Citrus Sinensis ID: 012324


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460------
MKVLIVFDDVTCFSQLESIIRSLDWLTPVSRIIITTRNKQVLRNWGVRKIYEIEALENHHALELFSRHAFKRNHPDVGYEKLSSKVMKYAQGVPLALKVLGCFLYEREKEVSESAINKLQRILHPSILEVLKISYDSLDNKEKNIFLDVACFFQGEDVNLVMKFLNASGFYPEIGISVLVDKSLIAIGSYNKIRMHDLLQELGREIVRQESINPGNRSRLWHHEDIYEVLTYNTHYSKLNQIIHTACNKLIAKTPNPMLMPRLNNLVILNLRSGKSLKSLPSGIFNLEFLTKLDLSGCSKLKRLPEISSGNVCWLFLRGTAIEELPSSIDRLRRLGYLNLSDCKRLKSLPSSLCKLKSLKVLNLCGCSNLQRLPECLGQLSSPIILNLAKTNIERIPESIIQLFVLRYLLLSYSERFQSLPKPLFLARGCLALEPFLGIIEDTQRIPHSDHMLAIDWQKIRKNVCL
cEEEEEEcccccHHHHHHHHccccccccccEEEEEEccHHHHHHccccEEEEcccccHHHHHHHHHHHccccccccccHHHHHHHHHHHHccccccHHHHHcccccccHHHHHHHHHHHHcccccHHHHHHHHccccccHHcccccEEEEcccccccHHHHHHHHHHccccccccHHHHHccccEEEccccEEEccHHHHHHHHHHHHHcccccccccccccHHHHHHHHHcccccccEEEEEEccccHHHHcccccccccccccccEEEEEcccccccccccccccccccEEccccccccccccccccccccEEEccccccEEccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccc
cEEEEEEcccccHHHHHHHHccccccccccEEEEEEccHHHHHHccccEEEEEccccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHccccHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHEEEEcccccHHHHHHHHHHHHHHccccHHHHHHHHHcccccHHHHHHHHHHcEEEEEcccccEEHHHHHHHHccHHEEcccccccccEEEEcHHHHHHHHccccccccccHEEHHccccccEEcccHHHHHHccccEEEEEccccccccccccccccccccEEEccccccccccccccHHHcEEEEccccccccccccHHHHHcccEEEcccccccccccccHcccccccEEEccccHHHHcccHHHccHHHccEEEccccccccccccHHHHHcccEEEccccHHHHcccccHHcccccHHHHHccccccHHHHcHHHHHHcccccccccccccc
MKVLIVFDDVTCFSQLESIIRsldwltpvsRIIITTRNKQVLRNWGVRKIYEIEALENHHALelfsrhafkrnhpdvgyeKLSSKVMKYAQGVPLALKVLGCFLYEREKEVSESAINKLQRILHPSILEVLKISYDsldnkeknIFLDVACFFQGEDVNLVMKFLnasgfypeigISVLVDKSLIAIGSYNKIRMHDLLQELGREIVrqesinpgnrsrlwhheDIYEVLTYNTHYSKLNQIIHTACNKLiaktpnpmlmprlNNLVILNlrsgkslkslpsgifnlefltkldlsgcsklkrlpeissgnvcWLFLRGTAIEELPSSIDRLRRlgylnlsdckrlkslpsslcklkslkvlnlcgcsnlqrlpeclgqlsspiILNLAKTNIERIPESIIQLFVLRYLLLSYSErfqslpkplflargclalepflgiiedtqriphsdhmlAIDWQKIRKNVCL
MKVLIVFDDVTCFSQLESiirsldwltpvsriiittrnkqvlrnWGVRKIYEIEALENHHALELFSRHAFKRNHPDVGYEKLSSKVMKYAQGVPLALKVLGCFLYEREKEVSESAINKLQRILHPSILEVLKISYDSLDNKEKNIFLDVACFFQGEDVNLVMKFLNASGFYPEIGISVLVDKSLIAIGSYNKIRMHDLLQELGREIVRQesinpgnrsrlwhHEDIYEVLTYNTHYSKLNQIIHTACNKLIAKTPNPMLMPRLNNLVILNLRSGKSLKSLPSGIFNLEFLTKLDLSGCSKLkrlpeissgnvCWLFLRGTAIEELPSSIDRLRRLGYLNLSDCKRLKSLPSSLCKLKSLKVLNLCGCSNLQRLPECLGQLSSPIILNLAKTNIERIPESIIQLFVLRYLLLSYSERFQSLPKPLFLARGCLALEPFLGIIEDTQRIPHSDHMlaidwqkirknvcl
MKVLIVFDDVTCFSQLESIIRSLDWLTPVSRIIITTRNKQVLRNWGVRKIYEIEALENHHALELFSRHAFKRNHPDVGYEKLSSKVMKYAQGVPLALKVLGCFLYEREKEVSESAINKLQRILHPSILEVLKISYDSLDNKEKNIFLDVACFFQGEDVNLVMKFLNASGFYPEIGISVLVDKSLIAIGSYNKIRMHDLLQELGREIVRQESINPGNRSRLWHHEDIYEVLTYNTHYSKLNQIIHTACNKLIAKTPNPMLMPRLNNLVILNLRSGKSLKSLPSGIFNLEFLTKLDLSGCSKLKRLPEISSGNVCWLFLRGTAIEELPSSIDRLRRLGYLNLSDCKRlkslpsslcklkslkvlnlCGCSNLQRLPECLGQLSSPIILNLAKTNIERIPESIIQLFVLRYLLLSYSERFQSLPKPLFLARGCLALEPFLGIIEDTQRIPHSDHMLAIDWQKIRKNVCL
**VLIVFDDVTCFSQLESIIRSLDWLTPVSRIIITTRNKQVLRNWGVRKIYEIEALENHHALELFSRHAFKRNHPDVGYEKLSSKVMKYAQGVPLALKVLGCFLYEREKEVSESAINKLQRILHPSILEVLKISYDSLDNKEKNIFLDVACFFQGEDVNLVMKFLNASGFYPEIGISVLVDKSLIAIGSYNKIRMHDLLQELGREIVRQESINPGNRSRLWHHEDIYEVLTYNTHYSKLNQIIHTACNKLIAKTPNPMLMPRLNNLVILNLRSGKSLKSLPSGIFNLEFLTKLDLSGCSKLKRLPEISSGNVCWLFLRGTAIEELPSSIDRLRRLGYLNLSDCKRLKSLPSSLCKLKSLKVLNLCGCSNLQRLPECLGQLSSPIILNLAKTNIERIPESIIQLFVLRYLLLSYSERFQSLPKPLFLARGCLALEPFLGIIEDTQRIPHSDHMLAIDWQKIRKN***
MKVLIVFDDVTCFSQLESIIRSLDWLTPVSRIIITTRNKQVLRNWGVRKIYEIEALENHHALELFSRHAFKRNHPDVGYEKLSSKVMKYAQGVPLALKVLGCFLYEREKEVSESAINKLQRILHPSILEVLKISYDSLDNKEKNIFLDVACFFQGEDVNLVMKFLNASGFYPEIGISVLVDKSLIAIGSYNKIRMHDLLQELGREIVRQESINPGNRSRLWHHEDIYEVLTYNTHYSKLNQIIHTACNKLIAKTPNPMLMPRLNNLVILNLRSGKSLKSLPSGIFNLEFLTKLDLSGCSKLKRLPEISSGNVCWLFLRGTAIEELPSSIDRLRRLGYLNLSDCKRLKSLPSSLCKLKSLKVLNLCGCSNLQRLPECLGQLSSPIILNLAKTNIERIPESIIQLFVLRYLLLSYSERFQSLPKPLFLARGCLALEPFLGIIEDTQRIPHSDHMLAIDWQKIRKNVCL
MKVLIVFDDVTCFSQLESIIRSLDWLTPVSRIIITTRNKQVLRNWGVRKIYEIEALENHHALELFSRHAFKRNHPDVGYEKLSSKVMKYAQGVPLALKVLGCFLYEREKEVSESAINKLQRILHPSILEVLKISYDSLDNKEKNIFLDVACFFQGEDVNLVMKFLNASGFYPEIGISVLVDKSLIAIGSYNKIRMHDLLQELGREIVRQESINPGNRSRLWHHEDIYEVLTYNTHYSKLNQIIHTACNKLIAKTPNPMLMPRLNNLVILNLRSGKSLKSLPSGIFNLEFLTKLDLSGCSKLKRLPEISSGNVCWLFLRGTAIEELPSSIDRLRRLGYLNLSDCKRLKSLPSSLCKLKSLKVLNLCGCSNLQRLPECLGQLSSPIILNLAKTNIERIPESIIQLFVLRYLLLSYSERFQSLPKPLFLARGCLALEPFLGIIEDTQRIPHSDHMLAIDWQKIRKNVCL
MKVLIVFDDVTCFSQLESIIRSLDWLTPVSRIIITTRNKQVLRNWGVRKIYEIEALENHHALELFSRHAFKRNHPDVGYEKLSSKVMKYAQGVPLALKVLGCFLYEREKEVSESAINKLQRILHPSILEVLKISYDSLDNKEKNIFLDVACFFQGEDVNLVMKFLNASGFYPEIGISVLVDKSLIAIGSYNKIRMHDLLQELGREIVRQESINPGNRSRLWHHEDIYEVLTYNTHYSKLNQIIHTACNKLIAKTPNPMLMPRLNNLVILNLRSGKSLKSLPSGIFNLEFLTKLDLSGCSKLKRLPEISSGNVCWLFLRGTAIEELPSSIDRLRRLGYLNLSDCKRLKSLPSSLCKLKSLKVLNLCGCSNLQRLPECLGQLSSPIILNLAKTNIERIPESIIQLFVLRYLLLSYSERFQSLPKPLFLARGCLALEPFLGIIEDTQRIPHSDHMLAIDWQKIR*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKVLIVFDDVTCFSQLESIIRSLDWLTPVSRIIITTRNKQVLRNWGVRKIYEIEALENHHALELFSRHAFKRNHPDVGYEKLSSKVMKYAQGVPLALKVLGCFLYEREKEVSESAINKLQRILHPSILEVLKISYDSLDNKEKNIFLDVACFFQGEDVNLVMKFLNASGFYPEIGISVLVDKSLIAIGSYNKIRMHDLLQELGREIVRQESINPGNRSRLWHHEDIYEVLTYNTHYSKLNQIIHTACNKLIAKTPNPMLMPRLNNLVILNLRSGKSLKSLPSGIFNLEFLTKLDLSGCSKLKRLPEISSGNVCWLFLRGTAIEELPSSIDRLRRLGYLNLSDCKRLKSLPSSLCKLKSLKVLNLCGCSNLQRLPECLGQLSSPIILNLAKTNIERIPESIIQLFVLRYLLLSYSERFQSLPKPLFLARGCLALEPFLGIIEDTQRIPHSDHMLAIDWQKIRKNVCL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query466 2.2.26 [Sep-21-2011]
Q40392 1144 TMV resistance protein N N/A no 0.847 0.345 0.343 2e-57
O23530 1301 Protein SUPPRESSOR OF npr no no 0.787 0.282 0.344 7e-47
Q9FL92 1372 Probable WRKY transcripti no no 0.813 0.276 0.337 8e-46
Q9FH83 1288 Probable WRKY transcripti no no 0.5 0.180 0.432 2e-44
Q9SZ67 1895 Probable WRKY transcripti no no 0.903 0.222 0.311 7e-44
O82500 1095 Putative disease resistan no no 0.896 0.381 0.307 9e-42
Q9FKN7 1613 Protein DA1-related 4 OS= no no 0.817 0.236 0.310 1e-36
Q9LVT1623 Putative disease resistan no no 0.862 0.645 0.241 1e-16
Q9LZ25811 Probable disease resistan no no 0.858 0.493 0.235 4e-16
Q9T048 985 Disease resistance protei no no 0.815 0.385 0.258 1e-15
>sp|Q40392|TMVRN_NICGU TMV resistance protein N OS=Nicotiana glutinosa GN=N PE=1 SV=1 Back     alignment and function desciption
 Score =  223 bits (569), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 153/445 (34%), Positives = 246/445 (55%), Gaps = 50/445 (11%)

Query: 2   KVLIVFDDVTCFSQ-LESIIRSLDWLTPVSRIIITTRNKQVLRNWGVRKIYEIEALENHH 60
           KVLIV DD+      LE +   LDW    SRIIITTR+K ++    +  IYE+ AL +H 
Sbjct: 295 KVLIVLDDIDNKDHYLEYLAGDLDWFGNGSRIIITTRDKHLIEKNDI--IYEVTALPDHE 352

Query: 61  ALELFSRHAFKRNHPDVGYEKLSSKVMKYAQGVPLALKVLGCFLYEREKEVSESAINKLQ 120
           +++LF +HAF +  P+  +EKLS +V+ YA+G+PLALKV G  L+       +SAI  ++
Sbjct: 353 SIQLFKQHAFGKEVPNENFEKLSLEVVNYAKGLPLALKVWGSLLHNLRLTEWKSAIEHMK 412

Query: 121 RILHPSILEVLKISYDSLDNKEKNIFLDVACFFQGEDVNLVMKFLNASGFYPEIGISVLV 180
              +  I++ LKISYD L+ K++ +FLD+ACF +GE+ + +++ L +     E G+ +L+
Sbjct: 413 NNSYSGIIDKLKISYDGLEPKQQEMFLDIACFLRGEEKDYILQILESCHIGAEYGLRILI 472

Query: 181 DKSLIAIGSYNKIRMHDLLQELGREIVRQESINPGNRSRLWHHEDIYEVLTYNT------ 234
           DKSL+ I  YN+++MHDL+Q++G+ IV  +  +PG RSRLW  +++ EV++ NT      
Sbjct: 473 DKSLVFISEYNQVQMHDLIQDMGKYIVNFQK-DPGERSRLWLAKEVEEVMSNNTGTMAME 531

Query: 235 -----HYSKL----NQII------------HTACNKLIAKTPNPML-----------MP- 261
                 YS      NQ +             ++ +  I   PN +             P 
Sbjct: 532 AIWVSSYSSTLRFSNQAVKNMKRLRVFNMGRSSTHYAIDYLPNNLRCFVCTNYPWESFPS 591

Query: 262 --RLNNLVILNLRSGKSLKSLPSGIFNLEFLTKLDLSGCSKLKRLPEISS-GNVCWLFL- 317
              L  LV L LR   SL+ L +   +L  L ++DLS   +L R P+ +   N+ ++ L 
Sbjct: 592 TFELKMLVHLQLRHN-SLRHLWTETKHLPSLRRIDLSWSKRLTRTPDFTGMPNLEYVNLY 650

Query: 318 RGTAIEELPSSIDRLRRLGYLNLSDCKRLKSLPSSLCKLKSLKVLNLCGCSNLQRLPECL 377
           + + +EE+  S+    ++  L L+DCK LK  P     ++SL+ L L  C +L++LPE  
Sbjct: 651 QCSNLEEVHHSLGCCSKVIGLYLNDCKSLKRFPC--VNVESLEYLGLRSCDSLEKLPEIY 708

Query: 378 GQLSSPIILNLAKTNIERIPESIIQ 402
           G++   I +++  + I  +P SI Q
Sbjct: 709 GRMKPEIQIHMQGSGIRELPSSIFQ 733




Disease resistance protein. Resistance proteins guard the plant against pathogens that contain an appropriate avirulence protein via a direct or indirect interaction with this avirulence protein. That triggers a defense system including the hypersensitive response, which restricts the pathogen growth.
Nicotiana glutinosa (taxid: 35889)
>sp|O23530|SNC1_ARATH Protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1 OS=Arabidopsis thaliana GN=SNC1 PE=1 SV=3 Back     alignment and function description
>sp|Q9FL92|WRK16_ARATH Probable WRKY transcription factor 16 OS=Arabidopsis thaliana GN=WRKY16 PE=2 SV=1 Back     alignment and function description
>sp|Q9FH83|WRK52_ARATH Probable WRKY transcription factor 52 OS=Arabidopsis thaliana GN=WRKY52 PE=2 SV=3 Back     alignment and function description
>sp|Q9SZ67|WRK19_ARATH Probable WRKY transcription factor 19 OS=Arabidopsis thaliana GN=WRKY19 PE=2 SV=1 Back     alignment and function description
>sp|O82500|Y4117_ARATH Putative disease resistance protein At4g11170 OS=Arabidopsis thaliana GN=At4g11170 PE=2 SV=1 Back     alignment and function description
>sp|Q9FKN7|DAR4_ARATH Protein DA1-related 4 OS=Arabidopsis thaliana GN=DAR4 PE=1 SV=2 Back     alignment and function description
>sp|Q9LVT1|DRL39_ARATH Putative disease resistance protein At5g47280 OS=Arabidopsis thaliana GN=At5g47280 PE=3 SV=1 Back     alignment and function description
>sp|Q9LZ25|DRL30_ARATH Probable disease resistance protein At5g04720 OS=Arabidopsis thaliana GN=At5g04720 PE=2 SV=1 Back     alignment and function description
>sp|Q9T048|DRL27_ARATH Disease resistance protein At4g27190 OS=Arabidopsis thaliana GN=At4g27190 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query466
147802475 1244 hypothetical protein VITISV_027841 [Viti 0.894 0.335 0.448 2e-83
255537139 1137 leucine-rich repeat-containing protein, 0.901 0.369 0.399 2e-76
356515308 1464 PREDICTED: TMV resistance protein N-like 0.942 0.299 0.365 4e-74
359493572 2338 PREDICTED: uncharacterized protein LOC10 0.809 0.161 0.414 3e-73
359496026 1250 PREDICTED: TMV resistance protein N-like 0.903 0.336 0.388 9e-73
255564976 944 TMV resistance protein N, putative [Rici 0.869 0.429 0.405 2e-71
359496034 1132 PREDICTED: TMV resistance protein N-like 0.873 0.359 0.408 3e-71
357499823 1437 NBS-containing resistance-like protein [ 0.894 0.290 0.369 5e-71
224145028 709 nbs-lrr resistance protein [Populus tric 0.886 0.582 0.381 8e-71
74231152 753 disease resistance protein [Phaseolus vu 0.860 0.532 0.388 9e-71
>gi|147802475|emb|CAN61853.1| hypothetical protein VITISV_027841 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  315 bits (808), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 199/444 (44%), Positives = 266/444 (59%), Gaps = 27/444 (6%)

Query: 2   KVLIVFDDVTCFSQLESIIRSLDWLTPVSRIIITTRNKQVLRNWGVRKIYEIEALENHHA 61
           KVLI+ DDV   +QLES+  ++DW    SRI+ITTR+K +L   GV +IYE + LE   A
Sbjct: 295 KVLIILDDVDDLNQLESLAGNVDWFGIGSRIVITTRDKHLLNVHGVSEIYEAKELEPEEA 354

Query: 62  LELFSRHAFKRNHPDVGYEKLSSKVMKYAQGVPLALKVLGCFLYEREKEVSESAINKLQR 121
           L+LFS++AFKR  P   Y  LS  V+ YA+G+PLALKVLG FL+ +     ES ++KL++
Sbjct: 355 LQLFSQYAFKRKSPXKDYMNLSDNVVHYAKGLPLALKVLGSFLFSKTILEWESELHKLKK 414

Query: 122 ILHPSILEVLKISYDSLDNKEKNIFLDVACFFQGEDVNLVMKFLNASGFYPEIGISVLVD 181
            L+  + +VL+IS+D LD  +K IFLD+ACFF+G++ + V+K L+  GF+ + GI VL D
Sbjct: 415 ELNTKVQDVLRISFDGLDFTQKEIFLDLACFFKGQEYDFVIKILDGCGFHAKSGIRVLSD 474

Query: 182 KSLIAIGSYNKIRMHDLLQELGREIVRQES-INPGNRSRLWHHEDIYEVLTYNTHYSKLN 240
           + LI +   N++ MHDL+Q++G EIVRQE   +PG  SRLW +E IY VL  NT    LN
Sbjct: 475 RCLIDLLD-NRLWMHDLIQQMGWEIVRQECPKDPGKWSRLWDYEHIYSVLKKNTVLDNLN 533

Query: 241 QIIHTACNKLIAKTPNPMLMPR---------------------LNNLVILNLRSGKSLKS 279
            I  +    LI   PN   MP                      LN L+ LNL++ K L+S
Sbjct: 534 TIELSNSQHLI-HLPNFSSMPNLERLVLEGCTSFLEVDPSIEVLNKLIFLNLKNCKKLRS 592

Query: 280 LPSGIFNLEFLTKLDLSGCSKLKRLPEISSG--NVCWLFLRGTAIEELPSSIDRLRRLGY 337
            P  I  LE L  L LSGCS LK  PEI     ++  L+L GTAI ELP SI  L  L  
Sbjct: 593 FPRSI-KLECLKYLSLSGCSDLKNFPEIQGNMQHLSELYLDGTAISELPFSIGYLTGLIL 651

Query: 338 LNLSDCKRLKSLPSSLCKLKSLKVLNLCGCSNLQRLPECLGQLSSPIILNLAKTNIERIP 397
           L+L +CKRLKSLPSS+CKLKSL+ L L  CS L+  PE +  +     L L  T ++++ 
Sbjct: 652 LDLENCKRLKSLPSSICKLKSLETLILSACSKLESFPEIMENMEHLKKLLLDGTALKQLH 711

Query: 398 ESIIQLFVLRYLLLSYSERFQSLP 421
            SI  L  L  L L   +   +LP
Sbjct: 712 PSIEHLNGLVSLNLRDCKNLATLP 735




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255537139|ref|XP_002509636.1| leucine-rich repeat-containing protein, putative [Ricinus communis] gi|223549535|gb|EEF51023.1| leucine-rich repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356515308|ref|XP_003526343.1| PREDICTED: TMV resistance protein N-like [Glycine max] Back     alignment and taxonomy information
>gi|359493572|ref|XP_002270741.2| PREDICTED: uncharacterized protein LOC100261885 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359496026|ref|XP_002277166.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|255564976|ref|XP_002523481.1| TMV resistance protein N, putative [Ricinus communis] gi|223537309|gb|EEF38940.1| TMV resistance protein N, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|359496034|ref|XP_002277500.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|357499823|ref|XP_003620200.1| NBS-containing resistance-like protein [Medicago truncatula] gi|355495215|gb|AES76418.1| NBS-containing resistance-like protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|224145028|ref|XP_002325500.1| nbs-lrr resistance protein [Populus trichocarpa] gi|222862375|gb|EEE99881.1| nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|74231152|gb|ABA00702.1| disease resistance protein [Phaseolus vulgaris] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query466
TAIR|locus:2118106 1219 AT4G12010 [Arabidopsis thalian 0.572 0.219 0.373 4e-55
TAIR|locus:2081790 1253 AT3G51560 [Arabidopsis thalian 0.457 0.169 0.438 5.5e-54
TAIR|locus:2827629 1355 AT2G17050 [Arabidopsis thalian 0.487 0.167 0.375 2.4e-53
TAIR|locus:2167457 1191 AT5G36930 [Arabidopsis thalian 0.489 0.191 0.430 4.5e-52
TAIR|locus:2158485 1288 RRS1 "RESISTANT TO RALSTONIA S 0.5 0.180 0.432 4.8e-51
TAIR|locus:2155347 1372 TTR1 "TOLERANT TO TOBACCO RING 0.469 0.159 0.443 1.2e-50
TAIR|locus:2175991 1294 AT5G17680 [Arabidopsis thalian 0.725 0.261 0.370 3.3e-50
TAIR|locus:2170488 1205 AT5G46260 [Arabidopsis thalian 0.575 0.222 0.354 1.8e-49
TAIR|locus:20944981981 AT3G25510 [Arabidopsis thalian 0.890 0.209 0.296 7.2e-35
UNIPROTKB|Q40392 1144 N "TMV resistance protein N" [ 0.869 0.354 0.324 1.2e-47
TAIR|locus:2118106 AT4G12010 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 395 (144.1 bits), Expect = 4.0e-55, Sum P(2) = 4.0e-55
 Identities = 106/284 (37%), Positives = 158/284 (55%)

Query:     2 KVLIVFDDVTCFSQLESIIRSLDWLTPVSRIIITTRNKQVLRNWGVRKIYEIEALENHHA 61
             ++LIV DDV    Q+  ++    W    SRIIITTR+ +++     RK Y +  L +  A
Sbjct:   292 RLLIVLDDVNDEKQIRYLMGHCKWYQGGSRIIITTRDSKLIETIKGRK-YVLPKLNDREA 350

Query:    62 LELFSRHAFKRNHPDVGYEKLSSKVMKYAQGVPLALKVLGCFLYEREKEVSESAINKLQR 121
             L+LFS +AF  + P   +E L++ V+ YA+G PLALKVLG  L ER+    E+ +++L+ 
Sbjct:   351 LKLFSLNAFSNSFPLKEFEGLTNMVLDYAKGHPLALKVLGSDLCERDDLYWEAKLDRLKS 410

Query:   122 ILHPSILEVLKISYDSLDNKEKNIFLDVACFFQGEDVNLVMKFLNASGFYPEIGISVLVD 181
               H  I EVL+ SY+ L  ++KN+FLD+ACFF+ E+V+ V   LN+ G      +  LVD
Sbjct:   411 RSHGDIYEVLETSYEELTTEQKNVFLDIACFFRSENVDYVTSLLNSHGVDVSGVVKDLVD 470

Query:   182 KSLIAIGSYNKIRMHDLLQELGREI-VRQESIN---------PGNRS----RLWHHEDIY 227
             K LI + S N+I MHD+LQ + +EI ++ E+I           GN+     RLW  EDI 
Sbjct:   471 KCLITL-SDNRIEMHDMLQTMAKEISLKVETIGIRDCRWLSRHGNQCQWHIRLWDSEDIC 529

Query:   228 EVLTYNTHYSKLNQIIHTACNKLIAKTPNPMLMPRLNNLVILNL 271
             ++LT      K+  I     +KL A   +      + NL  L +
Sbjct:   530 DLLTEGLGTDKIRGIFLDT-SKLRAMRLSAKAFQGMYNLKYLKI 572


GO:0005634 "nucleus" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0007165 "signal transduction" evidence=IEA
GO:0043531 "ADP binding" evidence=IEA
GO:0006612 "protein targeting to membrane" evidence=RCA
GO:0009963 "positive regulation of flavonoid biosynthetic process" evidence=RCA
GO:0010363 "regulation of plant-type hypersensitive response" evidence=RCA
TAIR|locus:2081790 AT3G51560 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2827629 AT2G17050 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2167457 AT5G36930 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2158485 RRS1 "RESISTANT TO RALSTONIA SOLANACEARUM 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2155347 TTR1 "TOLERANT TO TOBACCO RINGSPOT NEPOVIRUS 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2175991 AT5G17680 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2170488 AT5G46260 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2094498 AT3G25510 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q40392 N "TMV resistance protein N" [Nicotiana glutinosa (taxid:35889)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query466
PLN03210 1153 PLN03210, PLN03210, Resistant to P 2e-53
pfam00931285 pfam00931, NB-ARC, NB-ARC domain 2e-18
PLN03210 1153 PLN03210, PLN03210, Resistant to P 1e-16
PLN03210 1153 PLN03210, PLN03210, Resistant to P 1e-15
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 4e-07
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 6e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-04
PRK15387 788 PRK15387, PRK15387, E3 ubiquitin-protein ligase Ss 8e-04
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 0.004
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 0.004
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
 Score =  192 bits (490), Expect = 2e-53
 Identities = 153/442 (34%), Positives = 220/442 (49%), Gaps = 39/442 (8%)

Query: 2   KVLIVFDDVTCFSQLESIIRSLDWLTPVSRIIITTRNKQVLRNWGVRKIYEIEALENHHA 61
           KVLI  DD+     L+++     W    SRII+ T++K  LR  G+  IYE+    N  A
Sbjct: 297 KVLIFIDDLDDQDVLDALAGQTQWFGSGSRIIVITKDKHFLRAHGIDHIYEVCLPSNELA 356

Query: 62  LELFSRHAFKRNHPDVGYEKLSSKVMKYAQGVPLALKVLGCFLYEREKEVSESAINKLQR 121
           LE+F R AFK+N P  G+ +L+S+V   A  +PL L VLG +L  R+KE     + +L+ 
Sbjct: 357 LEMFCRSAFKKNSPPDGFMELASEVALRAGNLPLGLNVLGSYLRGRDKEDWMDMLPRLRN 416

Query: 122 ILHPSILEVLKISYDSLDN-KEKNIFLDVACFFQGEDVNLVMKFLNASGFYPEIGISVLV 180
            L   I + L++SYD L+N K+K IF  +AC F GE VN +   L  S     IG+  LV
Sbjct: 417 GLDGKIEKTLRVSYDGLNNKKDKAIFRHIACLFNGEKVNDIKLLLANSDLDVNIGLKNLV 476

Query: 181 DKSLIAIGSYNKIRMHDLLQELGREIVRQESINPGNRSRLWHHEDIYEVLTYNTHYSKLN 240
           DKSLI +   + + MH LLQE+G+EIVR +S  PG R  L   +DI +VL  NT   K+ 
Sbjct: 477 DKSLIHV-REDIVEMHSLLQEMGKEIVRAQSNEPGEREFLVDAKDICDVLEDNTGTKKVL 535

Query: 241 QI-----------IHTACNKLIAKTPNPMLMPRLNNLVILNLRSGKSLKS------LPSG 283
            I           IH    K             + NL+ L   + K  +       LP G
Sbjct: 536 GITLDIDEIDELHIHENAFK------------GMRNLLFLKFYTKKWDQKKEVRWHLPEG 583

Query: 284 IFNLEFLTKLDLSGCSK--LKRLP-EISSGNVCWLFLRGTAIEELPSSIDRLRRLGYLNL 340
            F+     KL L    K  L+ +P      N+  L ++G+ +E+L   +  L  L  ++L
Sbjct: 584 -FD-YLPPKLRLLRWDKYPLRCMPSNFRPENLVKLQMQGSKLEKLWDGVHSLTGLRNIDL 641

Query: 341 SDCKRLKSLPSSLCKLKSLKVLNLCGCSNLQRLPECLGQLSSPIILNLAK-TNIERIPES 399
              K LK +P  L    +L+ L L  CS+L  LP  +  L+    L++++  N+E +P  
Sbjct: 642 RGSKNLKEIP-DLSMATNLETLKLSDCSSLVELPSSIQYLNKLEDLDMSRCENLEILPTG 700

Query: 400 IIQLFVLRYLLLSYSERFQSLP 421
            I L  L  L LS   R +S P
Sbjct: 701 -INLKSLYRLNLSGCSRLKSFP 721


syringae 6; Provisional. Length = 1153

>gnl|CDD|216202 pfam00931, NB-ARC, NB-ARC domain Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|185285 PRK15387, PRK15387, E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 466
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 100.0
PLN03210 1153 Resistant to P. syringae 6; Provisional 100.0
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 99.95
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.74
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.69
KOG0617264 consensus Ras suppressor protein (contains leucine 99.57
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.55
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.51
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.46
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.42
KOG0617264 consensus Ras suppressor protein (contains leucine 99.4
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.36
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.3
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.17
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.13
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.11
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.11
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.05
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.95
PLN03150623 hypothetical protein; Provisional 98.91
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 98.89
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.89
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.87
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 98.86
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.85
KOG4237 498 consensus Extracellular matrix protein slit, conta 98.84
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 98.84
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.82
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.74
PLN03150623 hypothetical protein; Provisional 98.72
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.71
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.69
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.62
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.46
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.43
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 98.36
PRK04841 903 transcriptional regulator MalT; Provisional 98.29
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.29
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.22
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.18
KOG4237 498 consensus Extracellular matrix protein slit, conta 98.17
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.11
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.1
PRK15386 426 type III secretion protein GogB; Provisional 98.07
PRK15386 426 type III secretion protein GogB; Provisional 97.98
KOG2982 418 consensus Uncharacterized conserved protein [Funct 97.95
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 97.89
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.81
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 97.76
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 97.64
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.63
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.63
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.54
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.39
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.3
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.28
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.28
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.19
PRK06893229 DNA replication initiation factor; Validated 96.64
PF05729166 NACHT: NACHT domain 96.64
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 96.63
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.51
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 96.33
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.29
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.24
KOG2123 388 consensus Uncharacterized conserved protein [Funct 95.98
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 95.94
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 95.78
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 95.66
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 95.44
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 95.4
KOG2982 418 consensus Uncharacterized conserved protein [Funct 95.38
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.31
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 95.06
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 94.88
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.71
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 94.33
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 93.5
COG3903414 Predicted ATPase [General function prediction only 93.33
PRK09087226 hypothetical protein; Validated 93.32
COG3899 849 Predicted ATPase [General function prediction only 91.97
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 91.8
KOG1947482 consensus Leucine rich repeat proteins, some prote 91.41
PRK08727233 hypothetical protein; Validated 91.27
PF13173128 AAA_14: AAA domain 90.77
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 90.58
PRK06620214 hypothetical protein; Validated 89.99
PRK05564313 DNA polymerase III subunit delta'; Validated 89.91
PRK08084235 DNA replication initiation factor; Provisional 89.83
smart0037026 LRR Leucine-rich repeats, outliers. 89.39
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 89.39
KOG1947482 consensus Leucine rich repeat proteins, some prote 88.71
PRK07471365 DNA polymerase III subunit delta'; Validated 87.94
KOG4341483 consensus F-box protein containing LRR [General fu 87.69
PRK05642234 DNA replication initiation factor; Validated 87.67
PRK13342413 recombination factor protein RarA; Reviewed 86.26
PRK06645507 DNA polymerase III subunits gamma and tau; Validat 85.04
PRK00411394 cdc6 cell division control protein 6; Reviewed 84.28
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 84.03
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 83.87
PRK14963504 DNA polymerase III subunits gamma and tau; Provisi 83.21
PRK09112351 DNA polymerase III subunit delta'; Validated 82.65
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 82.05
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 81.58
PRK12402337 replication factor C small subunit 2; Reviewed 81.21
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
Probab=100.00  E-value=3e-52  Score=432.57  Aligned_cols=359  Identities=28%  Similarity=0.367  Sum_probs=273.0

Q ss_pred             CeEEEEEeCCCChHhHHHHHhcCCCCCCCcEEEEEeCChhhHhh-cCcceEEEccCCChhhHHHHHHHhhcCCC-CCCch
Q 012324            1 MKVLIVFDDVTCFSQLESIIRSLDWLTPVSRIIITTRNKQVLRN-WGVRKIYEIEALENHHALELFSRHAFKRN-HPDVG   78 (466)
Q Consensus         1 kr~LlvlDd~~~~~~~~~l~~~~~~~~~gs~IlvTTR~~~v~~~-~~~~~~~~l~~L~~~~~~~Lf~~~~~~~~-~~~~~   78 (466)
                      |||+|||||||+..+|+.++.++|....||||++|||+++||.. |++.+.++++.|+.+|||+||.+.||... ...+.
T Consensus       261 krfllvLDDIW~~~dw~~I~~~~p~~~~g~KvvlTTRs~~V~~~~m~~~~~~~v~~L~~~eaW~LF~~~v~~~~~~~~~~  340 (889)
T KOG4658|consen  261 KRFLLVLDDIWEEVDWDKIGVPFPSRENGSKVVLTTRSEEVCGRAMGVDYPIEVECLTPEEAWDLFQKKVGPNTLGSHPD  340 (889)
T ss_pred             CceEEEEecccccccHHhcCCCCCCccCCeEEEEEeccHhhhhccccCCccccccccCccccHHHHHHhhcccccccccc
Confidence            79999999999999999999999999999999999999999999 88888999999999999999999998763 34456


Q ss_pred             HHHHHHHHHHHhCCCceeehhhhhhcccC-CHHHHHHHHHHHHhc-------cchhHHHHHHHHHhcCchhhhhhhceee
Q 012324           79 YEKLSSKVMKYAQGVPLALKVLGCFLYER-EKEVSESAINKLQRI-------LHPSILEVLKISYDSLDNKEKNIFLDVA  150 (466)
Q Consensus        79 ~~~~~~~i~~~c~glPlai~~~~~~l~~~-~~~~w~~~~~~l~~~-------~~~~~~~~l~~sy~~L~~~~~~~~~~~~  150 (466)
                      ++++|++++++|+|+|||+.++|+.|+.+ +..+|+.+.+.+...       ..+.++.++.+||+.||++.|.||+|||
T Consensus       341 i~~lak~v~~kC~GLPLAl~viG~~ma~K~t~~eW~~~~~~l~s~~~~~~~~~~~~i~~iLklSyd~L~~~lK~CFLyca  420 (889)
T KOG4658|consen  341 IEELAKEVAEKCGGLPLALNVLGGLLACKKTVQEWRRALNVLKSSLAADFSGMEESILPILKLSYDNLPEELKSCFLYCA  420 (889)
T ss_pred             HHHHHHHHHHHhCChHHHHHHHHHHhcCCCcHHHHHHHHccccccccCCCCchhhhhHHhhhccHhhhhHHHHHHHHhhc
Confidence            89999999999999999999999999987 677999999988665       1467899999999999998999999999


Q ss_pred             ccCCCccH--HHHHHHHHhcCCCc------------cchhhhhhcccceEEcC----CCeEEecHHHHHHHHHHHhhhcc
Q 012324          151 CFFQGEDV--NLVMKFLNASGFYP------------EIGISVLVDKSLIAIGS----YNKIRMHDLLQELGREIVRQESI  212 (466)
Q Consensus       151 ~fp~~~~~--~~l~~~~~~~~~~~------------~~~~~~L~~~sl~~~~~----~~~~~~hdlv~~~~~~~~~~~~~  212 (466)
                      .||+++++  +.++.+|+|+||+.            ..++.+|++++++....    ...|+|||++||+|.+++.+...
T Consensus       421 lFPED~~I~~e~Li~yWiaEGfi~~~~~~~~~~d~G~~~i~~LV~~~Ll~~~~~~~~~~~~kmHDvvRe~al~ias~~~~  500 (889)
T KOG4658|consen  421 LFPEDYEIKKEKLIEYWIAEGFIDPLDGGETAEDVGYDYIEELVRASLLIEERDEGRKETVKMHDVVREMALWIASDFGK  500 (889)
T ss_pred             cCCcccccchHHHHHHHHhccCcCccccccchhcchHHHHHHHHHHHHHhhcccccceeEEEeeHHHHHHHHHHhccccc
Confidence            99999765  45999999999873            34499999999998764    37899999999999999985432


Q ss_pred             CCCCcccccchh-hHHHHhhhcccchhhhhHHHhhhhhcccCCCCCCCCCCCCCCcEEEcCCCCC-CcccC-cccccCcc
Q 012324          213 NPGNRSRLWHHE-DIYEVLTYNTHYSKLNQIIHTACNKLIAKTPNPMLMPRLNNLVILNLRSGKS-LKSLP-SGIFNLEF  289 (466)
Q Consensus       213 ~~~~~~~l~~~~-~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~l~~L~~L~l~~~~~-~~~~~-~~l~~l~~  289 (466)
                      ..+.  .+.... ...+ .+........++....+...     .....-..++.|++|-+.+|.. ...++ ..|..++.
T Consensus       501 ~~e~--~iv~~~~~~~~-~~~~~~~~~~rr~s~~~~~~-----~~~~~~~~~~~L~tLll~~n~~~l~~is~~ff~~m~~  572 (889)
T KOG4658|consen  501 QEEN--QIVSDGVGLSE-IPQVKSWNSVRRMSLMNNKI-----EHIAGSSENPKLRTLLLQRNSDWLLEISGEFFRSLPL  572 (889)
T ss_pred             cccc--eEEECCcCccc-cccccchhheeEEEEeccch-----hhccCCCCCCccceEEEeecchhhhhcCHHHHhhCcc
Confidence            2111  110000 0000 00011111222221111110     0011122334677777776642 23333 33556777


Q ss_pred             cCEEecCCCCCCCccCCCCCC--cccEEeecCccCcccChhhhccCCCCeeeccccccccccccccCCCCCCCEEEecCC
Q 012324          290 LTKLDLSGCSKLKRLPEISSG--NVCWLFLRGTAIEELPSSIDRLRRLGYLNLSDCKRLKSLPSSLCKLKSLKVLNLCGC  367 (466)
Q Consensus       290 L~~L~l~~~~~~~~~~~~~~~--~l~~L~l~~~~i~~lp~~l~~l~~L~~L~l~~~~~~~~~p~~~~~l~~L~~L~l~~~  367 (466)
                      |++||+++|.-.+.+|..+..  +|++|+++++.++.+|.+++++..|++|++..+.....+|.....+++|++|.+...
T Consensus       573 LrVLDLs~~~~l~~LP~~I~~Li~LryL~L~~t~I~~LP~~l~~Lk~L~~Lnl~~~~~l~~~~~i~~~L~~Lr~L~l~~s  652 (889)
T KOG4658|consen  573 LRVLDLSGNSSLSKLPSSIGELVHLRYLDLSDTGISHLPSGLGNLKKLIYLNLEVTGRLESIPGILLELQSLRVLRLPRS  652 (889)
T ss_pred             eEEEECCCCCccCcCChHHhhhhhhhcccccCCCccccchHHHHHHhhheeccccccccccccchhhhcccccEEEeecc
Confidence            777887777777777766553  667777778889999999999999999999887766666665666999999988653



>PLN03210 Resistant to P Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>COG3903 Predicted ATPase [General function prediction only] Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>COG3899 Predicted ATPase [General function prediction only] Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query466
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-29
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-29
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 2e-27
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 8e-22
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 4e-10
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-27
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-23
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-19
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-05
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 1e-25
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-24
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-09
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 8e-23
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-17
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-13
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 7e-13
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-12
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-12
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-06
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-16
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-14
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-13
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-08
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-08
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-15
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-15
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 6e-14
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-13
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-12
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-12
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 4e-06
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-15
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-09
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-14
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-11
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-09
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-07
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-14
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 3e-13
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-13
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 3e-08
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 8e-04
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 5e-13
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 1e-12
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-12
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 9e-12
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-11
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-09
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 4e-09
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 2e-12
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 5e-10
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 8e-08
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 7e-06
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 2e-12
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-11
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-10
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-07
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-07
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 3e-07
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-12
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-11
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-10
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-10
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-07
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-12
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-06
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-04
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-12
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-10
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-10
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-08
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-08
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-07
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 9e-12
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-09
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-11
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-08
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 2e-11
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-10
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 5e-08
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-04
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-11
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 8e-10
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-09
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-09
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-05
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-04
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-11
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-10
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-08
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-08
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-06
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-11
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-10
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-09
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 7e-08
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-07
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 3e-11
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 8e-11
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 4e-11
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 6e-11
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 8e-11
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-10
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 9e-08
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-10
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-08
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-04
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-10
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-10
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-09
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-09
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-08
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-06
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-10
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-10
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-09
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-09
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-08
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-10
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-09
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-10
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-06
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-05
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-05
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-09
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 7e-07
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-06
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 3e-05
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-09
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-07
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-06
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-05
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-09
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-07
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-09
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-09
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-07
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-09
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 5e-04
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-09
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-09
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-08
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-05
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-05
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-08
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-07
1o6v_A 466 Internalin A; bacterial infection, extracellular r 1e-06
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-06
1o6v_A466 Internalin A; bacterial infection, extracellular r 8e-06
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-08
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-08
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-08
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-07
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-05
3e6j_A229 Variable lymphocyte receptor diversity region; var 9e-08
3e6j_A229 Variable lymphocyte receptor diversity region; var 4e-07
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 9e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 7e-05
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-07
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-07
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-05
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-07
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-06
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-05
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 7e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-06
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-06
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-06
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-06
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-06
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-06
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-05
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-06
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 2e-06
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-05
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 3e-06
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 6e-06
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-05
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 7e-04
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 3e-05
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 8e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 1e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 2e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 4e-04
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 4e-04
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 5e-04
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
 Score =  116 bits (293), Expect = 2e-29
 Identities = 42/189 (22%), Positives = 76/189 (40%), Gaps = 17/189 (8%)

Query: 247 CNKLIAKTPNPMLMPRLNNLVILNLRSGKSLKSLPSGIFNL--EFLTKLDLSGCSKLKRL 304
            N    +  +       NN   +  R+G++LK+    + +        L+L     L + 
Sbjct: 39  YNADRNRWHSAWRQANSNNP-QIETRTGRALKATADLLEDATQPGRVALELRSV-PLPQF 96

Query: 305 PEISSG--NVCWLFLRGTAIEELPSSIDRLRRLGYLNLSDCKRLKSLPSSLCKLKSLKVL 362
           P+ +    ++  + +    + ELP ++ +   L  L L+    L++LP+S+  L  L+ L
Sbjct: 97  PDQAFRLSHLQHMTIDAAGLMELPDTMQQFAGLETLTLARNP-LRALPASIASLNRLREL 155

Query: 363 NLCGCSNLQRLPECLGQLSSPI---------ILNLAKTNIERIPESIIQLFVLRYLLLSY 413
           ++  C  L  LPE L    +            L L  T I  +P SI  L  L+ L +  
Sbjct: 156 SIRACPELTELPEPLASTDASGEHQGLVNLQSLRLEWTGIRSLPASIANLQNLKSLKIRN 215

Query: 414 SERFQSLPK 422
           S    +L  
Sbjct: 216 S-PLSALGP 223


>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query466
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 99.97
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 99.93
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 99.91
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 99.88
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.86
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.83
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.81
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.8
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.79
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.79
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.76
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.75
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.74
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.73
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.73
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.72
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.72
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.72
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.72
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.71
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.71
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.71
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.71
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.7
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.7
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.7
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.7
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.7
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.69
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.69
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.69
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.69
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.69
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.69
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.68
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.67
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.67
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.67
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.67
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.67
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.67
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.67
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.67
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.66
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.66
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.66
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.66
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.66
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.66
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.66
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.65
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.64
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.64
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.64
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.63
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.63
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.63
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.63
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.63
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.63
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.63
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.62
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.62
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.62
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.62
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.62
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.61
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.61
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.61
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.6
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.6
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.6
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.6
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.6
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.6
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.6
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.6
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.59
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.59
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.59
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.58
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.58
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.58
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.58
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.58
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.57
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.57
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.57
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.57
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.57
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.56
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.56
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.56
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.56
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.56
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.56
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.56
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.54
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.54
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.54
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.54
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.54
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.53
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.53
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.5
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.5
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.5
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.49
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.49
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.48
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.46
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.45
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.44
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.43
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.42
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.42
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.41
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.41
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.41
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.41
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.4
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.4
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.39
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.36
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.33
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.3
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.29
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.28
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.27
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.27
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.26
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.25
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.22
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 99.2
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.19
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.18
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.18
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.18
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.02
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.01
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 98.97
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.92
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 98.91
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.85
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 98.79
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 98.69
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.68
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.66
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 98.56
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.46
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.27
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.19
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 98.17
2fna_A357 Conserved hypothetical protein; structural genomic 98.1
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.09
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.06
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.02
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.91
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.77
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.76
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 97.22
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.12
4gt6_A394 Cell surface protein; leucine rich repeats, putati 96.77
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 96.5
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 96.37
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 96.32
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 96.19
4gt6_A394 Cell surface protein; leucine rich repeats, putati 96.05
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 95.86
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 95.7
2chg_A226 Replication factor C small subunit; DNA-binding pr 95.45
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 94.95
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 94.9
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 94.81
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 94.72
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 94.37
2v1u_A387 Cell division control protein 6 homolog; DNA repli 93.11
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 92.05
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 89.31
2chq_A319 Replication factor C small subunit; DNA-binding pr 88.75
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 88.42
3bos_A242 Putative DNA replication factor; P-loop containing 84.73
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 83.86
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
Probab=99.97  E-value=2.5e-31  Score=270.19  Aligned_cols=201  Identities=15%  Similarity=0.154  Sum_probs=159.0

Q ss_pred             CeEEEEEeCCCChHhHHHHHhcCCCCCCCcEEEEEeCChhhHhhcC-cceEEEccCCChhhHHHHHHHhhcCCCCCCchH
Q 012324            1 MKVLIVFDDVTCFSQLESIIRSLDWLTPVSRIIITTRNKQVLRNWG-VRKIYEIEALENHHALELFSRHAFKRNHPDVGY   79 (466)
Q Consensus         1 kr~LlvlDd~~~~~~~~~l~~~~~~~~~gs~IlvTTR~~~v~~~~~-~~~~~~l~~L~~~~~~~Lf~~~~~~~~~~~~~~   79 (466)
                      |||||||||||+.+++ .+. .    .+||+||||||++.++..++ ..++|+|++|+++|||+||.+.+|.... .+..
T Consensus       243 kr~LlVLDdv~~~~~~-~~~-~----~~gs~ilvTTR~~~v~~~~~~~~~~~~l~~L~~~ea~~Lf~~~a~~~~~-~~~~  315 (549)
T 2a5y_B          243 PNTLFVFDDVVQEETI-RWA-Q----ELRLRCLVTTRDVEISNAASQTCEFIEVTSLEIDECYDFLEAYGMPMPV-GEKE  315 (549)
T ss_dssp             TTEEEEEEEECCHHHH-HHH-H----HTTCEEEEEESBGGGGGGCCSCEEEEECCCCCHHHHHHHHHHTSCCCC---CHH
T ss_pred             CcEEEEEECCCCchhh-ccc-c----cCCCEEEEEcCCHHHHHHcCCCCeEEECCCCCHHHHHHHHHHHhcCCCC-chhH
Confidence            4999999999998865 221 1    27999999999999998876 4468999999999999999999986543 4677


Q ss_pred             HHHHHHHHHHhCCCceeehhhhhhcccCCHHHHHHHHH-HHHhccchhHHHHHHHHHhcCchhhhhhhc-----------
Q 012324           80 EKLSSKVMKYAQGVPLALKVLGCFLYEREKEVSESAIN-KLQRILHPSILEVLKISYDSLDNKEKNIFL-----------  147 (466)
Q Consensus        80 ~~~~~~i~~~c~glPlai~~~~~~l~~~~~~~w~~~~~-~l~~~~~~~~~~~l~~sy~~L~~~~~~~~~-----------  147 (466)
                      .+++++|+++|+|+|||++++|+.++.+. ++|...+. .++......+..++.+||+.||++.+.||+           
T Consensus       316 ~~~~~~I~~~c~GlPLAl~~~g~~l~~~~-w~~~~~l~~~l~~~~~~~i~~~l~~Sy~~L~~~lk~~f~~Ls~~er~l~~  394 (549)
T 2a5y_B          316 EDVLNKTIELSSGNPATLMMFFKSCEPKT-FEKMAQLNNKLESRGLVGVECITPYSYKSLAMALQRCVEVLSDEDRSALA  394 (549)
T ss_dssp             HHHHHHHHHHHTTCHHHHHHHHTTCCSSS-HHHHHHHHHHHHHHCSSTTCCCSSSSSSSHHHHHHHHHHTSCHHHHHHTT
T ss_pred             HHHHHHHHHHhCCChHHHHHHHHHhccch-HHHHHHhHHHhhcccHHHHHHHHhcccccccHHHHHHHhccchhhhhHhh
Confidence            88999999999999999999999998774 23322222 233323455777788889988888888888           


Q ss_pred             eeeccCCCccHHHHHHHHHhc--CCCccc-----------hhhhhhcccceEEcC---CCeEEecHHHHHHHHHHHhhhc
Q 012324          148 DVACFFQGEDVNLVMKFLNAS--GFYPEI-----------GISVLVDKSLIAIGS---YNKIRMHDLLQELGREIVRQES  211 (466)
Q Consensus       148 ~~~~fp~~~~~~~l~~~~~~~--~~~~~~-----------~~~~L~~~sl~~~~~---~~~~~~hdlv~~~~~~~~~~~~  211 (466)
                      |||+||+++.++  ++.|+++  ||+...           ++++|++++|++...   ...|+|||++|++|+.++..++
T Consensus       395 ~ls~fp~~~~i~--i~~w~a~~~G~i~~~~~~~~~~~~~~~l~~L~~rsLl~~~~~~~~~~~~mHdlv~~~a~~~~~~~~  472 (549)
T 2a5y_B          395 FAVVMPPGVDIP--VKLWSCVIPVDICSNEEEQLDDEVADRLKRLSKRGALLSGKRMPVLTFKIDHIIHMFLKHVVDAQT  472 (549)
T ss_dssp             GGGSSCTTCCEE--HHHHHHHSCC-------CCCTHHHHHHHHHTTTBSSCSEEECSSSCEEECCHHHHHHHHTTSCTHH
T ss_pred             heeeeCCCCeee--eeeeeeeccceeccCCCCCCHHHHHHHHHHHHHcCCeeEecCCCceEEEeChHHHHHHHHHHHHHH
Confidence            999999998888  8899999  776432           599999999998753   3579999999999998776554



>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 466
d2a5yb3277 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenor 6e-20
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-04
d1jl5a_ 353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.002
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 6e-05
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-04
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 5e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 0.001
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 7e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.001
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 0.001
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]
 Score = 87.6 bits (216), Expect = 6e-20
 Identities = 26/146 (17%), Positives = 48/146 (32%), Gaps = 8/146 (5%)

Query: 2   KVLIVFDDVTCFSQLESIIRSLDWLTPVSRIIITTRNKQVLRN-WGVRKIYEIEALENHH 60
             L VFDDV                    R ++TTR+ ++        +  E+ +LE   
Sbjct: 136 NTLFVFDDV------VQEETIRWAQELRLRCLVTTRDVEISNAASQTCEFIEVTSLEIDE 189

Query: 61  ALELFSRHAFKRNHPDVGYEKLSSKVMKYAQGVPLALKVLGCFLYEREKEVSESAINKLQ 120
             +    +       +   E + +K ++ + G P  L +       +  E      NKL+
Sbjct: 190 CYDFLEAYGMPMPVGE-KEEDVLNKTIELSSGNPATLMMFFKSCEPKTFEKMAQLNNKLE 248

Query: 121 RILHPSILEVLKISYDSLDNKEKNIF 146
                 +  +   SY SL    +   
Sbjct: 249 SRGLVGVECITPYSYKSLAMALQRCV 274


>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query466
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 99.93
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.75
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.73
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.61
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.57
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.57
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.57
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.55
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.53
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.52
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.51
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.48
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.45
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.45
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.43
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.42
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.41
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.37
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.37
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.35
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.35
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.34
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.34
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.15
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.1
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.1
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.08
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.07
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.06
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 98.92
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.87
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.76
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.71
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 98.62
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.44
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.03
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 97.89
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.7
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.69
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.25
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.11
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.58
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 95.93
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 93.15
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 86.5
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 83.62
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]
Probab=99.93  E-value=1.1e-26  Score=212.35  Aligned_cols=142  Identities=18%  Similarity=0.137  Sum_probs=126.3

Q ss_pred             CeEEEEEeCCCChHhHHHHHhcCCCCCCCcEEEEEeCChhhHhhcCcc-eEEEccCCChhhHHHHHHHhhcCCCCCCchH
Q 012324            1 MKVLIVFDDVTCFSQLESIIRSLDWLTPVSRIIITTRNKQVLRNWGVR-KIYEIEALENHHALELFSRHAFKRNHPDVGY   79 (466)
Q Consensus         1 kr~LlvlDd~~~~~~~~~l~~~~~~~~~gs~IlvTTR~~~v~~~~~~~-~~~~l~~L~~~~~~~Lf~~~~~~~~~~~~~~   79 (466)
                      ||+|+||||+|+.++|..+..      .|||||||||++.++..+... +.|++++|+.+|||+||.+++|..... +..
T Consensus       135 kr~LlVLDDv~~~~~~~~~~~------~~srilvTTR~~~v~~~~~~~~~~~~l~~L~~~ea~~Lf~~~~~~~~~~-~~~  207 (277)
T d2a5yb3         135 PNTLFVFDDVVQEETIRWAQE------LRLRCLVTTRDVEISNAASQTCEFIEVTSLEIDECYDFLEAYGMPMPVG-EKE  207 (277)
T ss_dssp             TTEEEEEEEECCHHHHHHHHH------TTCEEEEEESBGGGGGGCCSCEEEEECCCCCHHHHHHHHHHTSCCCC---CHH
T ss_pred             CCeeEecchhhHHhhhhhhcc------cCceEEEEeehHHHHHhcCCCCceEECCCCCHHHHHHHHHHHhCCccCc-hhh
Confidence            689999999999999987754      389999999999999887654 689999999999999999998865543 456


Q ss_pred             HHHHHHHHHHhCCCceeehhhhhhcccCCHHHHHHHHHHHHhccchhHHHHHHHHHhcCchhhhhhhcee
Q 012324           80 EKLSSKVMKYAQGVPLALKVLGCFLYEREKEVSESAINKLQRILHPSILEVLKISYDSLDNKEKNIFLDV  149 (466)
Q Consensus        80 ~~~~~~i~~~c~glPlai~~~~~~l~~~~~~~w~~~~~~l~~~~~~~~~~~l~~sy~~L~~~~~~~~~~~  149 (466)
                      ++++++|+++|+|+|||++++|+.|+.++.+.|.+..+++.......+..++.+||++||+++|+||.++
T Consensus       208 ~~~~~~iv~~c~GlPLAl~~ig~~l~~k~~~~~~~~~~~L~~~~~~~v~~il~~sY~~L~~~lk~c~~~l  277 (277)
T d2a5yb3         208 EDVLNKTIELSSGNPATLMMFFKSCEPKTFEKMAQLNNKLESRGLVGVECITPYSYKSLAMALQRCVEVL  277 (277)
T ss_dssp             HHHHHHHHHHHTTCHHHHHHHHTTCCSSSHHHHHHHHHHHHHHCSSTTCCCSSSSSSSHHHHHHHHHHTS
T ss_pred             HHHHHHHHHHhCCCHHHHHHHHHHhccCCHHHHHHHHHHHhcCcHHHHHHHHHHHHhcccHHHHHHHHhC
Confidence            8899999999999999999999999999999999999999877778899999999999999999999763



>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure