Citrus Sinensis ID: 012260

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------
MTLSSSSMRTLVFFTTLLSFLVGSNQQPFLSSLEQDSVYQVLDSVNPTIHWRSLFPDDLCSSPPHGVVCDYFTISANDTVSSQTETVHITELSFGYVSDYSPNPPCNANSTLNPLIFTSFKHLRKLFFYKCFTEKQVPVPDNIPASFGSSLEELVFIDNPSFVGPLGGIIGSFTNLRRLVLTGNGVYGGIPDKVGDLVGLEEITLSRNKLSGGFSFSLDKLKKLRILDLSQNQFDGNVPEEMGNLTNLLKLDLSSNVCSGKIPESLGHLKSLEFMDLSFNGFGNFGVPTFLAEMDKLREVYLSGNFLGGEIPEIWESLGGIVGIGLSGTGLVGKIPASMGIHLKKLSYLSLDNNKLQGNVPEEFGVLEFVGEINLENNNLSGRVPFSAKFSTKVGEKLKLKGNPDLCIDEKFSIGKNASGSIGQLKLCKKPDNPKAAMFSDATAASPSGLVVASHMLMFLGFLVFFA
cccccHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHcccccccccccccccccccccccEEccccccccccccccccccEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHccccccEEcccHHHcccccccEEEccccEEEEcccccccccccccEEEcccccccccccHHHHcccccccEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccEEcccccccccccHHHHccccccccccccccccccccHHHHHccccccEEccccccccccccHHHHccccccEEEccccccEEEccccccccccccccEEcccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHc
ccccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccccccccccccccccccccEEEEcccccccccHHccccccccccccHccccccccHHHccccccccccHHHcccccccEEEEccccccccccccccccHHHHHHHHHHHHHccccccccccHHHccccccEEEEEccccccccccHHHccccccEEEEcccccccccccHHHccccccEEEEEccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEccccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHHHHcccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHHHccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHc
mtlssssmRTLVFFTTLLSFLvgsnqqpflssleqdsVYQVLdsvnptihwrslfpddlcsspphgvvcdyftisandtvssqteTVHITELsfgyvsdyspnppcnanstlnpliFTSFKHLRKLFFYKcftekqvpvpdnipasfgssleelvfidnpsfvgplggiigsFTNLRRLVLTgngvyggipdkvgdlvgleeitlsrnklsggfsfsldklkKLRILDLsqnqfdgnvpeemGNLTNLLKldlssnvcsgkipeslghlkslefmdlsfngfgnfgvpTFLAEMDKLREVYLSgnflggeipEIWESlggivgiglsgtglvgkipasmgihLKKLSYLsldnnklqgnvpeefgvLEFVGEInlennnlsgrvpfsakfSTKVGEklklkgnpdlcidekfsigknasgsigqlklckkpdnpkaamfsdataaspsgLVVASHMLMFLGFLVFFA
mtlssssmrTLVFFTTLLSFLVGSNQQPFLSSLEQDSVYQVLDSVNPTIHWRSLFPDDLCSSPPHGVVCDYFTISANDTVSSQTETVHITELSFGYVSDYSPNPPCNANSTLNPLIFTSFKHLRKLFFYKCFTEKQVPVPDNIPASFGSSLEELVFIDNPSFVGPLGGIIGSFTNLRRLVLTGNGVYGGIPDKVGDLVGLEEITLsrnklsggfsFSLDKLKKLRILDLSQNQFDGNVPEEMGNLTNLLKLDLSSNVCSGKIPESLGHLKSLEFMDLSFNGFGNFGVPTFLAEMDKLREVYLSGNFLGGEIPEIWESLGGIVGIGLSGTGLVGKIPASMGIHLKKLSYLSLDNNKLQGNVPEEFGVLEFVGEINLEnnnlsgrvpfSAKFSTKVgeklklkgnpdlCIDEKFSIgknasgsigqLKLCKKPDNPKAAMFSDATAASPSGLVVASHMLMFLGFLVFFA
MTLSSSSMRtlvffttllsflvGSNQQPFLSSLEQDSVYQVLDSVNPTIHWRSLFPDDLCSSPPHGVVCDYFTISANDTVSSQTETVHITELSFGYVSDYSPNPPCNANSTLNPLIFTSFKHLRKLFFYKCFTEKQVPVPDNIPASFGSSLEELVFIDNPSFVGPLGGIIGSFTNLRRLVLTGNGVYGGIPDKVGDLVGLEEITLSRNKLSGGFSFSldklkklrildlSQNQFDGNVPEEMGNLTNLLKLDLSSNVCSGKIPESLGHLKSLEFMDLSFNGFGNFGVPTFLAEMDKLREVYLSGNFLGGEIPEIWEslggivgiglsgtglvgKIPASMGIHLKKLSYLSLDNNKLQGNVPEEFGVLEFVGEINLENNNLSGRVPFSAKFSTKVGEKLKLKGNPDLCIDEKFSIGKNASGSIGQLKLCKKPDNPKAAMFSDATAASPSGLVVASHMLMFLGFLVFFA
*********TLVFFTTLLSFLVGSNQQPFLSSLEQDSVYQVLDSVNPTIHWRSLFPDDLCSSPPHGVVCDYFTISANDTVSSQTETVHITELSFGYVSDYSPNPPCNANSTLNPLIFTSFKHLRKLFFYKCFTEKQVPVPDNIPASFGSSLEELVFIDNPSFVGPLGGIIGSFTNLRRLVLTGNGVYGGIPDKVGDLVGLEEITLSRNKLSGGFSFSLDKLKKLRILDLSQNQFDGNVPEEMGNLTNLLKLDLSSNVCSGKIPESLGHLKSLEFMDLSFNGFGNFGVPTFLAEMDKLREVYLSGNFLGGEIPEIWESLGGIVGIGLSGTGLVGKIPASMGIHLKKLSYLSLDNNKLQGNVPEEFGVLEFVGEINLENNNLSGRVPFSAKFSTKVGEKLKLKGNPDLCIDEKFSIGKN****I**L***********************GLVVASHMLMFLGFLVFF*
******S**TLVFFTTLLSFLV***************VYQVLDSVNPTIHWRSLFPDDLCSSPPHGVVCDYFTISANDTVSSQTETVHITELSFGYVSDYSPNPPCN**STLNPLIFTSFKHLRKLFFYKCFTEKQVPVPDNIPASFGSSLEELVFIDNPSFVGPLGGIIGSFTNLRRLVLTGNGVYGGIPDKVGDLVGLEEITLSRNKLSGGFSFSLDKLKKLRILDLSQNQFDGNVPEEMGNLTNLLKLDLSSNVCSGKIPESLGHLKSLEFMDLSFNGFGNFGVPTFLAEMDKLREVYLSGNFLGGEIPEIWESLGGIVGIGLSGTGLVGKIPASMGIHLKKLSYLSLDNNKLQGNVPEEFGVLEFVGEINLENNNLSGRVPFSAKFSTKVGEKLKLKGNPDLCIDEKFSI*****************************AASPSGLVVASHMLMFLGFLVFFA
********RTLVFFTTLLSFLVGSNQQPFLSSLEQDSVYQVLDSVNPTIHWRSLFPDDLCSSPPHGVVCDYFTISANDTVSSQTETVHITELSFGYVSDYSPNPPCNANSTLNPLIFTSFKHLRKLFFYKCFTEKQVPVPDNIPASFGSSLEELVFIDNPSFVGPLGGIIGSFTNLRRLVLTGNGVYGGIPDKVGDLVGLEEITLSRNKLSGGFSFSLDKLKKLRILDLSQNQFDGNVPEEMGNLTNLLKLDLSSNVCSGKIPESLGHLKSLEFMDLSFNGFGNFGVPTFLAEMDKLREVYLSGNFLGGEIPEIWESLGGIVGIGLSGTGLVGKIPASMGIHLKKLSYLSLDNNKLQGNVPEEFGVLEFVGEINLENNNLSGRVPFSAKFSTKVGEKLKLKGNPDLCIDEKFSIGKNASGSIGQLKLCKKPDNPKAAMFSDATAASPSGLVVASHMLMFLGFLVFFA
**LSSSSMRTLVFFTTLLSFLVGSNQQPFLSSLEQDSVYQVLDSVNPTIHWRSLFPDDLCSSPPHGVVCDYFTISANDTVSSQTETVHITELSFGYVSDYSPNPPCNANSTLNPLIFTSFKHLRKLFFYKCFTEKQVPVPDNIPASFGSSLEELVFIDNPSFVGPLGGIIGSFTNLRRLVLTGNGVYGGIPDKVGDLVGLEEITLSRNKLSGGFSFSLDKLKKLRILDLSQNQFDGNVPEEMGNLTNLLKLDLSSNVCSGKIPESLGHLKSLEFMDLSFNGFGNFGVPTFLAEMDKLREVYLSGNFLGGEIPEIWESLGGIVGIGLSGTGLVGKIPASMGIHLKKLSYLSLDNNKLQGNVPEEFGVLEFVGEINLENNNLSGRVPFSAKFSTKVGEKLKLKGNPDLCIDEKFSIGKNASGSIGQLKLCKKPDNPKAAMFSDATAASPSGLVVASHMLMFLGFLVFFA
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHi
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiii
SSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHi
SSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTLSSSSMRTLVFFTTLLSFLVGSNQQPFLSSLEQDSVYQVLDSVNPTIHWRSLFPDDLCSSPPHGVVCDYFTISANDTVSSQTETVHITELSFGYVSDYSPNPPCNANSTLNPLIFTSFKHLRKLFFYKCFTEKQVPVPDNIPASFGSSLEELVFIDNPSFVGPLGGIIGSFTNLRRLVLTGNGVYGGIPDKVGDLVGLEEITLSRNKLSGGFSFSLDKLKKLRILDLSQNQFDGNVPEEMGNLTNLLKLDLSSNVCSGKIPESLGHLKSLEFMDLSFNGFGNFGVPTFLAEMDKLREVYLSGNFLGGEIPEIWESLGGIVGIGLSGTGLVGKIPASMGIHLKKLSYLSLDNNKLQGNVPEEFGVLEFVGEINLENNNLSGRVPFSAKFSTKVGEKLKLKGNPDLCIDEKFSIGKNASGSIGQLKLCKKPDNPKAAMFSDATAASPSGLVVASHMLMFLGFLVFFA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query467 2.2.26 [Sep-21-2011]
Q5PP26424 Piriformospora indica-ins no no 0.792 0.872 0.341 3e-53
Q9SSD1496 Protein TOO MANY MOUTHS O no no 0.828 0.780 0.301 1e-43
O82318 960 Probably inactive leucine no no 0.513 0.25 0.366 1e-28
Q9FL28 1173 LRR receptor-like serine/ no no 0.537 0.213 0.351 7e-28
Q9LYN8 1192 Leucine-rich repeat recep no no 0.492 0.192 0.334 9e-28
Q8VZG8 1045 Probable LRR receptor-lik no no 0.550 0.245 0.319 8e-27
C0LGT6 1031 LRR receptor-like serine/ no no 0.447 0.202 0.372 1e-26
C0LGV1 1135 LRR receptor-like serine/ no no 0.537 0.221 0.373 2e-26
C0LGW6 966 LRR receptor-like serine/ no no 0.492 0.238 0.313 2e-26
Q9LP24 1120 Probable leucine-rich rep no no 0.520 0.216 0.325 3e-26
>sp|Q5PP26|PII2_ARATH Piriformospora indica-insensitive protein 2 OS=Arabidopsis thaliana GN=PII-2 PE=2 SV=1 Back     alignment and function desciption
 Score =  209 bits (532), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 133/390 (34%), Positives = 211/390 (54%), Gaps = 20/390 (5%)

Query: 22  VGSNQQPFLSSLEQDSVYQVLDS-VNPTIHWRSLFPDDLCSSPPHGVVCDYFTISANDTV 80
           V  +++  +   E++++Y  +   V  + +  +L+PD    +P  GV CD +        
Sbjct: 28  VTDSEEAPMDKREREALYSAIQGFVGDSWNGSALYPDPCGWTPIQGVSCDIYN------- 80

Query: 81  SSQTETVHITELSFGYVSDYSPNPPCNANSTLNPLIFTSFKHLRKLFFYKCFTEKQVPVP 140
               +  ++T+LS G +  Y  + PC+++  + P +F   KHLR L F+ CF    V   
Sbjct: 81  ----DLWYVTDLSLGLI--YENSLPCSSSLQIRPELF-ELKHLRSLSFFNCFISPMVIAK 133

Query: 141 DNIPASFGSSLEELVFIDNPSFVGPLGGIIGSFTNLRRLVLTGNGVYGGIPDKVGDLVGL 200
           + +  +F S+LE L F  NP  +G L   IG+ T L+ LV+  NG  G +P  + +L  L
Sbjct: 134 EELWTNFASNLESLEFRSNPGLIGELPETIGNLTKLKSLVVLENGFSGELPASICNLKRL 193

Query: 201 EEITLSRNKLSGGFSFSLDKLKKLRILDLSQNQFDGNVPEEMGNLTNLLKLDLSSNVCSG 260
           + +  + N  +G        LK+L ILDLS+N F G +P   G+L +LLKLDLS+N+  G
Sbjct: 194 KRLVFAGNSFAGMIPNCFKGLKELLILDLSRNSFSGTLPTSFGDLVSLLKLDLSNNLLEG 253

Query: 261 KIPESLGHLKSLEFMDLSFNGFGNFGVPTFLAEMDKLREVYLSGNFLGGE--IPEIWESL 318
            +P+ LG LK+L  +DL  N F   G+   +  +  L E+ LS N +G E  +   W  +
Sbjct: 254 NLPQELGFLKNLTLLDLRNNRFSG-GLSKNIENIQSLTELVLSNNPMGEEDMVGTNWGKM 312

Query: 319 GGIVGIGLSGTGLVGKIPASMGIHLKKLSYLSLDNNKLQGNVP-EEFGVLEFVGEINLEN 377
             +V + LS  GL G+IP S+  +LK+L +L L+NN L G VP ++   L  +G + +  
Sbjct: 313 SNLVVLDLSKMGLRGEIPTSL-TNLKRLRFLGLNNNNLTGFVPSKKLEALPCLGALYING 371

Query: 378 NNLSGRVPFSAKFSTKVGEKLKLKGNPDLC 407
           NNL+G + FS KF  K+G + K   NP+LC
Sbjct: 372 NNLTGELRFSTKFYEKMGRRFKASKNPNLC 401
Required for growth promotion and enhanced seed production mediated by the endophytic fungus Piriformospora indica.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9SSD1|TMM_ARATH Protein TOO MANY MOUTHS OS=Arabidopsis thaliana GN=TMM PE=2 SV=1 Back     alignment and function description
>sp|O82318|Y2579_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase At2g25790 OS=Arabidopsis thaliana GN=At2g25790 PE=1 SV=1 Back     alignment and function description
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description
>sp|Q9LYN8|EXS_ARATH Leucine-rich repeat receptor protein kinase EXS OS=Arabidopsis thaliana GN=EXS PE=1 SV=1 Back     alignment and function description
>sp|Q8VZG8|Y4885_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g08850 OS=Arabidopsis thaliana GN=At4g08850 PE=1 SV=3 Back     alignment and function description
>sp|C0LGT6|EFR_ARATH LRR receptor-like serine/threonine-protein kinase EFR OS=Arabidopsis thaliana GN=EFR PE=1 SV=1 Back     alignment and function description
>sp|C0LGV1|RCH1_ARATH LRR receptor-like serine/threonine-protein kinase RCH1 OS=Arabidopsis thaliana GN=RCH1 PE=2 SV=1 Back     alignment and function description
>sp|C0LGW6|ERL1_ARATH LRR receptor-like serine/threonine-protein kinase ERL1 OS=Arabidopsis thaliana GN=ERL1 PE=2 SV=1 Back     alignment and function description
>sp|Q9LP24|Y1571_ARATH Probable leucine-rich repeat receptor-like protein kinase At1g35710 OS=Arabidopsis thaliana GN=At1g35710 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query467
224085674477 predicted protein [Populus trichocarpa] 0.993 0.972 0.631 1e-154
225438073465 PREDICTED: piriformospora indica-insensi 0.980 0.984 0.611 1e-151
255577928453 serine-threonine protein kinase, plant-t 0.931 0.960 0.647 1e-150
297799120454 hypothetical protein ARALYDRAFT_491907 [ 0.794 0.817 0.622 1e-134
7269711449 putative protein (fragment) [Arabidopsis 0.794 0.826 0.606 1e-130
15236148450 ROP-interactive CRIB motif-containing pr 0.794 0.824 0.606 1e-130
449468692521 PREDICTED: probably inactive leucine-ric 0.880 0.788 0.572 1e-119
449525273453 PREDICTED: probably inactive leucine-ric 0.865 0.891 0.578 1e-119
356545888444 PREDICTED: LOW QUALITY PROTEIN: piriform 0.869 0.914 0.538 1e-116
356536850445 PREDICTED: leucine-rich repeat receptor- 0.837 0.878 0.576 1e-114
>gi|224085674|ref|XP_002307659.1| predicted protein [Populus trichocarpa] gi|222857108|gb|EEE94655.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  550 bits (1417), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 300/475 (63%), Positives = 355/475 (74%), Gaps = 11/475 (2%)

Query: 1   MTLSSS-SMRTLVFFTTLLSFLVGSNQQPFLSSLEQDSVYQVLDSVNPTIHWRSLFPDDL 59
           M +SSS  +  L+F TTL+S LV S+QQP L S EQDS++QVL S+N  I WR+LFPDDL
Sbjct: 1   MAISSSFPIFGLLFLTTLMSSLVISHQQPLLDSAEQDSLFQVLYSINSAIPWRTLFPDDL 60

Query: 60  CSSPPHGVVCDYFT-----ISANDTVSSQ--TETVHITELSFGYVSDYSPNPPCNANSTL 112
           C S PHG+VC+YFT     ++ N +VS+Q   ET HI+ELSFG+VSDY+ NPPC+ NST+
Sbjct: 61  CLSAPHGIVCEYFTEEQPPLTPNGSVSTQPPLETAHISELSFGFVSDYTSNPPCSPNSTI 120

Query: 113 NPLIFTSFKHLRKLFFYKCFTEKQVPVPDNIPASFGSSLEELVFIDNPSFVGPLGGIIGS 172
           NPL+FTSFK LRKLFFYKCFTE  V VPD   +SFG++LEELVFI+NP+ VG L GIIG+
Sbjct: 121 NPLVFTSFKFLRKLFFYKCFTEMPVSVPDVSSSSFGANLEELVFIENPALVGSLSGIIGN 180

Query: 173 FTNLRRLVLTGNGVYGGIPDKVGDLVGLEEITLSRNKLSGGFSFSLDKLKKLRILDLSQN 232
           FTNLRRLVLTGNG+YG IPD VG LV +EE+T+SRN+LSGG  FSL KLKKLR+LDLSQN
Sbjct: 181 FTNLRRLVLTGNGIYGNIPDGVGSLVNMEEVTVSRNQLSGGVPFSLAKLKKLRVLDLSQN 240

Query: 233 QFDGNVPEEMGNLTNLLKLDLSSNVCSGKIPESLGHLKSLEFMDLSFNGFGNFGVPTFLA 292
             DG VP  +GNL+ LLKLDLS N  SGKIPESL  L+SLEF+DLSFN FGN+GVP FL 
Sbjct: 241 YLDGYVPLSVGNLSRLLKLDLSHNRLSGKIPESLVSLQSLEFLDLSFNSFGNYGVPLFLG 300

Query: 293 EMDKLREVYLSGNFLGGEIPEIWESLGGIVGIGLSGTGLVGKIPASMGIHLKKLSYLSLD 352
           EM +L+EVYLSGN LGG IPEIWE LGGI GIG S  GLVG IPASMG+HL+ L YL LD
Sbjct: 301 EMPRLKEVYLSGNLLGGHIPEIWEKLGGISGIGFSDMGLVGNIPASMGVHLRNLCYLGLD 360

Query: 353 NNKLQGNVPEEFGVLEFVGEINLENNNLSGRVPFSAKFSTKVGEKLKLKGNPDLCID-EK 411
           NNKL+G VPEE G L+   EINLENNNLSG++P +  F++KV EKLKLKGN  LC+D   
Sbjct: 361 NNKLEGTVPEELGFLKCGYEINLENNNLSGKIPVT--FTSKVAEKLKLKGNSGLCVDGGD 418

Query: 412 FSIGKNASGSIGQLKLCKKPDNPKAAMFSDATAASPSGLVVASHMLMFLGFLVFF 466
           FS      GS+G+LKLC K D     +  + +  S S         M LGF   F
Sbjct: 419 FSGFGKFEGSLGKLKLCNKSDISSPVLVQEGSLDSSSSSQTQISSRMMLGFGFLF 473

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225438073|ref|XP_002272315.1| PREDICTED: piriformospora indica-insensitive protein 2 [Vitis vinifera] gi|147855363|emb|CAN83874.1| hypothetical protein VITISV_014757 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255577928|ref|XP_002529836.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223530664|gb|EEF32537.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|297799120|ref|XP_002867444.1| hypothetical protein ARALYDRAFT_491907 [Arabidopsis lyrata subsp. lyrata] gi|297313280|gb|EFH43703.1| hypothetical protein ARALYDRAFT_491907 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|7269711|emb|CAB81444.1| putative protein (fragment) [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|15236148|ref|NP_194585.1| ROP-interactive CRIB motif-containing protein 7 [Arabidopsis thaliana] gi|332660106|gb|AEE85506.1| ROP-interactive CRIB motif-containing protein 7 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449468692|ref|XP_004152055.1| PREDICTED: probably inactive leucine-rich repeat receptor-like protein kinase At3g28040-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449525273|ref|XP_004169642.1| PREDICTED: probably inactive leucine-rich repeat receptor-like protein kinase At3g28040-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356545888|ref|XP_003541365.1| PREDICTED: LOW QUALITY PROTEIN: piriformospora indica-insensitive protein 2-like [Glycine max] Back     alignment and taxonomy information
>gi|356536850|ref|XP_003536946.1| PREDICTED: leucine-rich repeat receptor-like protein kinase PEPR1-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query467
TAIR|locus:2139880450 RIC7 "ROP-interactive CRIB mot 0.811 0.842 0.559 3.2e-113
TAIR|locus:2031880424 AT1G13230 [Arabidopsis thalian 0.785 0.865 0.317 2.6e-47
TAIR|locus:2102330475 AT3G25670 [Arabidopsis thalian 0.897 0.882 0.292 5.6e-45
TAIR|locus:2012433432 AT1G68780 [Arabidopsis thalian 0.830 0.898 0.301 2.8e-41
TAIR|locus:2016319496 TMM "TOO MANY MOUTHS" [Arabido 0.873 0.822 0.302 9.6e-41
TAIR|locus:2052367462 RLP29 "receptor like protein 2 0.796 0.805 0.310 3.4e-38
TAIR|locus:2167948 966 ERL1 "ERECTA-like 1" [Arabidop 0.558 0.270 0.312 8.4e-25
TAIR|locus:2043540 960 AT2G25790 [Arabidopsis thalian 0.708 0.344 0.299 3.6e-24
TAIR|locus:2074633 943 RLP35 "AT3G11080" [Arabidopsis 0.481 0.238 0.334 4.7e-24
TAIR|locus:2020417 1101 AT1G17230 [Arabidopsis thalian 0.657 0.278 0.303 6e-24
TAIR|locus:2139880 RIC7 "ROP-interactive CRIB motif-containing protein 7" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1117 (398.3 bits), Expect = 3.2e-113, P = 3.2e-113
 Identities = 215/384 (55%), Positives = 270/384 (70%)

Query:    24 SNQQPFLSSLEQDSVYQVLDSVNPTIHWRSLFPDDLCSSPPHGVVCDYFTISANDTVSSQ 83
             ++ Q  L   EQ++VY+VLDSVN  I WR++FPDD+C+SPP GVVCD    S N   +S 
Sbjct:    31 ASPQLALDPSEQEAVYRVLDSVNSAISWRTIFPDDICASPPDGVVCDNLYASQNGVATS- 89

Query:    84 TETVHITELSFGYVSDYSPNPPCNANSTLNPLIFTSFKHLRKLFFYKCFTEKQVPVPDNI 143
                VH+TE   GY+SDY+ NPPC++N+TL+PL+FT+FKHLRKLFFYKCFT+ +  +P  +
Sbjct:    90 ---VHVTEFHLGYLSDYTQNPPCSSNATLDPLLFTAFKHLRKLFFYKCFTDARASLPLTV 146

Query:   144 PASFGSSLEELVFIDNPSFVGPLGGIIGSFTNLRRLVLTGNGVYGGIPDKVGDLVGLEEI 203
             P  FGS LEELVFI+NPS VG +G +IG+FT LRRLVLTGNG +G IP ++GDLV LEEI
Sbjct:   147 PEDFGSVLEELVFIENPSLVGEIGAMIGNFTKLRRLVLTGNGFHGSIPGQIGDLVSLEEI 206

Query:   204 TLSRNKLSGGFSFSXXXXXXXXXXXX-SQNQFDGNVPEEMGNLTNLLKLDLSSNVCSGKI 262
             TLSRN L+GGF  +             S N  +GN P+ +G+LT LLKLDLS N  +G++
Sbjct:   207 TLSRNSLTGGFPANATSRLKNLKVLDFSHNFINGNAPDSIGDLTELLKLDLSFNEFTGEV 266

Query:   263 PESLGHLKSLEFMDLSFNGFGNFGVPTFLAEMDKLREVYLSGNFLGGEIPEIWEXXXXXX 322
             P  +G+LK L F+DLS+N FGNFGVP FLAEM  LREV+LSGN LGG IP IW+      
Sbjct:   267 PSGVGNLKKLVFLDLSYNRFGNFGVPLFLAEMSSLREVHLSGNKLGGRIPAIWKNLEGIS 326

Query:   323 XXXXXXXXXXXKIPASMGIHLKKLSYLSLDNNKLQGNVPEEFGVLEFVGEINLENNNLSG 382
                         IPASMG  LK L +L+LDNN L G +PEEFG L+   EINLENNNL+G
Sbjct:   327 GIGFSRMGLEGNIPASMGSSLKNLCFLALDNNNLDGQIPEEFGFLDSAREINLENNNLTG 386

Query:   383 RVPFSAKFSTKVGEKLKLKGNPDL 406
             + PFS  F  ++G+KLKL GN +L
Sbjct:   387 KAPFSDSFRDRIGKKLKLSGNVNL 410
GO:0005886 "plasma membrane" evidence=ISM
GO:0007165 "signal transduction" evidence=IC;RCA
GO:0005515 "protein binding" evidence=IPI
GO:0009860 "pollen tube growth" evidence=IMP
GO:0016324 "apical plasma membrane" evidence=IDA
GO:0031225 "anchored to membrane" evidence=TAS
GO:0002237 "response to molecule of bacterial origin" evidence=RCA
GO:0010103 "stomatal complex morphogenesis" evidence=RCA
GO:0048443 "stamen development" evidence=RCA
TAIR|locus:2031880 AT1G13230 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2102330 AT3G25670 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2012433 AT1G68780 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2016319 TMM "TOO MANY MOUTHS" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2052367 RLP29 "receptor like protein 29" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2167948 ERL1 "ERECTA-like 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2043540 AT2G25790 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2074633 RLP35 "AT3G11080" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2020417 AT1G17230 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query467
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-34
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-28
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 8e-25
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-22
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 8e-22
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 7e-18
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-15
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 9e-15
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-12
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-11
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-09
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 8e-08
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 3e-06
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 4e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 8e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 4e-04
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
 Score =  137 bits (346), Expect = 2e-34
 Identities = 87/243 (35%), Positives = 131/243 (53%), Gaps = 3/243 (1%)

Query: 143 IPASFGSSLEELVFIDNPSFVGPLGGIIGSFTNLRRLVLTGNGVYGGIPDKVGDLVGLEE 202
           IP     +LE L   +N    G +   IGSF++L+ L L GN + G IP+ + +L  LE 
Sbjct: 134 IPRGSIPNLETLDLSNN-MLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEF 192

Query: 203 ITLSRNKLSGGFSFSLDKLKKLRILDLSQNQFDGNVPEEMGNLTNLLKLDLSSNVCSGKI 262
           +TL+ N+L G     L ++K L+ + L  N   G +P E+G LT+L  LDL  N  +G I
Sbjct: 193 LTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPI 252

Query: 263 PESLGHLKSLEFMDLSFNGFGNFGVPTFLAEMDKLREVYLSGNFLGGEIPEIWESLGGIV 322
           P SLG+LK+L+++ L  N      +P  +  + KL  + LS N L GEIPE+   L  + 
Sbjct: 253 PSSLGNLKNLQYLFLYQNKLSG-PIPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQNLE 311

Query: 323 GIGLSGTGLVGKIPASMGIHLKKLSYLSLDNNKLQGNVPEEFGVLEFVGEINLENNNLSG 382
            + L      GKIP ++   L +L  L L +NK  G +P+  G    +  ++L  NNL+G
Sbjct: 312 ILHLFSNNFTGKIPVALT-SLPRLQVLQLWSNKFSGEIPKNLGKHNNLTVLDLSTNNLTG 370

Query: 383 RVP 385
            +P
Sbjct: 371 EIP 373

Length = 968
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 467
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.96
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.95
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.95
KOG4237498 consensus Extracellular matrix protein slit, conta 99.94
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.92
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.9
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.86
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.86
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.86
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.85
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.85
KOG4237498 consensus Extracellular matrix protein slit, conta 99.84
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.84
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.84
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.84
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.81
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.78
KOG0617264 consensus Ras suppressor protein (contains leucine 99.77
KOG0617264 consensus Ras suppressor protein (contains leucine 99.75
PLN03150623 hypothetical protein; Provisional 99.6
PLN03150623 hypothetical protein; Provisional 99.45
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.38
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.37
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.36
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.34
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.19
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.18
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.15
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.12
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.11
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.1
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.1
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.08
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.93
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.92
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.9
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.89
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.87
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.82
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.76
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.65
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.54
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.42
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.37
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.29
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.28
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.26
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.2
PF0826343 LRRNT_2: Leucine rich repeat N-terminal domain; In 98.17
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.15
PRK15386426 type III secretion protein GogB; Provisional 98.12
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.98
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.96
PRK15386 426 type III secretion protein GogB; Provisional 97.87
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.86
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.81
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.69
TIGR00864 2740 PCC polycystin cation channel protein. Note: this 97.52
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.51
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.48
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.34
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.14
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.12
KOG2123 388 consensus Uncharacterized conserved protein [Funct 97.01
KOG4341483 consensus F-box protein containing LRR [General fu 96.88
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.65
KOG4341483 consensus F-box protein containing LRR [General fu 96.02
KOG4308478 consensus LRR-containing protein [Function unknown 95.79
KOG4308478 consensus LRR-containing protein [Function unknown 95.16
smart0008251 LRRCT Leucine rich repeat C-terminal domain. 95.15
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.91
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.76
KOG1947482 consensus Leucine rich repeat proteins, some prote 94.59
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 93.03
KOG1947482 consensus Leucine rich repeat proteins, some prote 92.36
KOG0473326 consensus Leucine-rich repeat protein [Function un 90.47
KOG0473326 consensus Leucine-rich repeat protein [Function un 89.56
smart0037026 LRR Leucine-rich repeats, outliers. 89.51
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 89.51
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 88.39
smart0037026 LRR Leucine-rich repeats, outliers. 88.39
KOG3864221 consensus Uncharacterized conserved protein [Funct 81.92
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=1.2e-42  Score=388.45  Aligned_cols=348  Identities=31%  Similarity=0.455  Sum_probs=250.4

Q ss_pred             CHHHHHHHHHHHHhcCCC----CCCCCCCCCCCCCCCCceeEcCCCCCCCCcccccCCccceeEEEecCCCCCCCCC---
Q 012260           31 SSLEQDSVYQVLDSVNPT----IHWRSLFPDDLCSSPPHGVVCDYFTISANDTVSSQTETVHITELSFGYVSDYSPN---  103 (467)
Q Consensus        31 ~~~~~~all~~~~~~~~~----~~W~~~~~~~C~~~~w~gv~C~~~~~~~~~~~~~~~~~~~v~~L~L~~~~~~~~~---  103 (467)
                      +++|++||++||+++.++    .+|+..  ++||  .|.||+|+.              .++|+.|+|++....+..   
T Consensus        27 ~~~~~~~l~~~~~~~~~~~~~~~~w~~~--~~~c--~w~gv~c~~--------------~~~v~~L~L~~~~i~~~~~~~   88 (968)
T PLN00113         27 HAEELELLLSFKSSINDPLKYLSNWNSS--ADVC--LWQGITCNN--------------SSRVVSIDLSGKNISGKISSA   88 (968)
T ss_pred             CHHHHHHHHHHHHhCCCCcccCCCCCCC--CCCC--cCcceecCC--------------CCcEEEEEecCCCccccCChH
Confidence            568999999999998643    368543  5677  599999986              368999988753211100   


Q ss_pred             ------------CCCCCCcccChhhhhcCCCCceEecccccCCCCcCCCCCCCccccCCccEEEcccCCCcccccchhhc
Q 012260          104 ------------PPCNANSTLNPLIFTSFKHLRKLFFYKCFTEKQVPVPDNIPASFGSSLEELVFIDNPSFVGPLGGIIG  171 (467)
Q Consensus       104 ------------~~~~~~g~l~~~~f~~l~~L~~L~L~~~~~~~~~~ip~~l~~~l~~~L~~L~L~~n~~l~~~~p~~l~  171 (467)
                                  ..+...|.+|+.+|..+++|++|+|++|.+.+  .+|.   +.+ ++|++|++++| .+.+.+|..++
T Consensus        89 ~~~l~~L~~L~Ls~n~~~~~ip~~~~~~l~~L~~L~Ls~n~l~~--~~p~---~~l-~~L~~L~Ls~n-~~~~~~p~~~~  161 (968)
T PLN00113         89 IFRLPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTG--SIPR---GSI-PNLETLDLSNN-MLSGEIPNDIG  161 (968)
T ss_pred             HhCCCCCCEEECCCCccCCcCChHHhccCCCCCEEECcCCcccc--ccCc---ccc-CCCCEEECcCC-cccccCChHHh
Confidence                        11233455666665566666666666665543  4443   234 66777777777 67777777777


Q ss_pred             CCCCCCEEEeecCCCCCCcccccCCCCCCCEEEccCCcCCCcccccccCCCCCCEEeccCCcCCCCchhhhhCCCCCCEE
Q 012260          172 SFTNLRRLVLTGNGVYGGIPDKVGDLVGLEEITLSRNKLSGGFSFSLDKLKKLRILDLSQNQFDGNVPEEMGNLTNLLKL  251 (467)
Q Consensus       172 ~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L  251 (467)
                      ++++|++|++++|.+.+.+|..++++++|++|++++|.+++.+|..+.++++|++|++++|++++.+|..++++++|++|
T Consensus       162 ~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L  241 (968)
T PLN00113        162 SFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHL  241 (968)
T ss_pred             cCCCCCEEECccCcccccCChhhhhCcCCCeeeccCCCCcCcCChHHcCcCCccEEECcCCccCCcCChhHhcCCCCCEE
Confidence            77777777777777777777777777777777777777777777777777777777777777777777777777777777


Q ss_pred             EccCCcCCCCccccccCCCCCCeeeccccCCCCCChhHHhhcCcCCcEEeccCccCCCCchhHhhcCCCCcEEeccCCCC
Q 012260          252 DLSSNVCSGKIPESLGHLKSLEFMDLSFNGFGNFGVPTFLAEMDKLREVYLSGNFLGGEIPEIWESLGGIVGIGLSGTGL  331 (467)
Q Consensus       252 ~L~~n~l~~~~p~~~~~l~~L~~L~Ls~n~l~~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~Ls~N~l  331 (467)
                      ++++|.+++.+|..++++++|++|++++|++++ .+|..+.++++|+.|++++|.+.+.+|..+..+++|++|++++|.+
T Consensus       242 ~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~-~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~l~~n~~  320 (968)
T PLN00113        242 DLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSG-PIPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNF  320 (968)
T ss_pred             ECcCceeccccChhHhCCCCCCEEECcCCeeec-cCchhHhhccCcCEEECcCCeeccCCChhHcCCCCCcEEECCCCcc
Confidence            777777777777777777777777777777776 6677777777777777777777777777777777777777777777


Q ss_pred             CCCCchHHHhcccCCCEEeccCCCCCCCCchhhhCCCCCCEEEccCCcccccCCCCcccccccCCeeeecCCCCC
Q 012260          332 VGKIPASMGIHLKKLSYLSLDNNKLQGNVPEEFGVLEFVGEINLENNNLSGRVPFSAKFSTKVGEKLKLKGNPDL  406 (467)
Q Consensus       332 ~~~ip~~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~g~ip~~~~~~~~~~~~l~l~~Np~~  406 (467)
                      ++.+|..+. .+++|+.|++++|++++.+|..+..+++|+.|++++|+++|.+|..+.....+ +.+++++|+..
T Consensus       321 ~~~~~~~~~-~l~~L~~L~L~~n~l~~~~p~~l~~~~~L~~L~Ls~n~l~~~~p~~~~~~~~L-~~L~l~~n~l~  393 (968)
T PLN00113        321 TGKIPVALT-SLPRLQVLQLWSNKFSGEIPKNLGKHNNLTVLDLSTNNLTGEIPEGLCSSGNL-FKLILFSNSLE  393 (968)
T ss_pred             CCcCChhHh-cCCCCCEEECcCCCCcCcCChHHhCCCCCcEEECCCCeeEeeCChhHhCcCCC-CEEECcCCEec
Confidence            777777776 77778888888887777777777777778888888888777777665544433 67777777653

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>TIGR00864 PCC polycystin cation channel protein Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>smart00082 LRRCT Leucine rich repeat C-terminal domain Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query467
3rgx_A768 Structural Insight Into Brassinosteroid Perception 4e-15
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 9e-12
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 5e-15
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 1e-11
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 1e-12
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure 
Iteration: 1

 Score = 79.3 bits (194), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 97/401 (24%), Positives = 149/401 (37%), Gaps = 97/401 (24%)
Query: 58  DLCSSPPHGVVCDY-----FTISANDTVSSQTETVHITELSFGYVSDYSPNPPCNANSTL 112
           +LC +P + +   Y     FT     T+S+ +E V +  LSF Y+S   P+         
Sbjct: 387 NLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSL-HLSFNYLSGTIPSS-------- 437
Query: 113 NPLIFTSFKHLRKLFFYKCFTEKQVPVPDNIPASFGSSLEELVFIDNPSFVGPLGGIIGS 172
                 S   LR L  +    E ++P             +EL+++               
Sbjct: 438 ----LGSLSKLRDLKLWLNMLEGEIP-------------QELMYV--------------- 465
Query: 173 FTNLRRLVLTGNGVYGGIPDKVGDLVGLEEITLSRNKLSGGFSFSXXXXXXXXXXXXSQN 232
              L  L+L  N + G IP  + +   L  I+LS N+L+G                 S N
Sbjct: 466 -KTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNN 524
Query: 233 QFDGNVPEEMGNLTNLLKLDLSSNVCSGKIP----------------------------- 263
            F GN+P E+G+  +L+ LDL++N+ +G IP                             
Sbjct: 525 SFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMK 584
Query: 264 -----------------ESLGHLKSLEFMDLSFNGFGNFGVPTFLAEMDKLREVYLSGNF 306
                            E L  L +    +++   +G    PTF      +  + +S N 
Sbjct: 585 KECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTF-DNNGSMMFLDMSYNM 643
Query: 307 LGGEIPEIWEXXXXXXXXXXXXXXXXXKIPASMGIHLKKLSYLSLDNNKLQGNVPEEFGV 366
           L G IP+                     IP  +G  L+ L+ L L +NKL G +P+    
Sbjct: 644 LSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVG-DLRGLNILDLSSNKLDGRIPQAMSA 702
Query: 367 LEFVGEINLENNNLSGRVPFSAKFSTKVGEKLKLKGNPDLC 407
           L  + EI+L NNNLSG +P   +F T      K   NP LC
Sbjct: 703 LTMLTEIDLSNNNLSGPIPEMGQFETF--PPAKFLNNPGLC 741
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query467
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-52
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-30
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 6e-48
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-46
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 6e-45
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-44
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-43
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-28
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-05
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 9e-35
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-34
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-29
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-28
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-23
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 9e-32
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-31
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-27
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-23
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 5e-23
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-29
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-29
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-28
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-28
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-24
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-19
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-17
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-12
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-29
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 9e-26
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-21
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 7e-18
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-14
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-13
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-04
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-27
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-25
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-23
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-22
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-26
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-25
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-17
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-12
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 3e-10
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-26
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-25
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-20
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-16
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-26
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-22
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-22
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-17
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-16
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-25
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-24
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-22
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 5e-21
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-17
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-04
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-25
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-21
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-20
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-17
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-23
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-20
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-20
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-18
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-15
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-22
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-16
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-13
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-10
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-21
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-20
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-14
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 8e-10
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-21
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-17
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-17
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-16
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-14
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 8e-11
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-21
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-20
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-18
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-15
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 8e-21
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 4e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 9e-21
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-17
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-16
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 9e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-05
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-20
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 8e-13
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-20
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-19
1o6v_A466 Internalin A; bacterial infection, extracellular r 7e-15
1o6v_A 466 Internalin A; bacterial infection, extracellular r 6e-14
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-19
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-18
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-18
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-17
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-18
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 3e-13
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-09
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 8e-18
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 9e-18
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-17
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 9e-17
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-16
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 1e-15
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-10
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-05
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-16
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 4e-14
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-13
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-05
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-16
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 6e-11
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-05
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-16
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-12
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 5e-16
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 8e-15
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 7e-16
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 8e-15
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-14
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-15
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-10
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-07
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-15
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-11
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-15
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-14
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 1e-11
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-15
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-10
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-14
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-11
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 8e-14
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 9e-06
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-13
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-07
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-13
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-11
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 8e-10
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-12
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-11
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-09
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-08
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-11
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-06
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-11
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-09
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-11
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-10
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 9e-05
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-11
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-09
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 4e-08
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 5e-08
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 5e-11
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-10
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-10
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-10
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-06
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-10
1w8a_A192 SLIT protein; signaling protein, secreted protein, 4e-10
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 6e-10
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-05
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 8e-10
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-09
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-10
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-09
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-09
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-08
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-08
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 7e-08
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-06
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 9e-06
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 1e-08
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 7e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-08
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 9e-07
3m19_A251 Variable lymphocyte receptor A diversity region; a 4e-08
3m19_A251 Variable lymphocyte receptor A diversity region; a 3e-04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 8e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-06
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 1e-07
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 1e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 3e-07
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 5e-06
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 7e-05
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 6e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 7e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 4e-05
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 4e-05
3e6j_A229 Variable lymphocyte receptor diversity region; var 7e-06
3e6j_A229 Variable lymphocyte receptor diversity region; var 3e-04
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 1e-05
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 1e-05
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 5e-04
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-05
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 4e-05
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 5e-04
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 5e-05
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 9e-05
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 3e-04
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
 Score =  177 bits (452), Expect = 3e-52
 Identities = 68/269 (25%), Positives = 110/269 (40%), Gaps = 35/269 (13%)

Query: 143 IPASFG--SSLEELVFIDNPSFVGPLGGIIGSFTNLRRLVLTGNGVYGGIPDKVGDLVGL 200
           IP+S      L  L      + VGP+   I   T L  L +T   V G IPD +  +  L
Sbjct: 68  IPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTL 127

Query: 201 EEITLSRNKLSGGFSFSLDKLKKLRILDLSQNQFDGNVPEEMGNLTNLLK-LDLSSNVCS 259
             +  S N LSG    S+  L  L  +    N+  G +P+  G+ + L   + +S N  +
Sbjct: 128 VTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLT 187

Query: 260 GKIPESLGHLKSLEFMDLSFNGF-GNFGVPTFLAEMDKLREVYLSGNFLGGEIPEIWESL 318
           GKIP +  +L +L F+DLS N   G+             ++++L+ N L  ++ ++    
Sbjct: 188 GKIPPTFANL-NLAFVDLSRNMLEGD--ASVLFGSDKNTQKIHLAKNSLAFDLGKVGL-- 242

Query: 319 GGIVGIGLSGTGLVGKIPASMGIHLKKLSYLSLDNNKLQGNVPEEFGVLEFVGEINLENN 378
                                    K L+ L L NN++ G +P+    L+F+  +N+  N
Sbjct: 243 ------------------------SKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFN 278

Query: 379 NLSGRVPFSAKFSTKVGEKLKLKGNPDLC 407
           NL G +P          +      N  LC
Sbjct: 279 NLCGEIPQGGNLQR--FDVSAYANNKCLC 305
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query467
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 100.0
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 100.0
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 100.0
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 100.0
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 100.0
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 100.0
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 100.0
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.98
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.98
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.98
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.97
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.97
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.97
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.97
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.97
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.97
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.97
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.97
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.97
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.97
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.97
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.97
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.97
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.96
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.96
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.96
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.96
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.96
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.96
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.96
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.95
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.95
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.95
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.95
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.95
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.95
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.95
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.95
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.95
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.94
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.94
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.94
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.94
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.93
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.93
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.93
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.92
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.92
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.92
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.92
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.92
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.92
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.91
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.91
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.91
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.91
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.91
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.91
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.9
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.9
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.9
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.9
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.9
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.89
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.89
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.89
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.88
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.87
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.87
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.86
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.86
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.85
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.84
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.83
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.83
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.82
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.82
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.82
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.82
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.82
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.82
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.81
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.81
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.81
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.8
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.8
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.79
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.79
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.78
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.78
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.77
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.77
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.75
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.75
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.71
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.7
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.69
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.69
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.68
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.68
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.68
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.67
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.63
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.59
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.59
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.58
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.58
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.56
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.56
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.56
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.54
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.52
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.5
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.47
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.38
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.37
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.34
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.2
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.11
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 99.1
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.08
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 99.02
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 99.01
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.99
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.75
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.71
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.58
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.56
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.54
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.44
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.95
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.87
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.3
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.12
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.96
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
Probab=100.00  E-value=2e-44  Score=350.84  Aligned_cols=302  Identities=27%  Similarity=0.440  Sum_probs=215.8

Q ss_pred             CCCHHHHHHHHHHHHhcCCC---CCCCCCCCCCCCCCCCceeEcCCCCCCCCcccccCCccceeEEEecCCCCCCCCCCC
Q 012260           29 FLSSLEQDSVYQVLDSVNPT---IHWRSLFPDDLCSSPPHGVVCDYFTISANDTVSSQTETVHITELSFGYVSDYSPNPP  105 (467)
Q Consensus        29 ~~~~~~~~all~~~~~~~~~---~~W~~~~~~~C~~~~w~gv~C~~~~~~~~~~~~~~~~~~~v~~L~L~~~~~~~~~~~  105 (467)
                      .|.++|++||++||+++.++   .+|..+  ++||...|.||+|+...           ..++|+.|+|++.        
T Consensus         2 ~c~~~~~~aL~~~k~~~~~~~~l~~W~~~--~~~C~~~w~gv~C~~~~-----------~~~~l~~L~L~~~--------   60 (313)
T 1ogq_A            2 LCNPQDKQALLQIKKDLGNPTTLSSWLPT--TDCCNRTWLGVLCDTDT-----------QTYRVNNLDLSGL--------   60 (313)
T ss_dssp             CSCHHHHHHHHHHHHHTTCCGGGTTCCTT--SCTTTTCSTTEEECCSS-----------SCCCEEEEEEECC--------
T ss_pred             CCCHHHHHHHHHHHHhcCCcccccCCCCC--CCCCcCCCcceEeCCCC-----------CCceEEEEECCCC--------
Confidence            58999999999999999764   478653  46663359999998611           1257777777632        


Q ss_pred             CCCCcccChhhhhcCCCCceEecccccCCCCcCCCCCCCccccCCccEEEccc-CCCcccccchhhcCCCCCCEEEeecC
Q 012260          106 CNANSTLNPLIFTSFKHLRKLFFYKCFTEKQVPVPDNIPASFGSSLEELVFID-NPSFVGPLGGIIGSFTNLRRLVLTGN  184 (467)
Q Consensus       106 ~~~~g~l~~~~f~~l~~L~~L~L~~~~~~~~~~ip~~l~~~l~~~L~~L~L~~-n~~l~~~~p~~l~~l~~L~~L~L~~n  184 (467)
                       .+.|                         ...+|..+ +++ ++|++|++++ | .+.+.+|..|+++++|++|++++|
T Consensus        61 -~l~~-------------------------~~~~~~~l-~~l-~~L~~L~L~~~n-~l~~~~p~~l~~l~~L~~L~Ls~n  111 (313)
T 1ogq_A           61 -NLPK-------------------------PYPIPSSL-ANL-PYLNFLYIGGIN-NLVGPIPPAIAKLTQLHYLYITHT  111 (313)
T ss_dssp             -CCSS-------------------------CEECCGGG-GGC-TTCSEEEEEEET-TEESCCCGGGGGCTTCSEEEEEEE
T ss_pred             -CccC-------------------------CcccChhH-hCC-CCCCeeeCCCCC-cccccCChhHhcCCCCCEEECcCC
Confidence             1222                         01234444 666 7778888874 6 777778888888888888888888


Q ss_pred             CCCCCcccccCCCCCCCEEEccCCcCCCcccccccCCCCCCEEeccCCcCCCCchhhhhCCC-CCCEEEccCCcCCCCcc
Q 012260          185 GVYGGIPDKVGDLVGLEEITLSRNKLSGGFSFSLDKLKKLRILDLSQNQFDGNVPEEMGNLT-NLLKLDLSSNVCSGKIP  263 (467)
Q Consensus       185 ~l~~~~p~~~~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~-~L~~L~L~~n~l~~~~p  263 (467)
                      ++++.+|..+.++++|++|++++|.+++.+|..+.++++|++|++++|++++.+|..+.+++ +|++|++++|++++.+|
T Consensus       112 ~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~~L~~L~L~~N~l~~~~~  191 (313)
T 1ogq_A          112 NVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIP  191 (313)
T ss_dssp             CCEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCEEECCGGGGCCCTTCCEEECCSSEEEEECC
T ss_pred             eeCCcCCHHHhCCCCCCEEeCCCCccCCcCChHHhcCCCCCeEECcCCcccCcCCHHHhhhhhcCcEEECcCCeeeccCC
Confidence            88777777777777777777777777777777777777777777777777666666666665 66666666666655555


Q ss_pred             ccccCCCCCCeeeccccCCCCCChhHHhhcCcCCcEEeccCccCCCCchhHhhcCCCCcEEeccCCCCCCCCchHHHhcc
Q 012260          264 ESLGHLKSLEFMDLSFNGFGNFGVPTFLAEMDKLREVYLSGNFLGGEIPEIWESLGGIVGIGLSGTGLVGKIPASMGIHL  343 (467)
Q Consensus       264 ~~~~~l~~L~~L~Ls~n~l~~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~ip~~~~~~l  343 (467)
                      ..+..++                          |++|++++|++++..|..+..+++|++|++++|.+++.+|. +. .+
T Consensus       192 ~~~~~l~--------------------------L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~N~l~~~~~~-~~-~l  243 (313)
T 1ogq_A          192 PTFANLN--------------------------LAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFDLGK-VG-LS  243 (313)
T ss_dssp             GGGGGCC--------------------------CSEEECCSSEEEECCGGGCCTTSCCSEEECCSSEECCBGGG-CC-CC
T ss_pred             hHHhCCc--------------------------ccEEECcCCcccCcCCHHHhcCCCCCEEECCCCceeeecCc-cc-cc
Confidence            5554443                          55555555555555555555666666666666666655544 33 67


Q ss_pred             cCCCEEeccCCCCCCCCchhhhCCCCCCEEEccCCcccccCCCCcccccccCCeeeecCCCCCCcCc
Q 012260          344 KKLSYLSLDNNKLQGNVPEEFGVLEFVGEINLENNNLSGRVPFSAKFSTKVGEKLKLKGNPDLCIDE  410 (467)
Q Consensus       344 ~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~g~ip~~~~~~~~~~~~l~l~~Np~~C~c~  410 (467)
                      ++|++|+|++|++++.+|..+..+++|++|++++|+++|.+|.. .....+ +.+++++||+.|+.+
T Consensus       244 ~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~ip~~-~~l~~L-~~l~l~~N~~lc~~p  308 (313)
T 1ogq_A          244 KNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQG-GNLQRF-DVSAYANNKCLCGSP  308 (313)
T ss_dssp             TTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEEEECCCS-TTGGGS-CGGGTCSSSEEESTT
T ss_pred             CCCCEEECcCCcccCcCChHHhcCcCCCEEECcCCcccccCCCC-cccccc-ChHHhcCCCCccCCC
Confidence            88999999999999889999999999999999999999999986 444444 889999999999854
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 467
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-16
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-11
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-10
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-14
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-14
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-13
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-12
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-05
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-05
d2omza2 384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-04
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-13
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-09
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-06
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 4e-10
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 6e-08
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-07
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 6e-07
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-09
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-08
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-07
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-07
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-06
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.001
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-08
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 6e-08
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 3e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 7e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 5e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 7e-06
d2ca6a1 344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 2e-05
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 5e-05
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.001
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 4e-05
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 4e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 4e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 7e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 6e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 8e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 8e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.003
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 8e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.002
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.002
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 0.002
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 0.003
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: Decorin
species: Cow (Bos taurus) [TaxId: 9913]

 Score = 78.2 bits (191), Expect = 1e-16
 Identities = 52/240 (21%), Positives = 91/240 (37%), Gaps = 8/240 (3%)

Query: 143 IPASFGSSLEELVFIDNPSFVGPLGGIIGSFTNLRRLVLTGNGVYGGIPDKVGDLVGLEE 202
           +P         L   +N        G   +  NL  L+L  N +    P     LV LE 
Sbjct: 25  VPKDLPPDTALLDLQNN-KITEIKDGDFKNLKNLHTLILINNKISKISPGAFAPLVKLER 83

Query: 203 ITLSRNKLSGGFSFSLDKLKKLRILDLSQNQFDGNVPEEMGNLTNLLKLDLSSNVCSGKI 262
           + LS+N+L          L++LR+ +    +   +V   + N   +++L  +    SG  
Sbjct: 84  LYLSKNQLKELPEKMPKTLQELRVHENEITKVRKSVFNGL-NQMIVVELGTNPLKSSGIE 142

Query: 263 PESLGHLKSLEFMDLSFNGFGNFGVPTFLAEMDKLREVYLSGNFLGGEIPEIWESLGGIV 322
             +   +K L ++ ++                  L E++L GN +        + L  + 
Sbjct: 143 NGAFQGMKKLSYIRIADTNITTIPQGLP----PSLTELHLDGNKITKVDAASLKGLNNLA 198

Query: 323 GIGLSGTGLVGKIPASMGIHLKKLSYLSLDNNKLQGNVPEEFGVLEFVGEINLENNNLSG 382
            +GLS   +      S+      L  L L+NNKL   VP      +++  + L NNN+S 
Sbjct: 199 KLGLSFNSISAVDNGSLANT-PHLRELHLNNNKLV-KVPGGLADHKYIQVVYLHNNNISA 256
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query467
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.96
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.96
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.95
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.95
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.94
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.94
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.92
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.9
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.82
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.79
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.78
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.78
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.78
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.77
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.77
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.77
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.76
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.76
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.74
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.72
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.67
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.66
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.64
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.64
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.62
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.6
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.58
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.55
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.55
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.53
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.53
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.37
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.36
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.3
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.59
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.47
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.96
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.81
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.2
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.09
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

Probab=100.00  E-value=1.8e-43  Score=341.86  Aligned_cols=302  Identities=27%  Similarity=0.437  Sum_probs=208.4

Q ss_pred             CCCHHHHHHHHHHHHhcCCC---CCCCCCCCCCCCCCCCceeEcCCCCCCCCcccccCCccceeEEEecCCCCCCCCCCC
Q 012260           29 FLSSLEQDSVYQVLDSVNPT---IHWRSLFPDDLCSSPPHGVVCDYFTISANDTVSSQTETVHITELSFGYVSDYSPNPP  105 (467)
Q Consensus        29 ~~~~~~~~all~~~~~~~~~---~~W~~~~~~~C~~~~w~gv~C~~~~~~~~~~~~~~~~~~~v~~L~L~~~~~~~~~~~  105 (467)
                      .|.++|++||++||+++.++   .+|..+  ++||...|.||+|+...           ..+||++|+|++..       
T Consensus         2 ~c~~~e~~aLl~~k~~~~~~~~l~sW~~~--~d~C~~~w~gv~C~~~~-----------~~~~v~~L~L~~~~-------   61 (313)
T d1ogqa_           2 LCNPQDKQALLQIKKDLGNPTTLSSWLPT--TDCCNRTWLGVLCDTDT-----------QTYRVNNLDLSGLN-------   61 (313)
T ss_dssp             CSCHHHHHHHHHHHHHTTCCGGGTTCCTT--SCTTTTCSTTEEECCSS-----------SCCCEEEEEEECCC-------
T ss_pred             CCCHHHHHHHHHHHHHCCCCCcCCCCCCC--CCCCCCcCCCeEEeCCC-----------CcEEEEEEECCCCC-------
Confidence            48999999999999999876   478653  56774469999998721           34689999997432       


Q ss_pred             CCCCcccChhhhhcCCCCceEecccccCCCCcCCCCCCCccccCCccEEEccc-CCCcccccchhhcCCCCCCEEEeecC
Q 012260          106 CNANSTLNPLIFTSFKHLRKLFFYKCFTEKQVPVPDNIPASFGSSLEELVFID-NPSFVGPLGGIIGSFTNLRRLVLTGN  184 (467)
Q Consensus       106 ~~~~g~l~~~~f~~l~~L~~L~L~~~~~~~~~~ip~~l~~~l~~~L~~L~L~~-n~~l~~~~p~~l~~l~~L~~L~L~~n  184 (467)
                        ..|                         ...+|+.+ +++ ++|++|+|++ | .++|.+|..|+++++|++|+|++|
T Consensus        62 --l~g-------------------------~~~lp~~l-~~L-~~L~~L~Ls~~N-~l~g~iP~~i~~L~~L~~L~Ls~N  111 (313)
T d1ogqa_          62 --LPK-------------------------PYPIPSSL-ANL-PYLNFLYIGGIN-NLVGPIPPAIAKLTQLHYLYITHT  111 (313)
T ss_dssp             --CSS-------------------------CEECCGGG-GGC-TTCSEEEEEEET-TEESCCCGGGGGCTTCSEEEEEEE
T ss_pred             --CCC-------------------------CCCCChHH-hcC-cccccccccccc-ccccccccccccccccchhhhccc
Confidence              222                         11455555 677 7777777775 5 788888888888888888888888


Q ss_pred             CCCCCcccccCCCCCCCEEEccCCcCCCcccccccCCCCCCEEeccCCcCCCCchhhhhCCCCC-CEEEccCCcCCCCcc
Q 012260          185 GVYGGIPDKVGDLVGLEEITLSRNKLSGGFSFSLDKLKKLRILDLSQNQFDGNVPEEMGNLTNL-LKLDLSSNVCSGKIP  263 (467)
Q Consensus       185 ~l~~~~p~~~~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L-~~L~L~~n~l~~~~p  263 (467)
                      ++.+..+..+..+.+|+++++++|.+.+.+|..+.++++|+.+++++|.+++.+|..+..+..+ +.+++++|++++..|
T Consensus       112 ~l~~~~~~~~~~~~~L~~l~l~~N~~~~~~p~~l~~l~~L~~l~l~~n~l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~  191 (313)
T d1ogqa_         112 NVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIP  191 (313)
T ss_dssp             CCEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCEEECCGGGGCCCTTCCEEECCSSEEEEECC
T ss_pred             cccccccccccchhhhcccccccccccccCchhhccCcccceeecccccccccccccccccccccccccccccccccccc
Confidence            8877777777777778888888777777777777777777777777777777777766666654 566666666665555


Q ss_pred             ccccCCCCCCeeeccccCCCCCChhHHhhcCcCCcEEeccCccCCCCchhHhhcCCCCcEEeccCCCCCCCCchHHHhcc
Q 012260          264 ESLGHLKSLEFMDLSFNGFGNFGVPTFLAEMDKLREVYLSGNFLGGEIPEIWESLGGIVGIGLSGTGLVGKIPASMGIHL  343 (467)
Q Consensus       264 ~~~~~l~~L~~L~Ls~n~l~~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~ip~~~~~~l  343 (467)
                      ..+..+..                          ..+++.++...+.+|..+..+++++.+++++|.+++.+| .+. .+
T Consensus       192 ~~~~~l~~--------------------------~~l~l~~~~~~~~~~~~~~~~~~l~~l~~~~~~l~~~~~-~~~-~~  243 (313)
T d1ogqa_         192 PTFANLNL--------------------------AFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFDLG-KVG-LS  243 (313)
T ss_dssp             GGGGGCCC--------------------------SEEECCSSEEEECCGGGCCTTSCCSEEECCSSEECCBGG-GCC-CC
T ss_pred             cccccccc--------------------------ccccccccccccccccccccccccccccccccccccccc-ccc-cc
Confidence            54444322                          234444444444455555555555555555555554443 233 56


Q ss_pred             cCCCEEeccCCCCCCCCchhhhCCCCCCEEEccCCcccccCCCCcccccccCCeeeecCCCCCCcCc
Q 012260          344 KKLSYLSLDNNKLQGNVPEEFGVLEFVGEINLENNNLSGRVPFSAKFSTKVGEKLKLKGNPDLCIDE  410 (467)
Q Consensus       344 ~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~g~ip~~~~~~~~~~~~l~l~~Np~~C~c~  410 (467)
                      ++|++|+|++|+++|.+|..++++++|++|+|++|+|+|.+|.. .....+ +.+++++|+.+|+.+
T Consensus       244 ~~L~~L~Ls~N~l~g~iP~~l~~L~~L~~L~Ls~N~l~g~iP~~-~~L~~L-~~l~l~~N~~l~g~p  308 (313)
T d1ogqa_         244 KNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQG-GNLQRF-DVSAYANNKCLCGSP  308 (313)
T ss_dssp             TTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEEEECCCS-TTGGGS-CGGGTCSSSEEESTT
T ss_pred             cccccccCccCeecccCChHHhCCCCCCEEECcCCcccccCCCc-ccCCCC-CHHHhCCCccccCCC
Confidence            67777777777777777777777778888888888888777753 233333 677788888777754
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure