Citrus Sinensis ID: 012198
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 468 | ||||||
| 255580106 | 700 | map3k delta-1 protein kinase, putative [ | 0.952 | 0.637 | 0.559 | 1e-128 | |
| 296090398 | 758 | unnamed protein product [Vitis vinifera] | 0.944 | 0.583 | 0.552 | 1e-127 | |
| 225449728 | 767 | PREDICTED: serine/threonine-protein kina | 0.944 | 0.576 | 0.552 | 1e-127 | |
| 224113505 | 765 | serine/threonine protein kinase 4, CTR4 | 0.935 | 0.572 | 0.496 | 1e-122 | |
| 255575367 | 871 | map3k delta-1 protein kinase, putative [ | 0.944 | 0.507 | 0.493 | 1e-109 | |
| 384979221 | 845 | CTR1 [Fragaria x ananassa] | 0.927 | 0.513 | 0.504 | 1e-108 | |
| 237857405 | 843 | serine/threonine protein kinase [Prunus | 0.916 | 0.508 | 0.502 | 1e-108 | |
| 114229343 | 843 | ethylene control element variant [Malus | 0.920 | 0.511 | 0.495 | 1e-107 | |
| 114229341 | 843 | ethylene control element variant [Malus | 0.920 | 0.511 | 0.497 | 1e-107 | |
| 224068980 | 821 | serine/threonine protein kinase 1, CTR1 | 0.910 | 0.518 | 0.495 | 1e-107 |
| >gi|255580106|ref|XP_002530885.1| map3k delta-1 protein kinase, putative [Ricinus communis] gi|223529538|gb|EEF31491.1| map3k delta-1 protein kinase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 466 bits (1198), Expect = e-128, Method: Compositional matrix adjust.
Identities = 263/470 (55%), Positives = 332/470 (70%), Gaps = 24/470 (5%)
Query: 11 EMAPCKSWAQQTEESYQLQLAMALRLSSQAASADDPHFLALSSCDR--------HTDSAE 62
+ A W QQTEESYQLQLA+ALRLSSQAA A+D +FL S D ++SAE
Sbjct: 15 QTATFSRWVQQTEESYQLQLALALRLSSQAALANDSNFLDFKSNDHDHYHQLSSSSNSAE 74
Query: 63 TVSHRFWVNGCLSYFDRILDGFYLIHGMDPYTWSIGTNQRDAGLIPPYKSLKAVDPCNNL 122
+VSHRFWVNGCLSY+DRI DGFY+IHG+DPY W+I +Q+D GLIP ++SLKA+DP ++L
Sbjct: 75 SVSHRFWVNGCLSYYDRIPDGFYVIHGVDPYAWTISIDQKDIGLIPSFESLKALDPRDDL 134
Query: 123 SIKVILIDKSSDPNLKELHNRVLSLLCDRITAEEAVHQLANLVCNHMGGTTSTEEEEFDK 182
S+ V+LID+ DP LKEL NRV+ L + IT ++A+ QLA+LVCN MGG TSTE+ FD
Sbjct: 135 SVNVVLIDRFRDPGLKELSNRVIKLSSNWITTKDAIDQLADLVCNRMGGVTSTEQNTFDM 194
Query: 183 QWSECAEHLKDCLNSVVLPIGSLSVGLCVHRALLFKVLADLINLPCRIAKGCKYCRRDDA 242
W EC E L++ L SVVLPIG+L VGLCVHRALLFKVLAD INLPCRIAKGCK+CRRD A
Sbjct: 195 CWKECTEILRNRLGSVVLPIGNLPVGLCVHRALLFKVLADSINLPCRIAKGCKHCRRDVA 254
Query: 243 SSCLVQIGPDREYLVDLLEDPGVLSKPDSSLNRTASVFVSSPLYHPRFKAVETVENIRSL 302
+SCLVQ+G +REYLVDL PG LS+PDSSLNRT+S+ VSSPL HP FK+++T +++R+L
Sbjct: 255 ASCLVQVGSEREYLVDLFGKPGTLSQPDSSLNRTSSILVSSPLSHPSFKSLQTADDLRTL 314
Query: 303 AKLYFIDNHSPKFDLDDDPSGTAIDQDYK------PDPQALFQRASWNVTADRDLQMQNP 356
AK +FID+ DD PSGT IDQD K D + L +S + A ++
Sbjct: 315 AKHFFIDSQLLNLAFDDTPSGT-IDQDDKNSKTVIKDNKNLIPNSSNSHDASTPPLLKRV 373
Query: 357 SGPST-----HVIDSSNFIKGP----LLRSPVKPFRHRKSHETSAFSTLKPYVTNNHLLM 407
+G T H ++SS+ +L +P P HR + S S KP TNN L +
Sbjct: 374 AGNITNASGLHAVNSSSKSNSLSKDLILPNPALPIMHRDPYSISVTSNPKPDATNNQLFL 433
Query: 408 EANLSVMSTSNRELYLEEEGLEIRWSELLIKKKIGEGSFGTVYHAEWRNS 457
+AN S +S S+ EL+LEEE L+I WSEL+IK+KIGEGSFGTV+ A+WR S
Sbjct: 434 DANQSFVSRSSSELHLEEEDLDIPWSELVIKEKIGEGSFGTVHRADWRGS 483
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|296090398|emb|CBI40217.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|225449728|ref|XP_002267382.1| PREDICTED: serine/threonine-protein kinase CTR1-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224113505|ref|XP_002316514.1| serine/threonine protein kinase 4, CTR4 [Populus trichocarpa] gi|222865554|gb|EEF02685.1| serine/threonine protein kinase 4, CTR4 [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255575367|ref|XP_002528586.1| map3k delta-1 protein kinase, putative [Ricinus communis] gi|223531982|gb|EEF33794.1| map3k delta-1 protein kinase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|384979221|gb|AFI38955.1| CTR1 [Fragaria x ananassa] | Back alignment and taxonomy information |
|---|
| >gi|237857405|gb|ACR23642.1| serine/threonine protein kinase [Prunus persica] | Back alignment and taxonomy information |
|---|
| >gi|114229343|gb|ABI58290.1| ethylene control element variant [Malus x domestica] | Back alignment and taxonomy information |
|---|
| >gi|114229341|gb|ABI58289.1| ethylene control element variant [Malus x domestica] | Back alignment and taxonomy information |
|---|
| >gi|224068980|ref|XP_002326245.1| serine/threonine protein kinase 1, CTR1 [Populus trichocarpa] gi|222833438|gb|EEE71915.1| serine/threonine protein kinase 1, CTR1 [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 468 | ||||||
| TAIR|locus:2144613 | 821 | CTR1 "CONSTITUTIVE TRIPLE RESP | 0.777 | 0.443 | 0.507 | 7.4e-103 | |
| TAIR|locus:2027794 | 1030 | AT1G73660 [Arabidopsis thalian | 0.570 | 0.259 | 0.343 | 1.4e-40 | |
| TAIR|locus:2025515 | 933 | EDR1 "ENHANCED DISEASE RESISTA | 0.521 | 0.261 | 0.350 | 6e-40 | |
| TAIR|locus:2143009 | 880 | AT5G11850 [Arabidopsis thalian | 0.504 | 0.268 | 0.35 | 3.1e-39 | |
| TAIR|locus:2194055 | 992 | AT1G18160 [Arabidopsis thalian | 0.544 | 0.257 | 0.352 | 5e-39 | |
| MGI|MGI:1918132 | 881 | Armc3 "armadillo repeat contai | 0.245 | 0.130 | 0.36 | 2.8e-08 | |
| UNIPROTKB|E1C8F9 | 876 | E1C8F9 "Uncharacterized protei | 0.273 | 0.146 | 0.326 | 3.8e-07 | |
| TAIR|locus:2052786 | 775 | AT2G31010 [Arabidopsis thalian | 0.534 | 0.322 | 0.254 | 0.00069 |
| TAIR|locus:2144613 CTR1 "CONSTITUTIVE TRIPLE RESPONSE 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 914 (326.8 bits), Expect = 7.4e-103, Sum P(2) = 7.4e-103
Identities = 197/388 (50%), Positives = 256/388 (65%)
Query: 16 KSWAQQTEESYQLQLAMALRLSSQAASADDPHFLAL----SSCDRHTDSAETVSHRFWVN 71
KSWAQQTEESYQLQLA+ALRLSS+A ADDP+FL S+ SAETVSHRFWVN
Sbjct: 159 KSWAQQTEESYQLQLALALRLSSEATCADDPNFLDPVPDESALRTSPSSAETVSHRFWVN 218
Query: 72 GCLSYFDRILDGFYLIHGMDPYTWSIGTNQRDAGLIPPYKSLKAVDPCNNLSIKVILIDK 131
GCLSY+D++ DGFY+++G+DPY W++ + ++G IP +SL+AVD + S++ I++D+
Sbjct: 219 GCLSYYDKVPDGFYMMNGLDPYIWTLCIDLHESGRIPSIESLRAVDSGVDSSLEAIIVDR 278
Query: 132 SSDPNLKELHNRVLSLLCDRITAEEAVHQLANLVCNHMGGTTSTEEEEFDKQWSECAEHL 191
SDP KELHNRV + C IT +E V QLA L+CN MGG E+E W EC + L
Sbjct: 279 RSDPAFKELHNRVHDISCSCITTKEVVDQLAKLICNRMGGPVIMGEDELVPMWKECIDGL 338
Query: 192 KDCLNSVVLPIGSLSVGLCVHRALLFKVLADLINLPCRIAKGCKYCRRDDASSCLVQIGP 251
K+ VV+PIGSLSVGLC HRALLFKVLAD+I+LPCRIAKGCKYC RDDA+SCLV+ G
Sbjct: 339 KEIFK-VVVPIGSLSVGLCRHRALLFKVLADIIDLPCRIAKGCKYCNRDDAASCLVRFGL 397
Query: 252 DREYLVDLLEDPGVLSKPDSSLNRTASVFVSSPLYHPRFKAVETVENIRSLAKLYFIDNH 311
DREYLVDL+ PG L +PDS LN +S+ +SSPL PR K VE + R LAK YF D+
Sbjct: 398 DREYLVDLVGKPGHLWEPDSLLNGPSSISISSPLRFPRPKPVEPAVDFRLLAKQYFSDSQ 457
Query: 312 SPKFDLDDDPSGTAIDQDYKPDPQALFQRASWNVTADRDLQMQNPSG--------PSTHV 363
S +L DP+ D + ++F R N + D +N G P ++
Sbjct: 458 S--LNLVFDPASD--DMGF-----SMFHRQYDNPGGENDALAENGGGSLPPSANMPPQNM 508
Query: 364 IDSSNFIKG-PLLRSPV-KPFRHRKSHE 389
+ +SN I+ P+ P+ +P +R + E
Sbjct: 509 MRASNQIEAAPMNAPPISQPVPNRANRE 536
|
|
| TAIR|locus:2027794 AT1G73660 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2025515 EDR1 "ENHANCED DISEASE RESISTANCE 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2143009 AT5G11850 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2194055 AT1G18160 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1918132 Armc3 "armadillo repeat containing 3" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1C8F9 E1C8F9 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2052786 AT2G31010 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00034993001 | SubName- Full=Chromosome chr13 scaffold_74, whole genome shotgun sequence; (755 aa) | |||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 468 | |||
| pfam14381 | 203 | pfam14381, EDR1, Ethylene-responsive protein kinas | 9e-92 |
| >gnl|CDD|222722 pfam14381, EDR1, Ethylene-responsive protein kinase Le-CTR1 | Back alignment and domain information |
|---|
Score = 276 bits (709), Expect = 9e-92
Identities = 105/210 (50%), Positives = 133/210 (63%), Gaps = 10/210 (4%)
Query: 59 DSAETVSHRFWVNGCLSYFDRILDGFYLIHGMDPYTWSIGTNQRDAGLIPPYKSLKAVDP 118
SAE +SHR+WV GCLSY D+I DGFY I+GMDP + ++ G IP + L+AV P
Sbjct: 2 SSAEALSHRYWVYGCLSYDDKIPDGFYDIYGMDPCSDL-----KEFGRIPSLEDLQAVPP 56
Query: 119 CNNLSIKVILIDKSSDPNLKELHNRVLSLLCDRITA-EEAVHQLANLVCNHMGGTTSTEE 177
+ S +V+L+D+ +DP LKEL L+ T V +LA LV +HMGG E
Sbjct: 57 -GDSSFEVVLVDRRTDPKLKELEQLARCLVSGCGTNTAALVQKLAGLVSDHMGGPVKDAE 115
Query: 178 EEFDKQWSECAEHLKDCLNSVVLPIGSLSVGLCVHRALLFKVLADLINLPCRIAKGCKYC 237
+ W EC+ LK+ NS V+P+GSL +GLC HRALLFKVLAD I LPCR+ KGCKYC
Sbjct: 116 SMLAR-WKECSNELKE--NSGVVPLGSLKIGLCRHRALLFKVLADSIGLPCRLVKGCKYC 172
Query: 238 RRDDASSCLVQIGPDREYLVDLLEDPGVLS 267
DD +S LV+ REYLVDL+ PG L
Sbjct: 173 GSDDDASNLVKFDDGREYLVDLMGAPGTLI 202
|
EDR1 regulates disease resistance and ethylene-induced senescence, and is also involved in stress response signalling and cell death regulation. Length = 203 |
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 468 | |||
| PF14381 | 204 | EDR1: Ethylene-responsive protein kinase Le-CTR1 | 100.0 | |
| KOG0193 | 678 | consensus Serine/threonine protein kinase RAF [Sig | 99.18 | |
| KOG0192 | 362 | consensus Tyrosine kinase specific for activated ( | 97.81 | |
| KOG2052 | 513 | consensus Activin A type IB receptor, serine/threo | 97.76 | |
| smart00460 | 68 | TGc Transglutaminase/protease-like homologues. Tra | 97.74 | |
| PF01841 | 113 | Transglut_core: Transglutaminase-like superfamily; | 97.41 | |
| cd05107 | 401 | PTKc_PDGFR_beta Catalytic domain of the Protein Ty | 97.32 | |
| COG5279 | 521 | CYK3 Uncharacterized protein involved in cytokines | 97.17 | |
| KOG0197 | 468 | consensus Tyrosine kinases [Signal transduction me | 97.12 | |
| cd05104 | 375 | PTKc_Kit Catalytic domain of the Protein Tyrosine | 97.0 | |
| cd05105 | 400 | PTKc_PDGFR_alpha Catalytic domain of the Protein T | 96.58 | |
| cd05106 | 374 | PTKc_CSF-1R Catalytic domain of the Protein Tyrosi | 96.43 | |
| KOG0199 | 1039 | consensus ACK and related non-receptor tyrosine ki | 95.7 | |
| KOG0194 | 474 | consensus Protein tyrosine kinase [Signal transduc | 95.51 | |
| PLN03225 | 566 | Serine/threonine-protein kinase SNT7; Provisional | 94.67 | |
| PLN03224 | 507 | probable serine/threonine protein kinase; Provisio | 94.62 | |
| PLN00034 | 353 | mitogen-activated protein kinase kinase; Provision | 94.53 | |
| cd05055 | 302 | PTKc_PDGFR Catalytic domain of the Protein Tyrosin | 94.36 | |
| PTZ00426 | 340 | cAMP-dependent protein kinase catalytic subunit; P | 93.99 | |
| KOG3653 | 534 | consensus Transforming growth factor beta/activin | 93.79 | |
| PTZ00284 | 467 | protein kinase; Provisional | 93.77 | |
| KOG4278 | 1157 | consensus Protein tyrosine kinase [Signal transduc | 93.68 | |
| KOG4257 | 974 | consensus Focal adhesion tyrosine kinase FAK, cont | 93.4 | |
| KOG4721 | 904 | consensus Serine/threonine protein kinase, contain | 93.25 | |
| KOG1187 | 361 | consensus Serine/threonine protein kinase [Signal | 93.0 | |
| COG1305 | 319 | Transglutaminase-like enzymes, putative cysteine p | 92.88 | |
| cd05596 | 370 | STKc_ROCK Catalytic domain of the Protein Serine/T | 92.44 | |
| PTZ00036 | 440 | glycogen synthase kinase; Provisional | 91.85 | |
| KOG1095 | 1025 | consensus Protein tyrosine kinase [Signal transduc | 91.65 | |
| cd05622 | 371 | STKc_ROCK1 Catalytic domain of the Protein Serine/ | 91.23 | |
| cd05621 | 370 | STKc_ROCK2 Catalytic domain of the Protein Serine/ | 91.19 | |
| PTZ00283 | 496 | serine/threonine protein kinase; Provisional | 90.74 | |
| KOG1026 | 774 | consensus Nerve growth factor receptor TRKA and re | 89.87 | |
| KOG1025 | 1177 | consensus Epidermal growth factor receptor EGFR an | 89.61 | |
| KOG1094 | 807 | consensus Discoidin domain receptor DDR1 [Signal t | 89.47 | |
| KOG0196 | 996 | consensus Tyrosine kinase, EPH (ephrin) receptor f | 89.19 | |
| KOG0983 | 391 | consensus Mitogen-activated protein kinase (MAPK) | 89.11 | |
| KOG4258 | 1025 | consensus Insulin/growth factor receptor (contains | 88.67 | |
| KOG0200 | 609 | consensus Fibroblast/platelet-derived growth facto | 87.93 | |
| KOG0694 | 694 | consensus Serine/threonine protein kinase [Signal | 87.6 | |
| PRK09605 | 535 | bifunctional UGMP family protein/serine/threonine | 86.67 | |
| PHA03209 | 357 | serine/threonine kinase US3; Provisional | 86.31 | |
| PHA03207 | 392 | serine/threonine kinase US3; Provisional | 84.65 | |
| PHA03210 | 501 | serine/threonine kinase US3; Provisional | 84.23 | |
| cd06635 | 317 | STKc_TAO1 Catalytic domain of the Protein Serine/T | 83.18 | |
| KOG0663 | 419 | consensus Protein kinase PITSLRE and related kinas | 83.11 | |
| KOG4236 | 888 | consensus Serine/threonine protein kinase PKC mu/P | 82.74 | |
| KOG0667 | 586 | consensus Dual-specificity tyrosine-phosphorylatio | 81.11 | |
| KOG0605 | 550 | consensus NDR and related serine/threonine kinases | 80.57 |
| >PF14381 EDR1: Ethylene-responsive protein kinase Le-CTR1 | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.5e-72 Score=536.46 Aligned_cols=200 Identities=52% Similarity=0.867 Sum_probs=188.6
Q ss_pred CcHHHHHHHHHhcCcccCCCCCCCceeeeecCCcccccccc-cc-cCCCCCCChhcccccCCCCCCceeEEEecCCCCcc
Q 012198 59 DSAETVSHRFWVNGCLSYFDRILDGFYLIHGMDPYTWSIGT-NQ-RDAGLIPPYKSLKAVDPCNNLSIKVILIDKSSDPN 136 (468)
Q Consensus 59 ~~ae~lS~ryW~~g~L~y~DkI~DGFYdI~g~dp~~w~~~~-dl-~~~grmPSL~~L~a~~~~~~~s~EVILVDr~~D~~ 136 (468)
+++|++|+|||++|+|+|+||||||||||+|++ |+ ++ .+++|||||++|+++++. ++++|||||||+.|+.
T Consensus 1 ~~~e~lS~r~W~~~~L~y~dki~DGFYdi~g~~------~~~~l~~~~~~~Psl~~L~~~~~~-~~~~EvIlVDr~~D~~ 73 (204)
T PF14381_consen 1 SSAESLSHRYWVNGCLSYDDKIPDGFYDIYGMD------CTNSLKEEFGRMPSLEDLQAVPPD-DSSREVILVDRRRDPS 73 (204)
T ss_pred CcHHHHHHHHHHcCCCCCCCcCCCCCcccccCC------CccccccccCCCCCHHHHhcCCCC-CCCeeEEEEccccCHH
Confidence 478999999999999999999999999999996 74 66 589999999999999855 9999999999999999
Q ss_pred HHHHHHHHHHHHcccc-CHHHHHHHHHHHHHhhcCCCCCCchhhhhHHHHHHHHHHHhhhCCeEEEeccccccchhhhHH
Q 012198 137 LKELHNRVLSLLCDRI-TAEEAVHQLANLVCNHMGGTTSTEEEEFDKQWSECAEHLKDCLNSVVLPIGSLSVGLCVHRAL 215 (468)
Q Consensus 137 L~~L~~~a~~l~~~l~-~~~~~v~~LA~lVad~MGG~v~~~~~~l~~~w~~~~~eLK~~l~S~ViPIG~Lk~GlcRHRAL 215 (468)
|++|+++|+++++++. ++++++++||+|||++|||++..++ ....+|++++.+||. +++++|||+|++|+||||||
T Consensus 74 L~~L~~~a~~~~~~~~~~~~~~v~~LA~lVa~~MGG~~~~~~-~~~~~w~~~s~~lk~--~s~~vplG~l~~G~~rhRAL 150 (204)
T PF14381_consen 74 LKELEQRAHELSKGLSTNTKELVQKLAKLVADRMGGPVSDAE-DMLFRWELRSEKLKE--NSGVVPLGSLRIGLCRHRAL 150 (204)
T ss_pred HHHHHHHHHHHHhccccCHHHHHHHHHHHHHHHhCCCCCcch-hhhHHHHHHHHHHHh--CCCeEEEeeecccchHHHHH
Confidence 9999999999999998 6999999999999999999998544 444599998888988 89999999999999999999
Q ss_pred HHHHHhhhcCCCceEeccccccCC-CCCcceEEEeCCCeeEEEeCCCCCCcccC
Q 012198 216 LFKVLADLINLPCRIAKGCKYCRR-DDASSCLVQIGPDREYLVDLLEDPGVLSK 268 (468)
Q Consensus 216 LFKvLAD~IGLPCrLVRG~~Y~~~-dd~a~~lVk~~~~reYIVDLM~~PG~Li~ 268 (468)
|||||||+||||||||||++||+. ++.++|+|++++++|||||||++||+|+|
T Consensus 151 LFKvLAD~iglpCrLvrG~~y~g~~~~~a~~~V~~~~~~eyiVDLm~~PG~L~P 204 (204)
T PF14381_consen 151 LFKVLADRIGLPCRLVRGCYYCGWDDDDASNLVKFDDGREYIVDLMGAPGQLIP 204 (204)
T ss_pred HHHHHHHhcCCCceEEeeccCCccCCCCceEEEEcCCCcEEEEEcCCCCCCcCC
Confidence 999999999999999999999999 89999999999999999999999999997
|
|
| >KOG0193 consensus Serine/threonine protein kinase RAF [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0192 consensus Tyrosine kinase specific for activated (GTP-bound) p21cdc42Hs [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2052 consensus Activin A type IB receptor, serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >smart00460 TGc Transglutaminase/protease-like homologues | Back alignment and domain information |
|---|
| >PF01841 Transglut_core: Transglutaminase-like superfamily; InterPro: IPR002931 This domain is found in many proteins known to have transglutaminase activity, i | Back alignment and domain information |
|---|
| >cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta | Back alignment and domain information |
|---|
| >COG5279 CYK3 Uncharacterized protein involved in cytokinesis, contains TGc (transglutaminase/protease-like) domain [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0197 consensus Tyrosine kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit | Back alignment and domain information |
|---|
| >cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha | Back alignment and domain information |
|---|
| >cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor | Back alignment and domain information |
|---|
| >KOG0199 consensus ACK and related non-receptor tyrosine kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0194 consensus Protein tyrosine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN03225 Serine/threonine-protein kinase SNT7; Provisional | Back alignment and domain information |
|---|
| >PLN03224 probable serine/threonine protein kinase; Provisional | Back alignment and domain information |
|---|
| >PLN00034 mitogen-activated protein kinase kinase; Provisional | Back alignment and domain information |
|---|
| >cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors | Back alignment and domain information |
|---|
| >PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional | Back alignment and domain information |
|---|
| >KOG3653 consensus Transforming growth factor beta/activin receptor subfamily of serine/threonine kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PTZ00284 protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG4278 consensus Protein tyrosine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4257 consensus Focal adhesion tyrosine kinase FAK, contains FERM domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4721 consensus Serine/threonine protein kinase, contains leucine zipper domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1187 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG1305 Transglutaminase-like enzymes, putative cysteine proteases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase | Back alignment and domain information |
|---|
| >PTZ00036 glycogen synthase kinase; Provisional | Back alignment and domain information |
|---|
| >KOG1095 consensus Protein tyrosine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 | Back alignment and domain information |
|---|
| >cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 | Back alignment and domain information |
|---|
| >PTZ00283 serine/threonine protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG1026 consensus Nerve growth factor receptor TRKA and related tyrosine kinases [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG1025 consensus Epidermal growth factor receptor EGFR and related tyrosine kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1094 consensus Discoidin domain receptor DDR1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0196 consensus Tyrosine kinase, EPH (ephrin) receptor family [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0983 consensus Mitogen-activated protein kinase (MAPK) kinase MKK7/JNKK2 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4258 consensus Insulin/growth factor receptor (contains protein kinase domain) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0200 consensus Fibroblast/platelet-derived growth factor receptor and related receptor tyrosine kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0694 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK09605 bifunctional UGMP family protein/serine/threonine protein kinase; Validated | Back alignment and domain information |
|---|
| >PHA03209 serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >PHA03207 serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >PHA03210 serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 | Back alignment and domain information |
|---|
| >KOG0663 consensus Protein kinase PITSLRE and related kinases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4236 consensus Serine/threonine protein kinase PKC mu/PKD and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0667 consensus Dual-specificity tyrosine-phosphorylation regulated kinase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0605 consensus NDR and related serine/threonine kinases [General function prediction only] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 468 | ||||
| 3p86_A | 309 | Crystal Structure Of Ctr1 Kinase Domain Mutant D676 | 3e-04 | ||
| 3ppz_A | 309 | Crystal Structure Of Ctr1 Kinase Domain In Complex | 3e-04 |
| >pdb|3P86|A Chain A, Crystal Structure Of Ctr1 Kinase Domain Mutant D676n In Complex With Staurosporine Length = 309 | Back alignment and structure |
|
| >pdb|3PPZ|A Chain A, Crystal Structure Of Ctr1 Kinase Domain In Complex With Staurosporine Length = 309 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 468 | |||
| 2y4i_B | 319 | KSR2, HKSR2, kinase suppressor of RAS 2; transfera | 1e-09 | |
| 3p86_A | 309 | Serine/threonine-protein kinase CTR1; ETR1, ERS1, | 7e-09 | |
| 3og7_A | 289 | AKAP9-BRAF fusion protein; proto-oncogene, V600E, | 1e-08 | |
| 3lb7_A | 307 | RAF proto-oncogene serine/threonine-protein kinas; | 1e-08 | |
| 3dtc_A | 271 | Mitogen-activated protein kinase kinase kinase 9; | 2e-08 | |
| 2eva_A | 307 | TAK1 kinase - TAB1 chimera fusion protein; transfe | 1e-07 | |
| 3s95_A | 310 | LIMK-1, LIM domain kinase 1; structural genomics, | 1e-07 | |
| 3kmu_A | 271 | ILK, integrin-linked kinase; cell adhesion, ANK re | 3e-07 | |
| 4f0f_A | 287 | Serine/threonine-protein kinase ROCO4; LRRK2, ATP- | 6e-07 | |
| 3mdy_A | 337 | Bone morphogenetic protein receptor type-1B; compl | 3e-06 | |
| 3g2f_A | 336 | Bone morphogenetic protein receptor type-2; kinase | 5e-06 | |
| 2pvf_A | 334 | Fibroblast growth factor receptor 2; kinase domain | 7e-06 | |
| 3brb_A | 313 | Proto-oncogene tyrosine-protein kinase MER; ATP-bi | 8e-06 | |
| 3tt0_A | 382 | Basic fibroblast growth factor receptor 1; kinase | 9e-06 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-05 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-05 | |
| 2psq_A | 370 | Fibroblast growth factor receptor 2; kinase domain | 1e-05 | |
| 1b6c_B | 342 | TGF-B superfamily receptor type I; complex (isomer | 3e-05 | |
| 3qup_A | 323 | Tyrosine-protein kinase receptor TYRO3; protein ki | 3e-05 | |
| 3soc_A | 322 | Activin receptor type-2A; structural genomics cons | 4e-05 | |
| 1p4o_A | 322 | Insulin-like growth factor I receptor protein; IGF | 8e-05 | |
| 3c1x_A | 373 | Hepatocyte growth factor receptor; receptor tyrosi | 1e-04 | |
| 1fvr_A | 327 | Tyrosine-protein kinase TIE-2; tyrosine kinase, tr | 1e-04 | |
| 3sxs_A | 268 | Cytoplasmic tyrosine-protein kinase BMX; transfera | 1e-04 | |
| 3t9t_A | 267 | Tyrosine-protein kinase ITK/TSK; kinase domain, al | 1e-04 | |
| 3f66_A | 298 | Hepatocyte growth factor receptor; C-Met, protein | 2e-04 | |
| 1rjb_A | 344 | FL cytokine receptor; kinase, structure, autoinhib | 2e-04 | |
| 3v5q_A | 297 | NT-3 growth factor receptor; kinase domain, kinase | 2e-04 | |
| 2j0j_A | 656 | Focal adhesion kinase 1; cell migration, FERM, tra | 2e-04 | |
| 2ivs_A | 314 | Proto-oncogene tyrosine-protein kinase receptor RE | 2e-04 | |
| 1byg_A | 278 | CSK, protein (C-terminal SRC kinase); protein kina | 2e-04 | |
| 3gen_A | 283 | Tyrosine-protein kinase BTK; bruton'S tyrosine kin | 2e-04 | |
| 3gxj_A | 303 | TGF-beta receptor type-1; ALK5, kinase, inhibitor, | 3e-04 | |
| 3cc6_A | 281 | Protein tyrosine kinase 2 beta; focal adhesion kin | 3e-04 | |
| 1t46_A | 313 | HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom | 3e-04 | |
| 4aoj_A | 329 | High affinity nerve growth factor receptor; transf | 4e-04 | |
| 3kex_A | 325 | Receptor tyrosine-protein kinase ERBB-3; kinase do | 4e-04 | |
| 1k9a_A | 450 | Carboxyl-terminal SRC kinase; COOH-terminal SRC ki | 4e-04 | |
| 1fmk_A | 452 | C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros | 4e-04 | |
| 4fvq_A | 289 | Tyrosine-protein kinase JAK2; janus protein kinase | 5e-04 | |
| 3q4u_A | 301 | Activin receptor type-1; structural genomics conso | 5e-04 | |
| 3lzb_A | 327 | Epidermal growth factor receptor; epidermal growth | 5e-04 | |
| 3zzw_A | 289 | Tyrosine-protein kinase transmembrane receptor RO; | 5e-04 | |
| 1luf_A | 343 | Muscle-specific tyrosine kinase receptor MUSK; pho | 6e-04 | |
| 1qpc_A | 279 | LCK kinase; alpha beta fold, transferase; HET: PTR | 6e-04 | |
| 2yfx_A | 327 | Tyrosine-protein kinase receptor; nucleotide-bindi | 6e-04 | |
| 2xir_A | 316 | Vascular endothelial growth factor receptor 2; ang | 6e-04 | |
| 1qcf_A | 454 | Haematopoetic cell kinase (HCK); tyrosine kinase-i | 6e-04 | |
| 3kfa_A | 288 | Tyrosine-protein kinase ABL1; CML, drug resistance | 8e-04 | |
| 3lxl_A | 327 | Tyrosine-protein kinase JAK3; TYK2, inflammation, | 8e-04 | |
| 2h8h_A | 535 | Proto-oncogene tyrosine-protein kinase SRC; SRC ki | 8e-04 |
| >2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Length = 319 | Back alignment and structure |
|---|
Score = 58.1 bits (141), Expect = 1e-09
Identities = 20/58 (34%), Positives = 30/58 (51%), Gaps = 2/58 (3%)
Query: 403 NHLLMEANLSVMSTSNRELYLEEEGLEIRWSELLIKKKIGEGSFGTVYHAEWRNSVSI 460
N L+ A S ++L+E +I + +L I + IG+G FG VYH W V+I
Sbjct: 5 NLSLLSARSFPRKASQTSIFLQE--WDIPFEQLEIGELIGKGRFGQVYHGRWHGEVAI 60
|
| >3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Length = 309 | Back alignment and structure |
|---|
| >3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} PDB: 3c4c_A* 3c4d_A* 3idp_A* 3ii5_A* 3d4q_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 2fb8_A* 4dbn_A* 1uwj_A* 1uwh_A* 3q96_A* Length = 289 | Back alignment and structure |
|---|
| >3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} Length = 271 | Back alignment and structure |
|---|
| >2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Length = 307 | Back alignment and structure |
|---|
| >3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Length = 310 | Back alignment and structure |
|---|
| >3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} PDB: 3kmw_A* 3rep_A* Length = 271 | Back alignment and structure |
|---|
| >4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Length = 287 | Back alignment and structure |
|---|
| >3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} Length = 337 | Back alignment and structure |
|---|
| >3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Length = 336 | Back alignment and structure |
|---|
| >2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Length = 334 | Back alignment and structure |
|---|
| >3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Length = 313 | Back alignment and structure |
|---|
| >3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Length = 382 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Length = 370 | Back alignment and structure |
|---|
| >1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Length = 342 | Back alignment and structure |
|---|
| >3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Length = 323 | Back alignment and structure |
|---|
| >3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 2qlu_A* Length = 322 | Back alignment and structure |
|---|
| >1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Length = 322 | Back alignment and structure |
|---|
| >3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Length = 373 | Back alignment and structure |
|---|
| >1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Length = 327 | Back alignment and structure |
|---|
| >3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} PDB: 3sxr_A* Length = 268 | Back alignment and structure |
|---|
| >3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Length = 267 | Back alignment and structure |
|---|
| >3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 3q6w_A* 3r7o_A* 3q6u_A* 3cth_A* 3ce3_A* 3ctj_A* ... Length = 298 | Back alignment and structure |
|---|
| >1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Length = 344 | Back alignment and structure |
|---|
| >3v5q_A NT-3 growth factor receptor; kinase domain, kinase, phosphorylation, transferase-transfer inhibitor complex; HET: 0F4; 2.20A {Homo sapiens} Length = 297 | Back alignment and structure |
|---|
| >2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Length = 656 | Back alignment and structure |
|---|
| >2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Length = 314 | Back alignment and structure |
|---|
| >1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Length = 278 | Back alignment and structure |
|---|
| >3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Length = 283 | Back alignment and structure |
|---|
| >3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Length = 281 | Back alignment and structure |
|---|
| >1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Length = 313 | Back alignment and structure |
|---|
| >4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Length = 329 | Back alignment and structure |
|---|
| >3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Length = 325 | Back alignment and structure |
|---|
| >1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Length = 450 | Back alignment and structure |
|---|
| >1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Length = 452 | Back alignment and structure |
|---|
| >4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Length = 289 | Back alignment and structure |
|---|
| >3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Length = 301 | Back alignment and structure |
|---|
| >3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Length = 327 | Back alignment and structure |
|---|
| >3zzw_A Tyrosine-protein kinase transmembrane receptor RO; transferase, neurotrophic tyrosine kinase, receptor-related NTRKR2; 2.90A {Homo sapiens} Length = 289 | Back alignment and structure |
|---|
| >1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Length = 343 | Back alignment and structure |
|---|
| >1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Length = 279 | Back alignment and structure |
|---|
| >2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Length = 327 | Back alignment and structure |
|---|
| >2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Length = 316 | Back alignment and structure |
|---|
| >1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Length = 454 | Back alignment and structure |
|---|
| >3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Length = 288 | Back alignment and structure |
|---|
| >3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 3pjc_A* 1yvj_A* Length = 327 | Back alignment and structure |
|---|
| >2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Length = 535 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 468 | |||
| 3omv_A | 307 | RAF proto-oncogene serine/threonine-protein kinas; | 98.63 | |
| 4ase_A | 353 | Vascular endothelial growth factor receptor 2; tra | 98.27 | |
| 4gt4_A | 308 | Tyrosine-protein kinase transmembrane receptor RO; | 98.03 | |
| 4aoj_A | 329 | High affinity nerve growth factor receptor; transf | 97.84 | |
| 2y4i_B | 319 | KSR2, HKSR2, kinase suppressor of RAS 2; transfera | 97.61 | |
| 3lb7_A | 307 | RAF proto-oncogene serine/threonine-protein kinas; | 97.43 | |
| 3p86_A | 309 | Serine/threonine-protein kinase CTR1; ETR1, ERS1, | 97.4 | |
| 1fmk_A | 452 | C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros | 97.34 | |
| 2h8h_A | 535 | Proto-oncogene tyrosine-protein kinase SRC; SRC ki | 97.28 | |
| 1k9a_A | 450 | Carboxyl-terminal SRC kinase; COOH-terminal SRC ki | 97.11 | |
| 1qcf_A | 454 | Haematopoetic cell kinase (HCK); tyrosine kinase-i | 97.1 | |
| 3isr_A | 293 | Transglutaminase-like enzymes, putative cysteine; | 97.08 | |
| 3cbl_A | 377 | C-FES, proto-oncogene tyrosine-protein kinase FES/ | 97.03 | |
| 1rjb_A | 344 | FL cytokine receptor; kinase, structure, autoinhib | 96.97 | |
| 1mqb_A | 333 | Ephrin type-A receptor 2; tyrosine protein kinase, | 96.9 | |
| 3tt0_A | 382 | Basic fibroblast growth factor receptor 1; kinase | 96.9 | |
| 2xir_A | 316 | Vascular endothelial growth factor receptor 2; ang | 96.89 | |
| 1opk_A | 495 | P150, C-ABL, proto-oncogene tyrosine-protein kinas | 96.86 | |
| 2i1m_A | 333 | Macrophage colony-stimulating factor 1 receptor; k | 96.84 | |
| 2pvf_A | 334 | Fibroblast growth factor receptor 2; kinase domain | 96.81 | |
| 3l9p_A | 367 | Anaplastic lymphoma kinase; kinase domain, ATP-bin | 96.74 | |
| 1p4o_A | 322 | Insulin-like growth factor I receptor protein; IGF | 96.72 | |
| 2psq_A | 370 | Fibroblast growth factor receptor 2; kinase domain | 96.66 | |
| 4g3f_A | 336 | NF-kappa-beta-inducing kinase; non-RD kinase, prot | 96.56 | |
| 3kd4_A | 506 | Putative protease; structural genomics, joint cent | 96.54 | |
| 3brb_A | 313 | Proto-oncogene tyrosine-protein kinase MER; ATP-bi | 96.43 | |
| 1luf_A | 343 | Muscle-specific tyrosine kinase receptor MUSK; pho | 96.37 | |
| 3fpq_A | 290 | Serine/threonine-protein kinase WNK1; protein seri | 96.26 | |
| 4fih_A | 346 | Serine/threonine-protein kinase PAK 4; kinase doma | 96.23 | |
| 3an0_A | 340 | Dual specificity mitogen-activated protein kinase; | 96.14 | |
| 3kul_A | 325 | Ephrin type-A receptor 8; ATP-binding, kinase, nuc | 96.09 | |
| 2yfx_A | 327 | Tyrosine-protein kinase receptor; nucleotide-bindi | 96.07 | |
| 3dzo_A | 413 | Rhoptry kinase domain; parasitic disease, transfer | 96.01 | |
| 2f4m_A | 295 | Peptide N-glycanase; glycoproteins, ubiquitin-depe | 95.9 | |
| 2dyl_A | 318 | Dual specificity mitogen-activated protein kinase | 95.89 | |
| 3ll6_A | 337 | Cyclin G-associated kinase; transferase, protein k | 95.86 | |
| 3e7e_A | 365 | HBUB1, BUB1A, mitotic checkpoint serine/threonine- | 95.85 | |
| 3c1x_A | 373 | Hepatocyte growth factor receptor; receptor tyrosi | 95.84 | |
| 2w4o_A | 349 | Calcium/calmodulin-dependent protein kinase type I | 95.78 | |
| 4fie_A | 423 | Serine/threonine-protein kinase PAK 4; kinase doma | 95.74 | |
| 4aw0_A | 311 | HPDK1, 3-phosphoinositide-dependent protein kinase | 95.65 | |
| 3byv_A | 377 | Rhoptry kinase; malaria, transferase, structural g | 95.56 | |
| 3op5_A | 364 | Serine/threonine-protein kinase VRK1; adenosine tr | 95.43 | |
| 2ozo_A | 613 | Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t | 95.43 | |
| 4b99_A | 398 | Mitogen-activated protein kinase 7; transferase, i | 95.41 | |
| 2j0j_A | 656 | Focal adhesion kinase 1; cell migration, FERM, tra | 95.34 | |
| 3q60_A | 371 | ROP5B; pseudokinase, transferase; HET: ATP; 1.72A | 95.32 | |
| 3mdy_A | 337 | Bone morphogenetic protein receptor type-1B; compl | 95.26 | |
| 4fl3_A | 635 | Tyrosine-protein kinase SYK; transferase; HET: ANP | 95.25 | |
| 4aw2_A | 437 | Serine/threonine-protein kinase MRCK alpha; transf | 95.25 | |
| 1fvr_A | 327 | Tyrosine-protein kinase TIE-2; tyrosine kinase, tr | 95.24 | |
| 2qol_A | 373 | Ephrin receptor; receptor tyrosine kinase, juxtame | 95.15 | |
| 3lxp_A | 318 | Non-receptor tyrosine-protein kinase TYK2; JAK3, i | 94.97 | |
| 3a99_A | 320 | Proto-oncogene serine/threonine-protein kinase PI; | 94.93 | |
| 1b6c_B | 342 | TGF-B superfamily receptor type I; complex (isomer | 94.93 | |
| 3v8s_A | 410 | RHO-associated protein kinase 1; dimerization, myo | 94.85 | |
| 4dc2_A | 396 | Protein kinase C IOTA type; kinase, substrate, cel | 94.75 | |
| 2buj_A | 317 | Serine/threonine-protein kinase 16; transferase, A | 94.74 | |
| 3cek_A | 313 | Dual specificity protein kinase TTK; HMPS1, PYT, E | 94.72 | |
| 3llt_A | 360 | Serine/threonine kinase-1, pflammer; lammer kinase | 94.65 | |
| 3p1a_A | 311 | MYT1 kinase, membrane-associated tyrosine- and thr | 94.63 | |
| 3f66_A | 298 | Hepatocyte growth factor receptor; C-Met, protein | 94.6 | |
| 4ejn_A | 446 | RAC-alpha serine/threonine-protein kinase; AKT1, a | 94.54 | |
| 3pfq_A | 674 | PKC-B, PKC-beta, protein kinase C beta type; phosp | 94.48 | |
| 3eqc_A | 360 | Dual specificity mitogen-activated protein kinase; | 94.46 | |
| 1vzo_A | 355 | Ribosomal protein S6 kinase alpha 5; protein kinas | 94.44 | |
| 3uim_A | 326 | Brassinosteroid insensitive 1-associated receptor; | 94.43 | |
| 2w1i_A | 326 | JAK2; chromosomal rearrangement, nucleotide-bindin | 94.3 | |
| 2r5t_A | 373 | Serine/threonine-protein kinase SGK1; AGC protein | 94.27 | |
| 2vd5_A | 412 | DMPK protein; serine/threonine-protein kinase, kin | 94.23 | |
| 4exu_A | 371 | Mitogen-activated protein kinase 13; P38 kinase, t | 94.12 | |
| 3nsz_A | 330 | CK II alpha, casein kinase II subunit alpha; inhib | 94.01 | |
| 3rp9_A | 458 | Mitogen-activated protein kinase; structural genom | 93.93 | |
| 2jii_A | 352 | Serine/threonine-protein kinase VRK3 molecule: VA | 93.84 | |
| 3hko_A | 345 | Calcium/calmodulin-dependent protein kinase with d | 93.83 | |
| 3v5w_A | 689 | G-protein coupled receptor kinase 2; inhibitor com | 93.82 | |
| 2vx3_A | 382 | Dual specificity tyrosine-phosphorylation- regula | 93.75 | |
| 2iwi_A | 312 | Serine/threonine-protein kinase PIM-2; nucleotide- | 93.73 | |
| 3i6u_A | 419 | CDS1, serine/threonine-protein kinase CHK2; Ser/Th | 93.7 | |
| 3uqc_A | 286 | Probable conserved transmembrane protein; structur | 93.58 | |
| 1wak_A | 397 | Serine/threonine-protein kinase SPRK1; SRPK, trans | 93.55 | |
| 2nru_A | 307 | Interleukin-1 receptor-associated kinase 4; inhibi | 93.54 | |
| 1zth_A | 258 | RIO1 serine protein kinase; ribosome biogenesis, r | 93.54 | |
| 2fst_X | 367 | Mitogen-activated protein kinase 14; active mutant | 93.53 | |
| 3com_A | 314 | Serine/threonine-protein kinase 4; MST1, STE20-lik | 93.52 | |
| 2v62_A | 345 | Serine/threonine-protein kinase VRK2; transferase, | 93.49 | |
| 2zmd_A | 390 | Dual specificity protein kinase TTK; MPS1, T686A, | 93.31 | |
| 3uto_A | 573 | Twitchin; kinase, muscle sarcomere, transferase; H | 93.26 | |
| 1j1b_A | 420 | Glycogen synthase kinase-3 beta; complex, TAU, AMP | 93.26 | |
| 4aaa_A | 331 | Cyclin-dependent kinase-like 2; transferase, phosp | 93.17 | |
| 1rdq_E | 350 | PKA C-alpha, CAMP-dependent protein kinase, alpha- | 93.14 | |
| 3kvw_A | 429 | DYRK2, dual specificity tyrosine-phosphorylation-r | 93.11 | |
| 2pml_X | 348 | PFPK7, Ser/Thr protein kinase; phosphorylati trans | 92.98 | |
| 2c30_A | 321 | Serine/threonine-protein kinase PAK 6; CRIB domain | 92.74 | |
| 2wqm_A | 310 | Serine/threonine-protein kinase NEK7; ATP-binding, | 92.73 | |
| 3n9x_A | 432 | Phosphotransferase; malaria kinase, structural gen | 92.7 | |
| 1zar_A | 282 | RIO2 kinase; serine kinase, winged-helix, RIO doma | 92.5 | |
| 2bdw_A | 362 | Hypothetical protein K11E8.1D; kinase, calmodulin | 92.25 | |
| 2qkw_B | 321 | Protein kinase; three-helix bundle motif, AVRPTO-P | 92.13 | |
| 1t4h_A | 290 | Serine/threonine-protein kinase WNK1; protein seri | 92.01 | |
| 3gbz_A | 329 | Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- | 91.91 | |
| 3qyz_A | 364 | Mitogen-activated protein kinase 1; transferase, s | 91.87 | |
| 2y7j_A | 365 | Phosphorylase B kinase gamma catalytic chain, test | 91.85 | |
| 3gni_B | 389 | Strad alpha; kinase fold, pseudokinase, alpha heli | 91.78 | |
| 1cm8_A | 367 | Phosphorylated MAP kinase P38-gamma; phosphorylati | 91.75 | |
| 1u5q_A | 348 | Serine/threonine protein kinase TAO2; transferase; | 91.6 | |
| 3q5i_A | 504 | Protein kinase; CDPK, malaria, phosphotransferase, | 91.58 | |
| 3fhr_A | 336 | MAP kinase-activated protein kinase 3; kinase-inhi | 91.52 | |
| 2xrw_A | 371 | Mitogen-activated protein kinase 8; transcription, | 91.47 | |
| 1kob_A | 387 | Twitchin; kinase, intrasteric regulation; 2.30A {A | 91.32 | |
| 3c4z_A | 543 | Rhodopsin kinase; Ser/Thr kinase, RGS homology dom | 91.16 | |
| 3lij_A | 494 | Calcium/calmodulin dependent protein kinase with A | 91.03 | |
| 2x4f_A | 373 | Myosin light chain kinase family member 4; LUNG, b | 90.98 | |
| 3lm5_A | 327 | Serine/threonine-protein kinase 17B; STK17B, serin | 90.98 | |
| 2acx_A | 576 | G protein-coupled receptor kinase 6; GRK, G transf | 90.96 | |
| 3ttj_A | 464 | Mitogen-activated protein kinase 10; JNK3, protein | 90.78 | |
| 4e7w_A | 394 | Glycogen synthase kinase 3; GSK3, PTyr195, transfe | 90.58 | |
| 1nxk_A | 400 | MAP kinase-activated protein kinase 2; MK2, phosph | 90.53 | |
| 2owb_A | 335 | Serine/threonine-protein kinase PLK1; catalytic do | 90.14 | |
| 3nyv_A | 484 | Calmodulin-domain protein kinase 1; serine/threoni | 89.97 | |
| 1x3z_A | 335 | Peptide: N-glycanase; hydrolase-hydrolase inhibito | 89.72 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 89.52 | |
| 2h34_A | 309 | Serine/threonine-protein kinase PKNE; apoenzyme, t | 89.42 | |
| 4gyi_A | 397 | RIO2 kinase; protein kinase, ADP complex, phosphoa | 86.25 | |
| 3en9_A | 540 | Glycoprotease, O-sialoglycoprotein endopeptidase/p | 85.32 | |
| 2d3g_P | 26 | Ubiquitin interacting motif from hepatocyte growth | 82.55 | |
| 1g0d_A | 695 | Protein-glutamine gamma-glutamyltransferase; tissu | 82.06 | |
| 2q3z_A | 687 | Transglutaminase 2; transglutaminase 2, tissue tra | 81.26 | |
| 1ex0_A | 731 | Coagulation factor XIII A chain; transglutaminase, | 80.26 |
| >3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
Probab=98.63 E-value=1.2e-08 Score=100.79 Aligned_cols=41 Identities=37% Similarity=0.721 Sum_probs=37.9
Q ss_pred ccceeecCcceeeeeEecccceeeEEEEEeeCceeEEEeee
Q 012198 425 EEGLEIRWSELLIKKKIGEGSFGTVYHAEWRNSVSIFFFSI 465 (468)
Q Consensus 425 ~~~weI~~~eL~l~e~IGsG~FGtVyrg~W~G~vaVk~~~~ 465 (468)
...|||++++|+++++||+|+||+||+|+|++++|||+++.
T Consensus 28 ~~~Wei~~~~l~l~~~iG~G~fG~Vy~~~~~~~vAvK~~~~ 68 (307)
T 3omv_A 28 SYYWEIEASEVMLSTRIGSGSFGTVYKGKWHGDVAVKILKV 68 (307)
T ss_dssp -CCCBCCTTSCCEEEECCCCSSSEEEEEESSSEEEEEECCC
T ss_pred CcCcEEcHHHeEEeeEEeeCCCcEEEEEEECCcEEEEEEEe
Confidence 35799999999999999999999999999999999999863
|
| >4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* | Back alignment and structure |
|---|
| >4gt4_A Tyrosine-protein kinase transmembrane receptor RO; ATP binding, phosphorylation, transferase; 2.41A {Homo sapiens} PDB: 3zzw_A | Back alignment and structure |
|---|
| >4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} | Back alignment and structure |
|---|
| >2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} | Back alignment and structure |
|---|
| >3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* | Back alignment and structure |
|---|
| >1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... | Back alignment and structure |
|---|
| >2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 | Back alignment and structure |
|---|
| >1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A | Back alignment and structure |
|---|
| >1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B | Back alignment and structure |
|---|
| >3isr_A Transglutaminase-like enzymes, putative cysteine; protease, hutchinsoni MCSG, structural genomics; 1.90A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* | Back alignment and structure |
|---|
| >1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... | Back alignment and structure |
|---|
| >1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A | Back alignment and structure |
|---|
| >2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* | Back alignment and structure |
|---|
| >2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... | Back alignment and structure |
|---|
| >3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... | Back alignment and structure |
|---|
| >2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A | Back alignment and structure |
|---|
| >4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* | Back alignment and structure |
|---|
| >3kd4_A Putative protease; structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2, hydrol; HET: MSE; 2.00A {Parabacteroides distasonis atcc 8503} | Back alignment and structure |
|---|
| >3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* | Back alignment and structure |
|---|
| >1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3fpq_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase, ATP-BIND kinase, nucleotide-binding, phosphoprotein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* | Back alignment and structure |
|---|
| >3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* | Back alignment and structure |
|---|
| >3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >2f4m_A Peptide N-glycanase; glycoproteins, ubiquitin-dependent protein degradation, NUCL excision repair, peptide:N-glycanase; 1.85A {Mus musculus} SCOP: d.3.1.4 PDB: 2f4o_A* | Back alignment and structure |
|---|
| >2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} | Back alignment and structure |
|---|
| >3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} | Back alignment and structure |
|---|
| >3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} | Back alignment and structure |
|---|
| >4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens} | Back alignment and structure |
|---|
| >4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ... | Back alignment and structure |
|---|
| >3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A | Back alignment and structure |
|---|
| >3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A | Back alignment and structure |
|---|
| >2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* | Back alignment and structure |
|---|
| >3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* | Back alignment and structure |
|---|
| >3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* | Back alignment and structure |
|---|
| >4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* | Back alignment and structure |
|---|
| >1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* | Back alignment and structure |
|---|
| >2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... | Back alignment and structure |
|---|
| >3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* 4e20_A* 4e1z_A* | Back alignment and structure |
|---|
| >3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... | Back alignment and structure |
|---|
| >1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* | Back alignment and structure |
|---|
| >3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* | Back alignment and structure |
|---|
| >4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} | Back alignment and structure |
|---|
| >2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} | Back alignment and structure |
|---|
| >3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* | Back alignment and structure |
|---|
| >3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} | Back alignment and structure |
|---|
| >3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 4deg_A* 4deh_A* 4dei_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 4aoi_A* 4ap7_A* 3q6w_A* ... | Back alignment and structure |
|---|
| >4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* | Back alignment and structure |
|---|
| >3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A | Back alignment and structure |
|---|
| >3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ... | Back alignment and structure |
|---|
| >1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A* | Back alignment and structure |
|---|
| >2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* | Back alignment and structure |
|---|
| >2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4exu_A Mitogen-activated protein kinase 13; P38 kinase, transferase; 1.70A {Homo sapiens} PDB: 4eyj_A* 4eym_A* 3coi_A | Back alignment and structure |
|---|
| >3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} SCOP: d.144.1.7 PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3u9c_A* 4fbx_A* 3mb7_A* 3mb6_A* ... | Back alignment and structure |
|---|
| >3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A | Back alignment and structure |
|---|
| >2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* | Back alignment and structure |
|---|
| >2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A | Back alignment and structure |
|---|
| >3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A | Back alignment and structure |
|---|
| >1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* | Back alignment and structure |
|---|
| >2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* | Back alignment and structure |
|---|
| >1zth_A RIO1 serine protein kinase; ribosome biogenesis, rRNA, ADP, manganese, transferase; HET: ADP; 1.89A {Archaeoglobus fulgidus} PDB: 1zp9_A* 1ztf_A* | Back alignment and structure |
|---|
| >2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... | Back alignment and structure |
|---|
| >3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} | Back alignment and structure |
|---|
| >2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* | Back alignment and structure |
|---|
| >3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A | Back alignment and structure |
|---|
| >1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... | Back alignment and structure |
|---|
| >4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} PDB: 4bbm_A* | Back alignment and structure |
|---|
| >1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... | Back alignment and structure |
|---|
| >3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* 4azf_A* | Back alignment and structure |
|---|
| >2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* | Back alignment and structure |
|---|
| >2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* | Back alignment and structure |
|---|
| >2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* | Back alignment and structure |
|---|
| >3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* | Back alignment and structure |
|---|
| >1zar_A RIO2 kinase; serine kinase, winged-helix, RIO domain, ADP-Mn complex, rRNA processing, transferase; HET: ADP; 1.75A {Archaeoglobus fulgidus} SCOP: a.4.5.56 d.144.1.9 PDB: 1tqi_A* 1tqp_A* 1tqm_A* 1zao_A* | Back alignment and structure |
|---|
| >2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B | Back alignment and structure |
|---|
| >2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* | Back alignment and structure |
|---|
| >1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} PDB: 3fpq_A | Back alignment and structure |
|---|
| >3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* | Back alignment and structure |
|---|
| >3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 4gsb_A* 4gt3_A* 4gva_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3zu7_A 3zuv_A* 3o71_A 3r63_A 3c9w_A* 2y9q_A* 4fmq_A* ... | Back alignment and structure |
|---|
| >2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A | Back alignment and structure |
|---|
| >3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* | Back alignment and structure |
|---|
| >1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* | Back alignment and structure |
|---|
| >3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} | Back alignment and structure |
|---|
| >3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* | Back alignment and structure |
|---|
| >2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... | Back alignment and structure |
|---|
| >1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B | Back alignment and structure |
|---|
| >3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* | Back alignment and structure |
|---|
| >2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} | Back alignment and structure |
|---|
| >3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* | Back alignment and structure |
|---|
| >2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* | Back alignment and structure |
|---|
| >3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* | Back alignment and structure |
|---|
| >4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} | Back alignment and structure |
|---|
| >1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C | Back alignment and structure |
|---|
| >2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* | Back alignment and structure |
|---|
| >3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* | Back alignment and structure |
|---|
| >1x3z_A Peptide: N-glycanase; hydrolase-hydrolase inhibitor complex; HET: SUC; 2.80A {Saccharomyces cerevisiae} SCOP: d.3.1.4 PDB: 1x3w_A* 3esw_A* | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >4gyi_A RIO2 kinase; protein kinase, ADP complex, phosphoaspartate, acyl-phosphat ribosome biogenesis, Ser/Thr protein kinase; HET: PHD ADP; 2.20A {Chaetomium thermophilum} PDB: 4gyg_A | Back alignment and structure |
|---|
| >3en9_A Glycoprotease, O-sialoglycoprotein endopeptidase/protein kinase; endopeptidase activity, protein kinase activity; HET: TBR; 2.67A {Methanocaldococcus jannaschii} PDB: 3enh_A* 2vwb_A* | Back alignment and structure |
|---|
| >2d3g_P Ubiquitin interacting motif from hepatocyte growth factor-regulated tyrosine kinase...; protein-protein complex, UIM and ubiquitin; 1.70A {Bos taurus} | Back alignment and structure |
|---|
| >1g0d_A Protein-glutamine gamma-glutamyltransferase; tissue transglutaminase,acyltransferase; 2.50A {Pagrus major} SCOP: b.1.18.9 b.1.5.1 b.1.5.1 d.3.1.4 | Back alignment and structure |
|---|
| >2q3z_A Transglutaminase 2; transglutaminase 2, tissue transglutaminase, TG2, transferas; 2.00A {Homo sapiens} SCOP: b.1.18.9 b.1.5.1 b.1.5.1 d.3.1.4 PDB: 1kv3_A 3ly6_A* | Back alignment and structure |
|---|
| >1ex0_A Coagulation factor XIII A chain; transglutaminase, blood coagulation, mutant, W279F, oxyanion, transferase; 2.00A {Homo sapiens} SCOP: b.1.18.9 b.1.5.1 b.1.5.1 d.3.1.4 PDB: 1evu_A 1fie_A 1f13_A 1ggt_A 1ggu_A 1ggy_A 1qrk_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 468 | ||||
| d1p4oa_ | 308 | d.144.1.7 (A:) Insulin-like growth factor 1 recept | 5e-06 | |
| d1uwha_ | 276 | d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) | 1e-05 | |
| d1opja_ | 287 | d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou | 4e-05 | |
| d1fmka3 | 285 | d.144.1.7 (A:249-533) c-src tyrosine kinase {Human | 6e-05 | |
| d1byga_ | 262 | d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) | 6e-05 | |
| d1r0pa_ | 311 | d.144.1.7 (A:) Hepatocyte growth factor receptor, | 1e-04 | |
| d1mqba_ | 283 | d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum | 1e-04 | |
| d1ywna1 | 299 | d.144.1.7 (A:818-1166) Vascular endothelial growth | 2e-04 | |
| d1t46a_ | 311 | d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens | 2e-04 | |
| d1fgka_ | 299 | d.144.1.7 (A:) Fibroblast growth factor receptor 1 | 2e-04 | |
| d1mp8a_ | 273 | d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Huma | 2e-04 | |
| d1lufa_ | 301 | d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n | 2e-04 | |
| d1fvra_ | 309 | d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [ | 3e-04 | |
| d1qpca_ | 272 | d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom | 3e-04 | |
| d1sm2a_ | 263 | d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Hu | 3e-04 | |
| d1rjba_ | 325 | d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s | 5e-04 | |
| d1k2pa_ | 258 | d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Hum | 7e-04 | |
| d1vjya_ | 303 | d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human | 9e-04 | |
| d1u59a_ | 285 | d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum | 0.001 | |
| d1jpaa_ | 299 | d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou | 0.001 | |
| d1s9ja_ | 322 | d.144.1.7 (A:) Dual specificity mitogen-activated | 0.002 | |
| d1u46a_ | 273 | d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum | 0.004 |
| >d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 308 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Protein kinase-like (PK-like) superfamily: Protein kinase-like (PK-like) family: Protein kinases, catalytic subunit domain: Insulin-like growth factor 1 receptor species: Human (Homo sapiens) [TaxId: 9606]
Score = 46.0 bits (108), Expect = 5e-06
Identities = 12/42 (28%), Positives = 25/42 (59%), Gaps = 1/42 (2%)
Query: 417 SNRELYLEEEGLEIRWSELLIKKKIGEGSFGTVYHAEWRNSV 458
S ++Y+ +E E+ ++ + +++G+GSFG VY + V
Sbjct: 5 SAADVYVPDE-WEVAREKITMSRELGQGSFGMVYEGVAKGVV 45
|
| >d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 | Back information, alignment and structure |
|---|
| >d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 | Back information, alignment and structure |
|---|
| >d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 | Back information, alignment and structure |
|---|
| >d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Length = 311 | Back information, alignment and structure |
|---|
| >d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 | Back information, alignment and structure |
|---|
| >d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Length = 299 | Back information, alignment and structure |
|---|
| >d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 | Back information, alignment and structure |
|---|
| >d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 | Back information, alignment and structure |
|---|
| >d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Length = 273 | Back information, alignment and structure |
|---|
| >d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 | Back information, alignment and structure |
|---|
| >d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 309 | Back information, alignment and structure |
|---|
| >d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 | Back information, alignment and structure |
|---|
| >d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Length = 263 | Back information, alignment and structure |
|---|
| >d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 | Back information, alignment and structure |
|---|
| >d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Length = 258 | Back information, alignment and structure |
|---|
| >d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Length = 303 | Back information, alignment and structure |
|---|
| >d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 | Back information, alignment and structure |
|---|
| >d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 | Back information, alignment and structure |
|---|
| >d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 468 | |||
| d1rjba_ | 325 | Fl cytokine receptor {Human (Homo sapiens) [TaxId: | 98.09 | |
| d1jpaa_ | 299 | ephb2 receptor tyrosine kinase {Mouse (Mus musculu | 97.31 | |
| d1r0pa_ | 311 | Hepatocyte growth factor receptor, c-MET {Human (H | 96.93 | |
| d3bqca1 | 328 | Protein kinase CK2, alpha subunit {Rattus norvegic | 96.2 | |
| d1rdqe_ | 350 | cAMP-dependent PK, catalytic subunit {Mouse (Mus m | 95.68 | |
| d1koaa2 | 350 | Twitchin, kinase domain {Caenorhabditis elegans, p | 95.61 | |
| d1koba_ | 352 | Twitchin, kinase domain {California sea hare (Aply | 95.19 | |
| d2f4ma1 | 287 | Peptide:N-glycanase 1, PNG1 {Mouse (Mus musculus) | 91.51 | |
| d2q3za4 | 316 | Transglutaminase catalytic domain {Human (Homo sap | 84.94 |
| >d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Protein kinase-like (PK-like) superfamily: Protein kinase-like (PK-like) family: Protein kinases, catalytic subunit domain: Fl cytokine receptor species: Human (Homo sapiens) [TaxId: 9606]
Probab=98.09 E-value=9.7e-07 Score=84.05 Aligned_cols=38 Identities=26% Similarity=0.378 Sum_probs=34.0
Q ss_pred ceeecCcceeeeeEecccceeeEEEEEeeCc--------eeEEEee
Q 012198 427 GLEIRWSELLIKKKIGEGSFGTVYHAEWRNS--------VSIFFFS 464 (468)
Q Consensus 427 ~weI~~~eL~l~e~IGsG~FGtVyrg~W~G~--------vaVk~~~ 464 (468)
.||||+++++++++||+|+||+||+|.|++. +|||.+.
T Consensus 31 kwei~~~~~~l~~~lG~G~fG~Vy~a~~~~~~~~~~~~~vavK~~~ 76 (325)
T d1rjba_ 31 KWEFPRENLEFGKVLGSGAFGKVMNATAYGISKTGVSIQVAVKMLK 76 (325)
T ss_dssp GGBCCGGGEEEEEEEEECSSEEEEEEEEESCSSSSCEEEEEEEEEC
T ss_pred cccCCHHHeEEeeEEeeCCCeEEEEEEEcCCCcccceeEEEEEEec
Confidence 6999999999999999999999999999874 6777653
|
| >d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} | Back information, alignment and structure |
|---|
| >d2f4ma1 d.3.1.4 (A:164-450) Peptide:N-glycanase 1, PNG1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2q3za4 d.3.1.4 (A:146-461) Transglutaminase catalytic domain {Human (Homo sapiens), tissue isozyme [TaxId: 9606]} | Back information, alignment and structure |
|---|