yd~~~~~W~~~~~~p~~R~~~~~~~  287 (288)
T d1zgka1         218 VETETWTFVAPM----KHRRSALGITVH----QGRIYVLGGYDGHTFLDSVECYDPDTDTWSEVTRMTSGRSGVGVAV  287 (288)
T ss_dssp             TTTTEEEECCCC----SSCCBSCEEEEE----TTEEEEECCBCSSCBCCEEEEEETTTTEEEEEEECSSCCBSCEEEE
T ss_pred             ecceeeecccCc----cCcccceEEEEE----CCEEEEEecCCCCeecceEEEEECCCCEEEECCCCCCCcEeEEEEE
Confidence            999999998654    566888888776    7899999998764 67889999999999999999999988876553



>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1su3a2 b.66.1.1 (A:271-465) Collagenase (MMP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pexa_ b.66.1.1 (A:) Collagenase-3 (MMP-13), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1itva_ b.66.1.1 (A:) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1v0ea1 b.68.1.2 (A:245-760) Endo-alpha-sialidase {Bacteriophage K1F [TaxId: 344021]} Back     information, alignment and structure
>d1pexa_ b.66.1.1 (A:) Collagenase-3 (MMP-13), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v0ea1 b.68.1.2 (A:245-760) Endo-alpha-sialidase {Bacteriophage K1F [TaxId: 344021]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1gena_ b.66.1.1 (A:) Gelatinase A (MMP-2), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1qhua1 b.66.1.1 (A:24-215) Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1fxka_ a.2.5.1 (A:) Prefoldin beta subunit {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1itva_ b.66.1.1 (A:) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure