Citrus Sinensis ID: 012398

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460----
MESTTNTMVNGSDLDNNNAAGGGGVVDVYGEDFATEDQLITPWTVSVASGYTLLRDPRHNKGLAFTENERDAHYLRGLLPPALMNQELQEKRLMHNLRQYKVPLQRYVAMMDLQERNERLFYKLLIDNVEELLPVVYTPTVGEACQKYGSIFRRPQGLYISLKEKGKILEVLKNWPERNIQVIVVTDGERILGLGDLGCQGMGIPVGKLSLYTALGGLRPSACLPITIDVGTNNEQLLNDEFYIGLRQKRATGQEYAELLQEFMTAVKQNYGEKVLIQFEDFANHNAFELLSKYSSSHLVFNDDIQGTASVVLAGILSALKLVGGTLADQTFLFLGAGEAGTGIAELIALEMSKQTKAPIEEARKKIWLVDSKGLIVSSRKESLQHFKKPWAHEHAPIKSLLDAVKAIKPTMLMGTSGVGKTFTKEVVEAMASFNEKPVIFALSNPTSQSECTAEEAYTWSKVN
cccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccHHHHHHcccccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHcHHccccccccccHHHHHHHHHHccccccEEEEEccccccHHHHHHccccccccEEEEEcccEEEcccccccccccccHHHHHHHHHcccccccccccEEEEcccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHcccEEEEcccccccHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHcccccccEEEEEcccHHHHHHHHHHHHHHHHcccccHHHHHccEEEEccccccccccccccccccccccccccccccHHHHHHHccccEEEEcccccccccHHHHHHHHccccccEEEEcccccccccccHHHHHHHcccc
cccHHHHccccccccccccccccccccccccccccccccccccEEEcccccHHHHccccccHHHccHHHHHHcccccccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHcccHHHHHHHHHHcHHHHHHHHcccHHHHHHHcHHHHccccccEEEEHHHcccHHHHHcccccccccEEEEEccccEcccEccHHHHHHHHHHHHHHHHHHHcccHHHEEEEEEEcccccHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHccccEEEEccccHHHHHHHHHHHcccccEEEccccHHHHHHHHHHHHHHHHHccccccccEEEEcccHHHHHHHHHHHHHHHcccccHHHHHHcHEEEEccccEEcEcccccccHHHccccEcccccccHHHHHHHHcccEEEEcccccccccHHHHHHHHHHccccEEEEccccHHHccccHHHHHHccccc
mesttntmvngsdldnnnaaggggvvdvygedfatedqlitpwtvsvasgytllrdprhnkglaftenerDAHYLrgllppalmnQELQEKRLMHNLRQYKVPLQRYVAMMDLQERNERLFYKLLIDNVEEllpvvytptvgeACQKYgsifrrpqglyisLKEKGKILEVLknwperniQVIVVTdgerilglgdlgcqgmgipvgKLSLYTalgglrpsaclpitidvgtnneqllndeFYIGLRQKRATGQEYAELLQEFMTAVKQNYGEKVLIQFEDFANHNAFELLSKYSsshlvfnddiqGTASVVLAGILSALKlvggtladqtflflgageaGTGIAELIALEMSKQTKAPIEEARKKIWLVDSKGLIVSSRKESLqhfkkpwahehapIKSLLDAVKAikptmlmgtsgvgkTFTKEVVEAMASfnekpvifalsnptsqsectaeeAYTWSKVN
mesttntmvngsdldnnnaagGGGVVDVYGEDFATEDQLITPWTVSVASGYTLLRDPRHNKGLAFTENERDAHYLRGLLPPALMNQELQEKRLMHNLRQYKVPLQRYVAMMDLQERNERLFYKLLIDNVEELLPVVYTPTVGEACQKYGSIFRRPQGLYISLKEKGKILEVlknwperniqVIVVTDGERILGLGDLGCQGMGIPVGKLSLYTALGGLRPSACLPITIDVGTNNEQLLNDEFYIGLRQKRATGQEYAELLQEFMTAVKQNYGEKVLIQFEDFANHNAFELLSKYSSSHLVFNDDIQGTASVVLAGILSALKLVGGTLADQTFLFLGAGEAGTGIAELIALEMSKQTKAPIEEARKKIWLVDSKGLIVSSRKESLQHFkkpwahehapIKSLLDAVKAIKPTMLMGTSGVGKTFTKEVVEAMASFNEKPVIFAlsnptsqsectaeeaytwskvn
MESTTNTMVNGSDLdnnnaaggggvvdvYGEDFATEDQLITPWTVSVASGYTLLRDPRHNKGLAFTENERDAHYLRGLLPPALMNQELQEKRLMHNLRQYKVPLQRYVAMMDLQERNERLFYKLLIDNVEELLPVVYTPTVGEACQKYGSIFRRPQGLYISLKEKGKILEVLKNWPERNIQVIVVTDGERILGLGDLGCQGMGIPVGKLSLYTALGGLRPSACLPITIDVGTNNEQLLNDEFYIGLRQKRATGQEYAELLQEFMTAVKQNYGEKVLIQFEDFANHNAFELLSKYSSSHLVFNDDIQGTASVVLAGILSALKLVGGTLADQTFLFLGAGEAGTGIAELIALEMSKQTKAPIEEARKKIWLVDSKGLIVSSRKESLQHFKKPWAHEHAPIKSLLDAVKAIKPTMLMGTSGVGKTFTKEVVEAMASFNEKPVIFALSNPTSQSECTAEEAYTWSKVN
*********************GGGVVDVYGEDFATEDQLITPWTVSVASGYTLLRDPRHNKGLAFTENERDAHYLRGLLPPALMNQELQEKRLMHNLRQYKVPLQRYVAMMDLQERNERLFYKLLIDNVEELLPVVYTPTVGEACQKYGSIFRRPQGLYISLKEKGKILEVLKNWPERNIQVIVVTDGERILGLGDLGCQGMGIPVGKLSLYTALGGLRPSACLPITIDVGTNNEQLLNDEFYIGLRQKRATGQEYAELLQEFMTAVKQNYGEKVLIQFEDFANHNAFELLSKYSSSHLVFNDDIQGTASVVLAGILSALKLVGGTLADQTFLFLGAGEAGTGIAELIALEMSKQTKAPIEEARKKIWLVDSKGLIVSSRKESLQHFKKPWAHEHAPIKSLLDAVKAIKPTMLMGTSGVGKTFTKEVVEAMASFNEKPVIFAL*********************
******************************EDFATEDQLITPWTVSVASGYTLLRDPRHNKGLAFTENERDAHYLRGLLPPALMNQELQEKRLMHNLRQYKVPLQRYVAMMDLQERNERLFYKLLIDNVEELLPVVYTPTVGEACQKYGSIFRRPQGLYISLKEKGKILEVLKNWPERNIQVIVVTDGERILGLGDLGCQGMGIPVGKLSLYTALGGLRPSACLPITIDVGTNNEQLLNDEFYIGLRQKRATGQEYAELLQEFMTAVKQNYGEKVLIQFEDFANHNAFELLSKYSSSHLVFNDDIQGTASVVLAGILSALKLVGGTLADQTFLFLGAGEAGTGIAELIALEMSKQT**P*EEARKKIWLVDSKGLIVSSRKESLQHFKKPWAHEHAPIKSLLDAVKAIKPTMLMGTSGVGKTFTKEVVEAMASFNEKPVIFALSNPTSQSECTAEEAYTWSKV*
********VNGSDLDNNNAAGGGGVVDVYGEDFATEDQLITPWTVSVASGYTLLRDPRHNKGLAFTENERDAHYLRGLLPPALMNQELQEKRLMHNLRQYKVPLQRYVAMMDLQERNERLFYKLLIDNVEELLPVVYTPTVGEACQKYGSIFRRPQGLYISLKEKGKILEVLKNWPERNIQVIVVTDGERILGLGDLGCQGMGIPVGKLSLYTALGGLRPSACLPITIDVGTNNEQLLNDEFYIGLRQKRATGQEYAELLQEFMTAVKQNYGEKVLIQFEDFANHNAFELLSKYSSSHLVFNDDIQGTASVVLAGILSALKLVGGTLADQTFLFLGAGEAGTGIAELIALEMSKQTKAPIEEARKKIWLVDSKGLIVSSRKESLQHFKKPWAHEHAPIKSLLDAVKAIKPTMLMGTSGVGKTFTKEVVEAMASFNEKPVIFALSN*******************
****************************YGEDFATEDQLITPWTVSVASGYTLLRDPRHNKGLAFTENERDAHYLRGLLPPALMNQELQEKRLMHNLRQYKVPLQRYVAMMDLQERNERLFYKLLIDNVEELLPVVYTPTVGEACQKYGSIFRRPQGLYISLKEKGKILEVLKNWPERNIQVIVVTDGERILGLGDLGCQGMGIPVGKLSLYTALGGLRPSACLPITIDVGTNNEQLLNDEFYIGLRQKRATGQEYAELLQEFMTAVKQNYGEKVLIQFEDFANHNAFELLSKYSSSHLVFNDDIQGTASVVLAGILSALKLVGGTLADQTFLFLGAGEAGTGIAELIALEMSKQTKAPIEEARKKIWLVDSKGLIVSSRKESLQHFKKPWAHEHAPIKSLLDAVKAIKPTMLMGTSGVGKTFTKEVVEAMASFNEKPVIFALSNPTSQSECTAEEAYTWS***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MESTTNTMVNGSDLDNNNAAGGGGVVDVYGEDFATEDQLITPWTVSVASGYTLLRDPRHNKGLAFTENERDAHYLRGLLPPALMNQELQEKRLMHNLRQYKVPLQRYVAMMDLQERNERLFYKLLIDNVEELLPVVYTPTVGEACQKYGSIFRRPQGLYISLKEKGKILEVLKNWPERNIQVIVVTDGERILGLGDLGCQGMGIPVGKLSLYTALGGLRPSACLPITIDVGTNNEQLLNDEFYIGLRQKRATGQEYAELLQEFMTAVKQNYGEKVLIQFEDFANHNAFELLSKYSSSHLVFNDDIQGTASVVLAGILSALKLVGGTLADQTFLFLGAGEAGTGIAELIALEMSKQTKAPIEEARKKIWLVDSKGLIVSSRKESLQHFKKPWAHEHAPIKSLLDAVKAIKPTMLMGTSGVGKTFTKEVVEAMASFNEKPVIFALSNPTSQSECTAEEAYTWSKVN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query464 2.2.26 [Sep-21-2011]
P12628 589 NADP-dependent malic enzy N/A no 0.991 0.780 0.848 0.0
P34105 591 NADP-dependent malic enzy yes no 0.993 0.780 0.825 0.0
P51615 591 NADP-dependent malic enzy no no 0.993 0.780 0.834 0.0
Q9LYG3 588 NADP-dependent malic enzy yes no 0.989 0.780 0.819 0.0
P36444 647 NADP-dependent malic enzy N/A no 0.978 0.701 0.817 0.0
P43279 639 NADP-dependent malic enzy no no 0.946 0.687 0.846 0.0
Q9XGZ0 588 NADP-dependent malic enzy no no 0.989 0.780 0.812 0.0
Q9CA83 646 NADP-dependent malic enzy no no 0.948 0.681 0.822 0.0
O82191 581 NADP-dependent malic enzy no no 0.978 0.781 0.798 0.0
P37223 585 NADP-dependent malic enzy N/A no 0.971 0.770 0.792 0.0
>sp|P12628|MAOX_PHAVU NADP-dependent malic enzyme OS=Phaseolus vulgaris GN=ME1 PE=2 SV=1 Back     alignment and function desciption
 Score =  820 bits (2118), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/461 (84%), Positives = 426/461 (92%), Gaps = 1/461 (0%)

Query: 3   STTNTMVNGSDLD-NNNAAGGGGVVDVYGEDFATEDQLITPWTVSVASGYTLLRDPRHNK 61
           S+ +   NG ++    + + GGGV D+YGED ATED LITPWT SVASG +LLRDPR+NK
Sbjct: 2   SSISLKENGGEVSVKKDYSNGGGVRDLYGEDSATEDHLITPWTFSVASGCSLLRDPRYNK 61

Query: 62  GLAFTENERDAHYLRGLLPPALMNQELQEKRLMHNLRQYKVPLQRYVAMMDLQERNERLF 121
           GLAFTE ERDAHYLRGLLPP++ NQELQEKRLMHNLRQY+VPL RY+A+MDLQERNERLF
Sbjct: 62  GLAFTEGERDAHYLRGLLPPSVFNQELQEKRLMHNLRQYEVPLHRYMALMDLQERNERLF 121

Query: 122 YKLLIDNVEELLPVVYTPTVGEACQKYGSIFRRPQGLYISLKEKGKILEVLKNWPERNIQ 181
           YKLLIDNV ELLPVVYTPTVGEACQKYGSIFRRPQGLYISLKEKGKILEVLKNWPE++IQ
Sbjct: 122 YKLLIDNVAELLPVVYTPTVGEACQKYGSIFRRPQGLYISLKEKGKILEVLKNWPEKSIQ 181

Query: 182 VIVVTDGERILGLGDLGCQGMGIPVGKLSLYTALGGLRPSACLPITIDVGTNNEQLLNDE 241
           VIVVTDGERILGLGDLGCQGMGIPVGKLSLYTALGG+RPS+CLP+TIDVGTNNE+LLNDE
Sbjct: 182 VIVVTDGERILGLGDLGCQGMGIPVGKLSLYTALGGVRPSSCLPVTIDVGTNNEKLLNDE 241

Query: 242 FYIGLRQKRATGQEYAELLQEFMTAVKQNYGEKVLIQFEDFANHNAFELLSKYSSSHLVF 301
           FYIGLRQ+RATGQEYA  L EFM AVKQNYGEKVL+QFEDFANHNAF+LL KYSSSHLVF
Sbjct: 242 FYIGLRQRRATGQEYATFLDEFMRAVKQNYGEKVLVQFEDFANHNAFDLLEKYSSSHLVF 301

Query: 302 NDDIQGTASVVLAGILSALKLVGGTLADQTFLFLGAGEAGTGIAELIALEMSKQTKAPIE 361
           NDDIQGTASVVLAG+L++LKLVGGTLAD TFLFLGAGEAGTGIAELIA+E+SKQTKAP+E
Sbjct: 302 NDDIQGTASVVLAGLLASLKLVGGTLADHTFLFLGAGEAGTGIAELIAVEVSKQTKAPVE 361

Query: 362 EARKKIWLVDSKGLIVSSRKESLQHFKKPWAHEHAPIKSLLDAVKAIKPTMLMGTSGVGK 421
           E RKKIWLVDSKGLIVSSR ESLQ FKKPWAHEH P+K LL+AVKAIKPT+L+G+SG GK
Sbjct: 362 ETRKKIWLVDSKGLIVSSRLESLQQFKKPWAHEHEPVKGLLEAVKAIKPTVLIGSSGAGK 421

Query: 422 TFTKEVVEAMASFNEKPVIFALSNPTSQSECTAEEAYTWSK 462
           TFTKEVVE MAS NEKP+I ALSNPTSQSECTAEEAYTWSK
Sbjct: 422 TFTKEVVETMASLNEKPLILALSNPTSQSECTAEEAYTWSK 462

Phaseolus vulgaris (taxid: 3885)
EC: 1EC: .EC: 1EC: .EC: 1EC: .EC: 4EC: 0
>sp|P34105|MAOX_POPTR NADP-dependent malic enzyme OS=Populus trichocarpa PE=2 SV=3 Back     alignment and function description
>sp|P51615|MAOX_VITVI NADP-dependent malic enzyme OS=Vitis vinifera PE=2 SV=1 Back     alignment and function description
>sp|Q9LYG3|MAOP2_ARATH NADP-dependent malic enzyme 2 OS=Arabidopsis thaliana GN=NADP-ME2 PE=1 SV=1 Back     alignment and function description
>sp|P36444|MAOC_FLAPR NADP-dependent malic enzyme, chloroplastic OS=Flaveria pringlei GN=MODA PE=2 SV=1 Back     alignment and function description
>sp|P43279|MAOC_ORYSJ NADP-dependent malic enzyme, chloroplastic OS=Oryza sativa subsp. japonica GN=ME6 PE=2 SV=2 Back     alignment and function description
>sp|Q9XGZ0|MAOP3_ARATH NADP-dependent malic enzyme 3 OS=Arabidopsis thaliana GN=NADP-ME3 PE=1 SV=1 Back     alignment and function description
>sp|Q9CA83|MAOP4_ARATH NADP-dependent malic enzyme 4, chloroplastic OS=Arabidopsis thaliana GN=NADP-ME4 PE=1 SV=1 Back     alignment and function description
>sp|O82191|MAOP1_ARATH NADP-dependent malic enzyme 1 OS=Arabidopsis thaliana GN=NADP-ME1 PE=1 SV=1 Back     alignment and function description
>sp|P37223|MAOX_MESCR NADP-dependent malic enzyme OS=Mesembryanthemum crystallinum GN=MOD1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query464
359475960 585 PREDICTED: NADP-dependent malic enzyme-l 0.976 0.774 0.883 0.0
296081563 575 unnamed protein product [Vitis vinifera] 0.956 0.772 0.896 0.0
356515635 589 PREDICTED: NADP-dependent malic enzyme-l 0.989 0.779 0.876 0.0
255550956 588 malic enzyme, putative [Ricinus communis 0.984 0.777 0.893 0.0
356507937 588 PREDICTED: NADP-dependent malic enzyme-l 0.991 0.782 0.872 0.0
255546341 591 malic enzyme, putative [Ricinus communis 0.993 0.780 0.836 0.0
510876 589 NADP dependent malic enzyme [Phaseolus v 0.991 0.780 0.859 0.0
4239891 585 NADP-malic enzyme [Aloe arborescens] 0.967 0.767 0.866 0.0
224142207 591 predicted protein [Populus trichocarpa] 0.993 0.780 0.834 0.0
115462465 570 Os05g0186300 [Oryza sativa Japonica Grou 0.952 0.775 0.868 0.0
>gi|359475960|ref|XP_003631773.1| PREDICTED: NADP-dependent malic enzyme-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  847 bits (2187), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/454 (88%), Positives = 435/454 (95%), Gaps = 1/454 (0%)

Query: 9   VNGSDLDNNNAAGGGGVVDVYGEDFATEDQLITPWTVSVASGYTLLRDPRHNKGLAFTEN 68
           V+G D++   + GGGGV D+YGED ATEDQL+TPWTVSVASGYTLLRDP HNKGLAFTEN
Sbjct: 6   VSGLDMEKK-SGGGGGVEDIYGEDSATEDQLVTPWTVSVASGYTLLRDPHHNKGLAFTEN 64

Query: 69  ERDAHYLRGLLPPALMNQELQEKRLMHNLRQYKVPLQRYVAMMDLQERNERLFYKLLIDN 128
           ERDAHYLRGLLPPA++NQ+LQEKRLMHNLRQYKVPLQRY+AMMDLQERNERLFYKLLIDN
Sbjct: 65  ERDAHYLRGLLPPAVLNQDLQEKRLMHNLRQYKVPLQRYMAMMDLQERNERLFYKLLIDN 124

Query: 129 VEELLPVVYTPTVGEACQKYGSIFRRPQGLYISLKEKGKILEVLKNWPERNIQVIVVTDG 188
           VEELLPVVYTPTVGEACQKYGSIFRRPQGLYISLKEKGKILEVLKNWPER+IQVIVVTDG
Sbjct: 125 VEELLPVVYTPTVGEACQKYGSIFRRPQGLYISLKEKGKILEVLKNWPERSIQVIVVTDG 184

Query: 189 ERILGLGDLGCQGMGIPVGKLSLYTALGGLRPSACLPITIDVGTNNEQLLNDEFYIGLRQ 248
           ERILGLGDLGCQGMGIPVGKLSLYTALGGLRPSACLP+TIDVGTNNEQLL DEFYIGL+Q
Sbjct: 185 ERILGLGDLGCQGMGIPVGKLSLYTALGGLRPSACLPVTIDVGTNNEQLLKDEFYIGLKQ 244

Query: 249 KRATGQEYAELLQEFMTAVKQNYGEKVLIQFEDFANHNAFELLSKYSSSHLVFNDDIQGT 308
           +RATGQEYAELL EFM AVKQNYGE+VLIQFEDFANHNAFELL+KYS +HLVFNDDIQGT
Sbjct: 245 RRATGQEYAELLHEFMCAVKQNYGERVLIQFEDFANHNAFELLAKYSKTHLVFNDDIQGT 304

Query: 309 ASVVLAGILSALKLVGGTLADQTFLFLGAGEAGTGIAELIALEMSKQTKAPIEEARKKIW 368
           ASVVLAG++++LKLVGG+LA+ TFLFLGAGEAGTGIAELIALE+SKQTKAP+EE RKKIW
Sbjct: 305 ASVVLAGLIASLKLVGGSLAEHTFLFLGAGEAGTGIAELIALEISKQTKAPLEETRKKIW 364

Query: 369 LVDSKGLIVSSRKESLQHFKKPWAHEHAPIKSLLDAVKAIKPTMLMGTSGVGKTFTKEVV 428
           LVDSKGLIV SR ESLQHFKKPWAH+H PI++LLDAVK+IKPT+L+G+SGVGKTFTKEVV
Sbjct: 365 LVDSKGLIVHSRMESLQHFKKPWAHDHEPIRALLDAVKSIKPTVLIGSSGVGKTFTKEVV 424

Query: 429 EAMASFNEKPVIFALSNPTSQSECTAEEAYTWSK 462
           EAM SFN+KP+I ALSNPTSQSECTAEEAYTWSK
Sbjct: 425 EAMTSFNKKPLILALSNPTSQSECTAEEAYTWSK 458

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|296081563|emb|CBI20568.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356515635|ref|XP_003526504.1| PREDICTED: NADP-dependent malic enzyme-like [Glycine max] Back     alignment and taxonomy information
>gi|255550956|ref|XP_002516526.1| malic enzyme, putative [Ricinus communis] gi|223544346|gb|EEF45867.1| malic enzyme, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356507937|ref|XP_003522719.1| PREDICTED: NADP-dependent malic enzyme-like [Glycine max] Back     alignment and taxonomy information
>gi|255546341|ref|XP_002514230.1| malic enzyme, putative [Ricinus communis] gi|223546686|gb|EEF48184.1| malic enzyme, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|510876|emb|CAA56354.1| NADP dependent malic enzyme [Phaseolus vulgaris] Back     alignment and taxonomy information
>gi|4239891|dbj|BAA74735.1| NADP-malic enzyme [Aloe arborescens] Back     alignment and taxonomy information
>gi|224142207|ref|XP_002324450.1| predicted protein [Populus trichocarpa] gi|222865884|gb|EEF03015.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|115462465|ref|NP_001054832.1| Os05g0186300 [Oryza sativa Japonica Group] gi|37694731|gb|AAQ99276.1| NADP malic enzyme [Oryza sativa Japonica Group] gi|113578383|dbj|BAF16746.1| Os05g0186300 [Oryza sativa Japonica Group] gi|125551105|gb|EAY96814.1| hypothetical protein OsI_18741 [Oryza sativa Indica Group] gi|215687316|dbj|BAG91903.1| unnamed protein product [Oryza sativa Japonica Group] gi|215708752|dbj|BAG94021.1| unnamed protein product [Oryza sativa Japonica Group] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query464
TAIR|locus:2181980 588 NADP-ME2 "NADP-malic enzyme 2" 0.989 0.780 0.806 5e-202
TAIR|locus:2180547 588 NADP-ME3 "NADP-malic enzyme 3" 0.989 0.780 0.799 3.5e-201
TAIR|locus:2017854 646 NADP-ME4 "NADP-malic enzyme 4" 0.935 0.671 0.822 9.7e-199
TAIR|locus:2052045 581 NADP-ME1 "NADP-malic enzyme 1" 0.935 0.746 0.820 1.3e-196
UNIPROTKB|F1P0Y6 576 ME1 "Malic enzyme" [Gallus gal 0.903 0.727 0.555 1.3e-125
RGD|3074 572 Me1 "malic enzyme 1, NADP(+)-d 0.885 0.718 0.576 2.6e-125
UNIPROTKB|P13697 572 Me1 "NADP-dependent malic enzy 0.885 0.718 0.576 2.6e-125
MGI|MGI:97043 572 Me1 "malic enzyme 1, NADP(+)-d 0.885 0.718 0.571 8.9e-125
UNIPROTKB|Q29558 557 ME1 "NADP-dependent malic enzy 0.879 0.732 0.565 2.7e-123
UNIPROTKB|P48163 572 ME1 "NADP-dependent malic enzy 0.885 0.718 0.559 5.7e-123
TAIR|locus:2181980 NADP-ME2 "NADP-malic enzyme 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1955 (693.3 bits), Expect = 5.0e-202, P = 5.0e-202
 Identities = 370/459 (80%), Positives = 414/459 (90%)

Query:     4 TTNTMVNGSDLXXXXXXXXXXXXXXYGEDFATEDQLITPWTVSVASGYTLLRDPRHNKGL 63
             +T T + G D+              YGED AT DQL+TPW  SVASGYTL+RDPR+NKGL
Sbjct:     3 STPTDLPGEDVADNRSGVGGGISDVYGEDSATLDQLVTPWVTSVASGYTLMRDPRYNKGL 62

Query:    64 AFTENERDAHYLRGLLPPALMNQELQEKRLMHNLRQYKVPLQRYVAMMDLQERNERLFYK 123
             AFT+ ERDAHYL GLLPP +++Q++QE+++MHNLRQY VPLQRY+A+MDLQERNERLFYK
Sbjct:    63 AFTDKERDAHYLTGLLPPVILSQDVQERKVMHNLRQYTVPLQRYMALMDLQERNERLFYK 122

Query:   124 LLIDNVEELLPVVYTPTVGEACQKYGSIFRRPQGLYISLKEKGKILEVLKNWPERNIQVI 183
             LLIDNVEELLPVVYTPTVGEACQKYGSIFR+PQGLYISL EKGKILEVLKNWP+R IQVI
Sbjct:   123 LLIDNVEELLPVVYTPTVGEACQKYGSIFRKPQGLYISLNEKGKILEVLKNWPQRGIQVI 182

Query:   184 VVTDGERILGLGDLGCQGMGIPVGKLSLYTALGGLRPSACLPITIDVGTNNEQLLNDEFY 243
             VVTDGERILGLGDLGCQGMGIPVGKLSLYTALGG+RPSACLPITIDVGTNNE+LLNDEFY
Sbjct:   183 VVTDGERILGLGDLGCQGMGIPVGKLSLYTALGGIRPSACLPITIDVGTNNEKLLNDEFY 242

Query:   244 IGLRQKRATGQEYAELLQEFMTAVKQNYGEKVLIQFEDFANHNAFELLSKYSSSHLVFND 303
             IGL+Q+RATGQEYAE L EFM AVKQNYGEKVL+QFEDFANHNAF+LLSKYS SHLVFND
Sbjct:   243 IGLKQRRATGQEYAEFLHEFMCAVKQNYGEKVLVQFEDFANHNAFDLLSKYSDSHLVFND 302

Query:   304 DIQGTASVVLAGILSALKLVGGTLADQTFLFLGAGEAGTGIAELIALEMSKQTKAPIEEA 363
             DIQGTASVVLAG+++A K++G  LAD TFLFLGAGEAGTGIAELIAL++SK+T API E 
Sbjct:   303 DIQGTASVVLAGLIAAQKVLGKKLADHTFLFLGAGEAGTGIAELIALKISKETGAPITET 362

Query:   364 RKKIWLVDSKGLIVSSRKESLQHFKKPWAHEHAPIKSLLDAVKAIKPTMLMGTSGVGKTF 423
             RKKIWLVDSKGLIVSSRKESLQHFK+PWAHEH P+K L+ AV AIKPT+L+GTSGVG+TF
Sbjct:   363 RKKIWLVDSKGLIVSSRKESLQHFKQPWAHEHKPVKDLIGAVNAIKPTVLIGTSGVGQTF 422

Query:   424 TKEVVEAMASFNEKPVIFALSNPTSQSECTAEEAYTWSK 462
             TKEVVEAMA+ NEKP+I ALSNPTSQ+ECTAE+AYTW+K
Sbjct:   423 TKEVVEAMATNNEKPLILALSNPTSQAECTAEQAYTWTK 461
GO:0000166 "nucleotide binding" evidence=IEA
GO:0004470 "malic enzyme activity" evidence=IEA;ISS
GO:0006108 "malate metabolic process" evidence=IEA;ISS;IDA;TAS
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0016616 "oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor" evidence=IEA
GO:0016619 "malate dehydrogenase (oxaloacetate-decarboxylating) activity" evidence=IEA
GO:0016652 "oxidoreductase activity, acting on NAD(P)H, NAD(P) as acceptor" evidence=ISS
GO:0046872 "metal ion binding" evidence=IEA
GO:0051287 "NAD binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0004473 "malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+) activity" evidence=IDA
GO:0009051 "pentose-phosphate shunt, oxidative branch" evidence=TAS
GO:0051260 "protein homooligomerization" evidence=IDA
GO:0005618 "cell wall" evidence=IDA
GO:0046686 "response to cadmium ion" evidence=IEP;RCA
GO:0005774 "vacuolar membrane" evidence=IDA
GO:0005886 "plasma membrane" evidence=IDA
GO:0016020 "membrane" evidence=IDA
GO:0048046 "apoplast" evidence=IDA
GO:0005829 "cytosol" evidence=IDA
GO:0009506 "plasmodesma" evidence=IDA
GO:0006094 "gluconeogenesis" evidence=RCA
GO:0006612 "protein targeting to membrane" evidence=RCA
GO:0006970 "response to osmotic stress" evidence=RCA
GO:0007010 "cytoskeleton organization" evidence=RCA
GO:0009963 "positive regulation of flavonoid biosynthetic process" evidence=RCA
GO:0010363 "regulation of plant-type hypersensitive response" evidence=RCA
GO:0010498 "proteasomal protein catabolic process" evidence=RCA
GO:0048767 "root hair elongation" evidence=RCA
TAIR|locus:2180547 NADP-ME3 "NADP-malic enzyme 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2017854 NADP-ME4 "NADP-malic enzyme 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2052045 NADP-ME1 "NADP-malic enzyme 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|F1P0Y6 ME1 "Malic enzyme" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
RGD|3074 Me1 "malic enzyme 1, NADP(+)-dependent, cytosolic" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P13697 Me1 "NADP-dependent malic enzyme" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:97043 Me1 "malic enzyme 1, NADP(+)-dependent, cytosolic" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q29558 ME1 "NADP-dependent malic enzyme" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|P48163 ME1 "NADP-dependent malic enzyme" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P06801MAOX_MOUSE1, ., 1, ., 1, ., 4, 00.57140.88570.7185yesno
P13697MAOX_RAT1, ., 1, ., 1, ., 4, 00.57620.88570.7185yesno
Q29558MAOX_PIG1, ., 1, ., 1, ., 4, 00.56170.88570.7378yesno
P34105MAOX_POPTR1, ., 1, ., 1, ., 4, 00.82580.99350.7800yesno
Q9LYG3MAOP2_ARATH1, ., 1, ., 1, ., 4, 00.81910.98920.7806yesno
P22178MAOC_FLATR1, ., 1, ., 1, ., 4, 00.80670.95680.6851N/Ano
P37222MAOC_SOLLC1, ., 1, ., 1, ., 4, 00.79540.94610.7661N/Ano
P37223MAOX_MESCR1, ., 1, ., 1, ., 4, 00.79210.97190.7709N/Ano
P48163MAOX_HUMAN1, ., 1, ., 1, ., 4, 00.55930.88570.7185yesno
P12628MAOX_PHAVU1, ., 1, ., 1, ., 4, 00.84810.99130.7809N/Ano
P16243MAOC_MAIZE1, ., 1, ., 1, ., 4, 00.82500.91160.6650N/Ano
P36444MAOC_FLAPR1, ., 1, ., 1, ., 4, 00.81710.97840.7017N/Ano

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.1.10.976
4th Layer1.1.1.400.991

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00032092001
RecName- Full=Malic enzyme; (583 aa)
(Vitis vinifera)
Predicted Functional Partners:
GPEPC
RecName- Full=Phosphoenolpyruvate carboxylase; EC=4.1.1.31; (965 aa)
      • 0.483
GSVIVG00019865001
SubName- Full=Chromosome chr5 scaffold_2, whole genome shotgun sequence; (961 aa)
     •• 0.407

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query464
PLN03129 581 PLN03129, PLN03129, NADP-dependent malic enzyme; P 0.0
PRK13529 563 PRK13529, PRK13529, malate dehydrogenase; Provisio 0.0
PTZ00317 559 PTZ00317, PTZ00317, NADP-dependent malic enzyme; P 0.0
pfam00390182 pfam00390, malic, Malic enzyme, N-terminal domain 1e-106
cd05312 279 cd05312, NAD_bind_1_malic_enz, NAD(P) binding doma 8e-85
COG0281 432 COG0281, SfcA, Malic enzyme [Energy production and 2e-82
pfam03949255 pfam03949, Malic_M, Malic enzyme, NAD binding doma 9e-75
smart00919231 smart00919, Malic_M, Malic enzyme, NAD binding dom 1e-63
cd00762254 cd00762, NAD_bind_malic_enz, NAD(P) binding domain 1e-52
cd05311226 cd05311, NAD_bind_2_malic_enz, NAD(P) binding doma 5e-22
PRK12862 763 PRK12862, PRK12862, malic enzyme; Reviewed 2e-17
PRK07232 752 PRK07232, PRK07232, bifunctional malic enzyme oxid 2e-17
PRK12861 764 PRK12861, PRK12861, malic enzyme; Reviewed 4e-12
cd0519186 cd05191, NAD_bind_amino_acid_DH, NAD(P) binding do 4e-09
>gnl|CDD|215594 PLN03129, PLN03129, NADP-dependent malic enzyme; Provisional Back     alignment and domain information 
 Score =  901 bits (2331), Expect = 0.0
 Identities = 330/441 (74%), Positives = 380/441 (86%), Gaps = 1/441 (0%)

Query: 22  GGGVVDVYGEDFATEDQLITPWTVSVASGYTLLRDPRHNKGLAFTENERDAHYLRGLLPP 81
            GGV DVYGED ATE+Q +TPW   VASGY LLRDPR+NKGLAFTE ERD   LRGLLPP
Sbjct: 15  AGGVEDVYGEDAATEEQPVTPWVR-VASGYDLLRDPRYNKGLAFTETERDRLGLRGLLPP 73

Query: 82  ALMNQELQEKRLMHNLRQYKVPLQRYVAMMDLQERNERLFYKLLIDNVEELLPVVYTPTV 141
           A+++QELQ KR M NLR  + PL +Y A+MDLQERNERLFY++LIDN+EELLP+VYTPTV
Sbjct: 74  AVLSQELQVKRFMENLRALESPLAKYRALMDLQERNERLFYRVLIDNIEELLPIVYTPTV 133

Query: 142 GEACQKYGSIFRRPQGLYISLKEKGKILEVLKNWPERNIQVIVVTDGERILGLGDLGCQG 201
           GEACQKYGS+FRRP+GLYISLK+KG++L +LKNWPER++QVIVVTDGERILGLGDLG QG
Sbjct: 134 GEACQKYGSLFRRPRGLYISLKDKGRVLSMLKNWPERDVQVIVVTDGERILGLGDLGVQG 193

Query: 202 MGIPVGKLSLYTALGGLRPSACLPITIDVGTNNEQLLNDEFYIGLRQKRATGQEYAELLQ 261
           MGIPVGKL LYTA GG+RPSA LP+ IDVGTNNE+LLND FYIGLRQ R TG+EY EL+ 
Sbjct: 194 MGIPVGKLDLYTAAGGIRPSAVLPVCIDVGTNNEKLLNDPFYIGLRQPRLTGEEYDELVD 253

Query: 262 EFMTAVKQNYGEKVLIQFEDFANHNAFELLSKYSSSHLVFNDDIQGTASVVLAGILSALK 321
           EFM AVKQ +G KVL+QFEDFAN NAF LL +Y ++HL FNDDIQGTA+V LAG+L+AL+
Sbjct: 254 EFMEAVKQRWGPKVLVQFEDFANKNAFRLLQRYRTTHLCFNDDIQGTAAVALAGLLAALR 313

Query: 322 LVGGTLADQTFLFLGAGEAGTGIAELIALEMSKQTKAPIEEARKKIWLVDSKGLIVSSRK 381
             GG LADQ  LF GAGEAGTGIAELIAL MS+QT    EEARK+IWLVDSKGL+  SRK
Sbjct: 314 ATGGDLADQRILFAGAGEAGTGIAELIALAMSRQTGISEEEARKRIWLVDSKGLVTKSRK 373

Query: 382 ESLQHFKKPWAHEHAPIKSLLDAVKAIKPTMLMGTSGVGKTFTKEVVEAMASFNEKPVIF 441
           +SLQ FKKP+AH+H P  SLL+AVKAIKPT+L+G SGVG TFTKEV+EAMAS NE+P+IF
Sbjct: 374 DSLQPFKKPFAHDHEPGASLLEAVKAIKPTVLIGLSGVGGTFTKEVLEAMASLNERPIIF 433

Query: 442 ALSNPTSQSECTAEEAYTWSK 462
           ALSNPTS++ECTAEEAYTW+ 
Sbjct: 434 ALSNPTSKAECTAEEAYTWTG 454

Length = 581
>gnl|CDD|237414 PRK13529, PRK13529, malate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|240357 PTZ00317, PTZ00317, NADP-dependent malic enzyme; Provisional Back     alignment and domain information
>gnl|CDD|215894 pfam00390, malic, Malic enzyme, N-terminal domain Back     alignment and domain information
>gnl|CDD|133454 cd05312, NAD_bind_1_malic_enz, NAD(P) binding domain of malic enzyme (ME), subgroup 1 Back     alignment and domain information
>gnl|CDD|223358 COG0281, SfcA, Malic enzyme [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|217809 pfam03949, Malic_M, Malic enzyme, NAD binding domain Back     alignment and domain information
>gnl|CDD|214912 smart00919, Malic_M, Malic enzyme, NAD binding domain Back     alignment and domain information
>gnl|CDD|133442 cd00762, NAD_bind_malic_enz, NAD(P) binding domain of malic enzyme Back     alignment and domain information
>gnl|CDD|133453 cd05311, NAD_bind_2_malic_enz, NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>gnl|CDD|183799 PRK12862, PRK12862, malic enzyme; Reviewed Back     alignment and domain information
>gnl|CDD|235976 PRK07232, PRK07232, bifunctional malic enzyme oxidoreductase/phosphotransacetylase; Reviewed Back     alignment and domain information
>gnl|CDD|183798 PRK12861, PRK12861, malic enzyme; Reviewed Back     alignment and domain information
>gnl|CDD|133449 cd05191, NAD_bind_amino_acid_DH, NAD(P) binding domain of amino acid dehydrogenase-like proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 464
KOG1257 582 consensus NADP+-dependent malic enzyme [Energy pro 100.0
PRK13529 563 malate dehydrogenase; Provisional 100.0
PTZ00317 559 NADP-dependent malic enzyme; Provisional 100.0
PLN03129 581 NADP-dependent malic enzyme; Provisional 100.0
COG0281 432 SfcA Malic enzyme [Energy production and conversio 100.0
PRK12861 764 malic enzyme; Reviewed 100.0
PRK12862 763 malic enzyme; Reviewed 100.0
PRK07232 752 bifunctional malic enzyme oxidoreductase/phosphotr 100.0
PF00390182 malic: Malic enzyme, N-terminal domain; InterPro: 100.0
PF03949255 Malic_M: Malic enzyme, NAD binding domain; InterPr 100.0
cd00762254 NAD_bind_malic_enz NAD(P) binding domain of malic 100.0
cd05312 279 NAD_bind_1_malic_enz NAD(P) binding domain of mali 100.0
cd05311226 NAD_bind_2_malic_enz NAD(P) binding domain of mali 99.97
cd0519186 NAD_bind_amino_acid_DH NAD(P) binding domain of am 98.93
PRK05476 425 S-adenosyl-L-homocysteine hydrolase; Provisional 97.62
TIGR01035 417 hemA glutamyl-tRNA reductase. This enzyme, togethe 97.52
cd00401 413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 97.41
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain 97.33
PRK00045 423 hemA glutamyl-tRNA reductase; Reviewed 97.29
PLN02477410 glutamate dehydrogenase 97.28
cd05211217 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of 97.28
PRK09414445 glutamate dehydrogenase; Provisional 97.23
PRK14031444 glutamate dehydrogenase; Provisional 97.09
PTZ00079454 NADP-specific glutamate dehydrogenase; Provisional 97.08
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 97.08
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 96.98
cd01076227 NAD_bind_1_Glu_DH NAD(P) binding domain of glutama 96.96
PRK14982340 acyl-ACP reductase; Provisional 96.96
TIGR00936 406 ahcY adenosylhomocysteinase. This enzyme hydrolyze 96.96
PLN02494 477 adenosylhomocysteinase 96.88
COG0373 414 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] 96.88
PRK14030445 glutamate dehydrogenase; Provisional 96.76
PLN00203 519 glutamyl-tRNA reductase 96.7
PLN00106 323 malate dehydrogenase 96.61
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 96.6
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 96.54
cd05313254 NAD_bind_2_Glu_DH NAD(P) binding domain of glutama 96.49
PRK14175286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.48
PRK14192283 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.46
PRK08306296 dipicolinate synthase subunit A; Reviewed 96.38
PRK13940 414 glutamyl-tRNA reductase; Provisional 96.32
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 96.11
PTZ00075 476 Adenosylhomocysteinase; Provisional 96.03
PRK12549284 shikimate 5-dehydrogenase; Reviewed 95.87
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 95.83
cd05197 425 GH4_glycoside_hydrolases Glycoside Hydrases Family 95.8
PRK05086 312 malate dehydrogenase; Provisional 95.77
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 95.71
cd05212140 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding dom 95.66
PF00670162 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase 95.57
PF0380796 F420_oxidored: NADP oxidoreductase coenzyme F420-d 95.56
PF00056141 Ldh_1_N: lactate/malate dehydrogenase, NAD binding 95.34
PTZ00325 321 malate dehydrogenase; Provisional 95.32
PRK00676338 hemA glutamyl-tRNA reductase; Validated 95.27
cd00650 263 LDH_MDH_like NAD-dependent, lactate dehydrogenase- 95.26
TIGR01809282 Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO 95.18
PRK14191285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.09
cd05291 306 HicDH_like L-2-hydroxyisocapronate dehydrogenases 95.01
PF00208244 ELFV_dehydrog: Glutamate/Leucine/Phenylalanine/Val 94.95
cd05296 419 GH4_P_beta_glucosidase Glycoside Hydrolases Family 94.81
PRK10792285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.73
cd01079197 NAD_bind_m-THF_DH NAD binding domain of methylene- 94.68
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 94.6
PRK00066 315 ldh L-lactate dehydrogenase; Reviewed 94.51
PRK09424 509 pntA NAD(P) transhydrogenase subunit alpha; Provis 94.49
cd05298 437 GH4_GlvA_pagL_like Glycoside Hydrolases Family 4; 94.31
cd00704 323 MDH Malate dehydrogenase. Malate dehydrogenase (MD 94.17
PRK14189285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.04
PRK14194301 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.82
PTZ00082 321 L-lactate dehydrogenase; Provisional 93.81
PTZ00117 319 malate dehydrogenase; Provisional 93.81
cd01337 310 MDH_glyoxysomal_mitochondrial Glyoxysomal and mito 93.74
COG0334411 GdhA Glutamate dehydrogenase/leucine dehydrogenase 93.66
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 93.63
PRK08223 287 hypothetical protein; Validated 93.62
PLN02928347 oxidoreductase family protein 93.58
PRK14176287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.53
PRK14178279 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.49
cd01336 325 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosoli 93.43
PRK08762376 molybdopterin biosynthesis protein MoeB; Validated 93.34
PRK06223 307 malate dehydrogenase; Reviewed 93.31
PRK00257 381 erythronate-4-phosphate dehydrogenase; Validated 93.29
PRK08328231 hypothetical protein; Provisional 93.28
PRK12475 338 thiamine/molybdopterin biosynthesis MoeB-like prot 93.25
TIGR01763 305 MalateDH_bact malate dehydrogenase, NAD-dependent. 93.19
PRK08644212 thiamine biosynthesis protein ThiF; Provisional 93.18
cd00757228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 93.1
PRK15076 431 alpha-galactosidase; Provisional 93.08
PRK05600 370 thiamine biosynthesis protein ThiF; Validated 93.05
PRK05442 326 malate dehydrogenase; Provisional 92.95
PRK12749288 quinate/shikimate dehydrogenase; Reviewed 92.9
TIGR02992326 ectoine_eutC ectoine utilization protein EutC. Mem 92.9
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 92.88
PRK08605332 D-lactate dehydrogenase; Validated 92.87
PRK08293 287 3-hydroxybutyryl-CoA dehydrogenase; Validated 92.85
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 92.59
TIGR02355240 moeB molybdopterin synthase sulfurylase MoeB. This 92.52
PRK14190284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 92.5
PF02056183 Glyco_hydro_4: Family 4 glycosyl hydrolase; InterP 92.5
PRK15438 378 erythronate-4-phosphate dehydrogenase PdxB; Provis 92.46
PRK14184286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 92.45
cd01338 322 MDH_choloroplast_like Chloroplast-like malate dehy 92.39
TIGR01772 312 MDH_euk_gproteo malate dehydrogenase, NAD-dependen 92.38
PRK14183281 bifunctional 5,10-methylene-tetrahydrofolate dehyd 92.27
COG0111324 SerA Phosphoglycerate dehydrogenase and related de 92.2
cd05297 423 GH4_alpha_glucosidase_galactosidase Glycoside Hydr 92.2
PF02882160 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cycl 92.15
PRK14027283 quinate/shikimate dehydrogenase; Provisional 92.14
PRK14177284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 92.08
TIGR01759 323 MalateDH-SF1 malate dehydrogenase. This model repr 91.95
cd05290 307 LDH_3 A subgroup of L-lactate dehydrogenases. L-la 91.94
PRK05690245 molybdopterin biosynthesis protein MoeB; Provision 91.86
PRK14172278 bifunctional 5,10-methylene-tetrahydrofolate dehyd 91.78
PRK14179284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 91.58
PLN02516299 methylenetetrahydrofolate dehydrogenase (NADP+) 91.44
PRK14851 679 hypothetical protein; Provisional 91.43
PRK12548289 shikimate 5-dehydrogenase; Provisional 91.39
PRK14619 308 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 91.35
PRK07634 245 pyrroline-5-carboxylate reductase; Reviewed 91.27
PRK14188296 bifunctional 5,10-methylene-tetrahydrofolate dehyd 91.18
PRK14171288 bifunctional 5,10-methylene-tetrahydrofolate dehyd 91.17
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily o 91.14
PRK07688 339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 91.0
PRK14174295 bifunctional 5,10-methylene-tetrahydrofolate dehyd 90.97
PRK00258278 aroE shikimate 5-dehydrogenase; Reviewed 90.89
cd05294 309 LDH-like_MDH_nadp A lactate dehydrogenases-like st 90.79
PRK14168297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 90.78
PRK14193284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 90.75
PRK14187294 bifunctional 5,10-methylene-tetrahydrofolate dehyd 90.69
COG1486 442 CelF Alpha-galactosidases/6-phospho-beta-glucosida 90.66
TIGR01915219 npdG NADPH-dependent F420 reductase. This model re 90.62
TIGR00561 511 pntA NAD(P) transhydrogenase, alpha subunit. In so 90.54
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 90.48
PRK14170284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 90.46
COG0169283 AroE Shikimate 5-dehydrogenase [Amino acid transpo 90.32
PRK14166282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 90.19
PRK05597 355 molybdopterin biosynthesis protein MoeB; Validated 90.18
TIGR01758 324 MDH_euk_cyt malate dehydrogenase, NAD-dependent. T 90.06
PRK08291330 ectoine utilization protein EutC; Validated 89.91
cd05293 312 LDH_1 A subgroup of L-lactate dehydrogenases. L-la 89.74
PTZ00345 365 glycerol-3-phosphate dehydrogenase; Provisional 89.71
PRK08374 336 homoserine dehydrogenase; Provisional 89.66
cd01339 300 LDH-like_MDH L-lactate dehydrogenase-like malate d 89.56
PRK07574385 formate dehydrogenase; Provisional 89.34
PRK00094 325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr 89.27
TIGR00872 298 gnd_rel 6-phosphogluconate dehydrogenase (decarbox 89.26
PLN02306386 hydroxypyruvate reductase 89.17
PRK07411 390 hypothetical protein; Validated 88.94
PRK14185293 bifunctional 5,10-methylene-tetrahydrofolate dehyd 88.92
PRK06129 308 3-hydroxyacyl-CoA dehydrogenase; Validated 88.81
PRK07878 392 molybdopterin biosynthesis-like protein MoeZ; Vali 88.77
COG0039 313 Mdh Malate/lactate dehydrogenases [Energy producti 88.73
PRK02842427 light-independent protochlorophyllide reductase su 88.65
PRK14169282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 88.52
PF01262168 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal 88.47
PRK09260 288 3-hydroxybutyryl-CoA dehydrogenase; Validated 88.41
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 88.28
PRK13243333 glyoxylate reductase; Reviewed 88.19
PRK06141314 ornithine cyclodeaminase; Validated 88.09
PRK14173287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 88.04
PRK14618 328 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 87.75
PRK06522 304 2-dehydropantoate 2-reductase; Reviewed 87.73
PRK14180282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 87.69
PRK12921 305 2-dehydropantoate 2-reductase; Provisional 87.63
PRK14181287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 87.6
PRK12550272 shikimate 5-dehydrogenase; Reviewed 87.59
PRK06130 311 3-hydroxybutyryl-CoA dehydrogenase; Validated 87.45
PLN02616364 tetrahydrofolate dehydrogenase/cyclohydrolase, put 87.41
COG0686371 Ald Alanine dehydrogenase [Amino acid transport an 87.16
PRK06436303 glycerate dehydrogenase; Provisional 87.13
PRK14167297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 87.08
PRK08410311 2-hydroxyacid dehydrogenase; Provisional 87.08
KOG0029 501 consensus Amine oxidase [Secondary metabolites bio 87.03
PRK07680 273 late competence protein ComER; Validated 86.99
PLN02602 350 lactate dehydrogenase 86.91
PRK14182282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 86.9
TIGR03140 515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 86.87
PRK15317 517 alkyl hydroperoxide reductase subunit F; Provision 86.84
cd05292 308 LDH_2 A subgroup of L-lactate dehydrogenases. L-la 86.47
TIGR01408 1008 Ube1 ubiquitin-activating enzyme E1. This model re 86.23
PF07992201 Pyr_redox_2: Pyridine nucleotide-disulphide oxidor 86.18
PRK09880343 L-idonate 5-dehydrogenase; Provisional 86.1
PRK12480330 D-lactate dehydrogenase; Provisional 86.07
PRK11880 267 pyrroline-5-carboxylate reductase; Reviewed 85.78
cd01485198 E1-1_like Ubiquitin activating enzyme (E1), repeat 85.64
PRK14186297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 85.62
PRK07066 321 3-hydroxybutyryl-CoA dehydrogenase; Validated 85.41
PRK06487317 glycerate dehydrogenase; Provisional 85.27
PRK15469312 ghrA bifunctional glyoxylate/hydroxypyruvate reduc 85.25
PRK12439 341 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 85.21
KOG0685 498 consensus Flavin-containing amine oxidase [Coenzym 85.04
PRK11790 409 D-3-phosphoglycerate dehydrogenase; Provisional 85.03
PRK15116 268 sulfur acceptor protein CsdL; Provisional 84.9
PLN02897345 tetrahydrofolate dehydrogenase/cyclohydrolase, put 84.61
KOG1495 332 consensus Lactate dehydrogenase [Energy production 84.22
PRK15409323 bifunctional glyoxylate/hydroxypyruvate reductase 84.18
PRK14620 326 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 84.17
cd01492197 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit 84.13
PRK09599 301 6-phosphogluconate dehydrogenase-like protein; Rev 84.1
TIGR00507270 aroE shikimate 5-dehydrogenase. This model finds p 84.03
TIGR01771 299 L-LDH-NAD L-lactate dehydrogenase. This model repr 83.95
TIGR02371325 ala_DH_arch alanine dehydrogenase, Archaeoglobus f 83.85
PRK07679 279 pyrroline-5-carboxylate reductase; Reviewed 83.46
PRK13581 526 D-3-phosphoglycerate dehydrogenase; Provisional 83.45
PRK09310477 aroDE bifunctional 3-dehydroquinate dehydratase/sh 83.17
PLN00112 444 malate dehydrogenase (NADP); Provisional 82.86
PLN03139386 formate dehydrogenase; Provisional 82.75
PRK07340304 ornithine cyclodeaminase; Validated 82.56
COG0345 266 ProC Pyrroline-5-carboxylate reductase [Amino acid 82.35
cd00755231 YgdL_like Family of activating enzymes (E1) of ubi 82.31
TIGR03376 342 glycerol3P_DH glycerol-3-phosphate dehydrogenase ( 82.01
cd01483143 E1_enzyme_family Superfamily of activating enzymes 81.99
TIGR01327 525 PGDH D-3-phosphoglycerate dehydrogenase. This mode 81.9
PRK06407301 ornithine cyclodeaminase; Provisional 81.88
cd00300 300 LDH_like L-lactate dehydrogenase-like enzymes. Mem 81.83
PRK06035 291 3-hydroxyacyl-CoA dehydrogenase; Validated 81.0
PF01113124 DapB_N: Dihydrodipicolinate reductase, N-terminus; 80.98
TIGR01381 664 E1_like_apg7 E1-like protein-activating enzyme Gsa 80.96
PRK08618325 ornithine cyclodeaminase; Validated 80.94
cd08237341 ribitol-5-phosphate_DH ribitol-5-phosphate dehydro 80.83
COG0190283 FolD 5,10-methylene-tetrahydrofolate dehydrogenase 80.63
TIGR03366280 HpnZ_proposed putative phosphonate catabolism asso 80.52
PRK06823315 ornithine cyclodeaminase; Validated 80.25
COG5322351 Predicted dehydrogenase [General function predicti 80.09
PLN02819 1042 lysine-ketoglutarate reductase/saccharopine dehydr 80.01
PRK08229 341 2-dehydropantoate 2-reductase; Provisional 80.01
>KOG1257 consensus NADP+-dependent malic enzyme [Energy production and conversion] Back     alignment and domain information 
Probab=100.00  E-value=5.8e-173  Score=1338.98  Aligned_cols=420  Identities=66%  Similarity=1.073  Sum_probs=415.8

Q ss_pred             ccccccccccccCCCCCcCCCCCHHHHhhcccCCCCCCcccCHHHHHHHHHHHhhcCCCchhHHHHhhhhhhhhhhhhHH
Q 012398           44 TVSVASGYTLLRDPRHNKGLAFTENERDAHYLRGLLPPALMNQELQEKRLMHNLRQYKVPLQRYVAMMDLQERNERLFYK  123 (464)
Q Consensus        44 ~~~~~~g~~~l~~p~~NkgtaFt~~ER~~lgl~GLlPp~v~t~e~Q~~r~~~~~~~~~~~l~Ky~~L~~L~~~Ne~Lfy~  123 (464)
                      ..+..+|+++|+||++|||+|||.+||++|||||||||.|+|+|+|++||+.+|+++++||+||+||++||+|||+|||+
T Consensus        25 ~~~~~~g~~ll~~p~~NKglAFTl~ERq~l~i~GLLPp~v~t~d~Q~~r~~~~l~~~~~~l~ky~~L~~L~~rNerLfY~  104 (582)
T KOG1257|consen   25 VESKKRGYDLLRDPRYNKGLAFTLEERQRLGIHGLLPPVVRTQDEQALRCMNNLRSLTSPLAKYIYLMDLQDRNERLFYR  104 (582)
T ss_pred             cccccCChhhccCCCcccccccCHHHHHhhCccccCCccccCHHHHHHHHHHHHHhccchHHHHHHHHHHHHhhhHHHHH
Confidence            45678999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HhhhcccccCCcccchhhHHHHHHHhhhhcCCCcccccccCcchHHHHHhcCCCCCeeEEEEecCceeeccCCCCCCccc
Q 012398          124 LLIDNVEELLPVVYTPTVGEACQKYGSIFRRPQGLYISLKEKGKILEVLKNWPERNIQVIVVTDGERILGLGDLGCQGMG  203 (464)
Q Consensus       124 ll~~~~~e~lpivYTPtVg~ac~~~s~i~r~p~gly~s~~d~g~i~~~l~n~~~~~v~viVVTDG~rILGLGDlG~~gm~  203 (464)
                      +|++|++|+||||||||||+|||+||+|||+|+|||||++|+|||.++|+|||.++|++||||||+|||||||+|++|||
T Consensus       105 ~l~~nie~~~PIvYTPTvG~acq~y~~i~r~p~Glfisi~D~Ghi~~~l~nWp~~~V~~IvVTDGerILGLGDlG~~Gmg  184 (582)
T KOG1257|consen  105 LLIDNIEELLPIVYTPTVGLACQQYGLIFRRPQGLFISIKDKGHIKQVLKNWPERNVKAIVVTDGERILGLGDLGVNGMG  184 (582)
T ss_pred             HHHhhHHHhCCeeecCcHHHHHHHhhhhhccCceeEEEecccchHHHHHHhCCccceeEEEEeCCCceecccccccCccc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccchhhhHHhhhCCCCCCceeeEEeecCCCccccccCccccccccCCCChhhHHHHHHHHHHHHHHhcCCCeeeeeecCC
Q 012398          204 IPVGKLSLYTALGGLRPSACLPITIDVGTNNEQLLNDEFYIGLRQKRATGQEYAELLQEFMTAVKQNYGEKVLIQFEDFA  283 (464)
Q Consensus       204 I~~GKl~Ly~a~gGI~P~~~lPV~LDvgTnne~Ll~Dp~YlG~r~~R~~g~~y~~~idefv~av~~~fGp~~lIq~EDf~  283 (464)
                      ||+||++||||||||+|++|||||||||||||+||+||+|+|+|++|++|++||+|+||||+||.++|||+++||||||+
T Consensus       185 IpvgKL~Lyta~~GI~P~~cLPV~LDVGTNNe~Ll~DplYiGLr~~R~~g~eYd~~~dEFm~Av~~~yG~~~lIqFEDF~  264 (582)
T KOG1257|consen  185 IPVGKLALYTALGGIRPSRCLPVCLDVGTNNEKLLNDPLYIGLRQRRVRGKEYDEFLDEFMEAVVQRYGPNTLIQFEDFA  264 (582)
T ss_pred             ceecHHHHHHHhcCCChhhceeEEEeccCChHHHhcCccccccccccccccHHHHHHHHHHHHHHHHhCcceEEEehhcc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CccHHHHHHHHcCCCceeecCccchhHHHHHHHHHHHHHhCCCCCcceEEEeCcchHHHHHHHHHHHHHHHhcCCChhhh
Q 012398          284 NHNAFELLSKYSSSHLVFNDDIQGTASVVLAGILSALKLVGGTLADQTFLFLGAGEAGTGIAELIALEMSKQTKAPIEEA  363 (464)
Q Consensus       284 ~~~af~iL~ryr~~~~~FnDDiQGTaaV~LAgll~Alk~~g~~l~d~riv~~GAGsAg~GiA~ll~~a~~~~~G~s~~eA  363 (464)
                      ++|||++|+|||.++|||||||||||+|+|||||+|+|++|++|+|++|||+|||+||+|||+||+.+|+++ |+|++||
T Consensus       265 ~~nAfrlL~kYr~~~c~FNDDIQGTaaValAgllaa~rit~~~lsd~~ilf~GAG~A~~GIA~l~v~~m~~~-Gl~~eeA  343 (582)
T KOG1257|consen  265 NHNAFRLLEKYRNKYCMFNDDIQGTAAVALAGLLAALRITGKPLSDHVILFLGAGEAALGIANLIVMAMVKE-GLSEEEA  343 (582)
T ss_pred             chhHHHHHHHhccccceecccccchhHHHHHHHHHHHHHhCCccccceEEEecCchHHhhHHHHHHHHHHHc-CCCHHHH
Confidence            999999999999999999999999999999999999999999999999999999999999999999999995 9999999


Q ss_pred             cCeEEEEcccCcccCCCccCCchhchhhhhhcCCCCCHHHHHhcCCCcEEEeccCCCCCCCHHHHHHHHcCCCCcEEEEc
Q 012398          364 RKKIWLVDSKGLIVSSRKESLQHFKKPWAHEHAPIKSLLDAVKAIKPTMLMGTSGVGKTFTKEVVEAMASFNEKPVIFAL  443 (464)
Q Consensus       364 ~~~i~lvD~~GLl~~~r~~~l~~~k~~fa~~~~~~~~L~e~v~~vkptvLIG~S~~~g~ft~evv~~Ma~~~erPIIFaL  443 (464)
                      +++|||||++|||+++|+.+++++|++||++++++++|+|||+.||||||||+|+++|+|||||||+||++|||||||||
T Consensus       344 ~kkIwlvD~~GLi~~~r~~~l~~~~~~fAk~~~~~~~L~e~V~~vKPtvLiG~S~~~g~Fteevl~~Ma~~~erPiIFal  423 (582)
T KOG1257|consen  344 RKKIWLVDSKGLITKGRKASLTEEKKPFAKDHEEIKDLEEAVKEVKPTVLIGASGVGGAFTEEVLRAMAKSNERPIIFAL  423 (582)
T ss_pred             hccEEEEecCceeeccccCCCChhhccccccChHHHHHHHHHHhcCCcEEEecccCCccCCHHHHHHHHhcCCCceEEec
Confidence            99999999999999999878999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCCCCCCHHHHhccccCC
Q 012398          444 SNPTSQSECTAEEAYTWSKVN  464 (464)
Q Consensus       444 SNPt~~~E~tpedA~~wT~g~  464 (464)
                      ||||+++||||||||+||+|+
T Consensus       424 SNPT~~aECtae~ay~~t~Gr  444 (582)
T KOG1257|consen  424 SNPTSKAECTAEQAYKWTKGR  444 (582)
T ss_pred             CCCccccccCHHHHhhhcCCc
Confidence            999999999999999999996

>PRK13529 malate dehydrogenase; Provisional Back     alignment and domain information
>PTZ00317 NADP-dependent malic enzyme; Provisional Back     alignment and domain information
>PLN03129 NADP-dependent malic enzyme; Provisional Back     alignment and domain information
>COG0281 SfcA Malic enzyme [Energy production and conversion] Back     alignment and domain information
>PRK12861 malic enzyme; Reviewed Back     alignment and domain information
>PRK12862 malic enzyme; Reviewed Back     alignment and domain information
>PRK07232 bifunctional malic enzyme oxidoreductase/phosphotransacetylase; Reviewed Back     alignment and domain information
>PF00390 malic: Malic enzyme, N-terminal domain; InterPro: IPR012301 Malic enzymes (malate oxidoreductases) catalyse the oxidative decarboxylation of malate to form pyruvate [], a reaction important in a number of metabolic pathways - e Back     alignment and domain information
>PF03949 Malic_M: Malic enzyme, NAD binding domain; InterPro: IPR012302 Malic enzymes (malate oxidoreductases) catalyse the oxidative decarboxylation of malate to form pyruvate [], a reaction important in a number of metabolic pathways - e Back     alignment and domain information
>cd00762 NAD_bind_malic_enz NAD(P) binding domain of malic enzyme Back     alignment and domain information
>cd05312 NAD_bind_1_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 1 Back     alignment and domain information
>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>TIGR01035 hemA glutamyl-tRNA reductase Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>PLN02477 glutamate dehydrogenase Back     alignment and domain information
>cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PRK09414 glutamate dehydrogenase; Provisional Back     alignment and domain information
>PRK14031 glutamate dehydrogenase; Provisional Back     alignment and domain information
>PTZ00079 NADP-specific glutamate dehydrogenase; Provisional Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>cd01076 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 1 Back     alignment and domain information
>PRK14982 acyl-ACP reductase; Provisional Back     alignment and domain information
>TIGR00936 ahcY adenosylhomocysteinase Back     alignment and domain information
>PLN02494 adenosylhomocysteinase Back     alignment and domain information
>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] Back     alignment and domain information
>PRK14030 glutamate dehydrogenase; Provisional Back     alignment and domain information
>PLN00203 glutamyl-tRNA reductase Back     alignment and domain information
>PLN00106 malate dehydrogenase Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>cd05313 NAD_bind_2_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 2 Back     alignment and domain information
>PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>PRK13940 glutamyl-tRNA reductase; Provisional Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>PTZ00075 Adenosylhomocysteinase; Provisional Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>cd05197 GH4_glycoside_hydrolases Glycoside Hydrases Family 4 Back     alignment and domain information
>PRK05086 malate dehydrogenase; Provisional Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>cd05212 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 Back     alignment and domain information
>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain Back     alignment and domain information
>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] Back     alignment and domain information
>PTZ00325 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK00676 hemA glutamyl-tRNA reductase; Validated Back     alignment and domain information
>cd00650 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family Back     alignment and domain information
>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type Back     alignment and domain information
>PRK14191 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>PF00208 ELFV_dehydrog: Glutamate/Leucine/Phenylalanine/Valine dehydrogenase; InterPro: IPR006096 Glutamate, leucine, phenylalanine and valine dehydrogenases are structurally and functionally related Back     alignment and domain information
>cd05296 GH4_P_beta_glucosidase Glycoside Hydrolases Family 4; Phospho-beta-glucosidase Back     alignment and domain information
>PRK10792 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd01079 NAD_bind_m-THF_DH NAD binding domain of methylene-tetrahydrofolate dehydrogenase Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>PRK00066 ldh L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>cd05298 GH4_GlvA_pagL_like Glycoside Hydrolases Family 4; GlvA- and pagL-like glycosidases Back     alignment and domain information
>cd00704 MDH Malate dehydrogenase Back     alignment and domain information
>PRK14189 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14194 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PTZ00082 L-lactate dehydrogenase; Provisional Back     alignment and domain information
>PTZ00117 malate dehydrogenase; Provisional Back     alignment and domain information
>cd01337 MDH_glyoxysomal_mitochondrial Glyoxysomal and mitochondrial malate dehydrogenases Back     alignment and domain information
>COG0334 GdhA Glutamate dehydrogenase/leucine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>PRK08223 hypothetical protein; Validated Back     alignment and domain information
>PLN02928 oxidoreductase family protein Back     alignment and domain information
>PRK14176 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14178 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd01336 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosolic Malate dehydrogenases Back     alignment and domain information
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK06223 malate dehydrogenase; Reviewed Back     alignment and domain information
>PRK00257 erythronate-4-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK08328 hypothetical protein; Provisional Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA Back     alignment and domain information
>PRK15076 alpha-galactosidase; Provisional Back     alignment and domain information
>PRK05600 thiamine biosynthesis protein ThiF; Validated Back     alignment and domain information
>PRK05442 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK12749 quinate/shikimate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR02992 ectoine_eutC ectoine utilization protein EutC Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>PRK08605 D-lactate dehydrogenase; Validated Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>PRK14190 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF02056 Glyco_hydro_4: Family 4 glycosyl hydrolase; InterPro: IPR001088 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PRK15438 erythronate-4-phosphate dehydrogenase PdxB; Provisional Back     alignment and domain information
>PRK14184 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd01338 MDH_choloroplast_like Chloroplast-like malate dehydrogenases Back     alignment and domain information
>TIGR01772 MDH_euk_gproteo malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PRK14183 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>cd05297 GH4_alpha_glucosidase_galactosidase Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases Back     alignment and domain information
>PF02882 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain; InterPro: IPR020631 Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF) Back     alignment and domain information
>PRK14027 quinate/shikimate dehydrogenase; Provisional Back     alignment and domain information
>PRK14177 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR01759 MalateDH-SF1 malate dehydrogenase Back     alignment and domain information
>cd05290 LDH_3 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>PRK14172 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14179 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PLN02516 methylenetetrahydrofolate dehydrogenase (NADP+) Back     alignment and domain information
>PRK14851 hypothetical protein; Provisional Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK07634 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK14188 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14171 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd01487 E1_ThiF_like E1_ThiF_like Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>PRK14174 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>cd05294 LDH-like_MDH_nadp A lactate dehydrogenases-like structure with malate dehydrogenase enzymatic activity Back     alignment and domain information
>PRK14168 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14193 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14187 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG1486 CelF Alpha-galactosidases/6-phospho-beta-glucosidases, family 4 of glycosyl hydrolases [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01915 npdG NADPH-dependent F420 reductase Back     alignment and domain information
>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>PRK14170 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14166 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>TIGR01758 MDH_euk_cyt malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PRK08291 ectoine utilization protein EutC; Validated Back     alignment and domain information
>cd05293 LDH_1 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PTZ00345 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK08374 homoserine dehydrogenase; Provisional Back     alignment and domain information
>cd01339 LDH-like_MDH L-lactate dehydrogenase-like malate dehydrogenase proteins Back     alignment and domain information
>PRK07574 formate dehydrogenase; Provisional Back     alignment and domain information
>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PLN02306 hydroxypyruvate reductase Back     alignment and domain information
>PRK07411 hypothetical protein; Validated Back     alignment and domain information
>PRK14185 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated Back     alignment and domain information
>COG0039 Mdh Malate/lactate dehydrogenases [Energy production and conversion] Back     alignment and domain information
>PRK02842 light-independent protochlorophyllide reductase subunit N; Provisional Back     alignment and domain information
>PRK14169 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>PRK06141 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK14173 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information
>PRK14180 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK12921 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK14181 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK12550 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PLN02616 tetrahydrofolate dehydrogenase/cyclohydrolase, putative Back     alignment and domain information
>COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06436 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK14167 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK08410 2-hydroxyacid dehydrogenase; Provisional Back     alignment and domain information
>KOG0029 consensus Amine oxidase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK07680 late competence protein ComER; Validated Back     alignment and domain information
>PLN02602 lactate dehydrogenase Back     alignment and domain information
>PRK14182 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>TIGR01408 Ube1 ubiquitin-activating enzyme E1 Back     alignment and domain information
>PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PRK09880 L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK12480 D-lactate dehydrogenase; Provisional Back     alignment and domain information
>PRK11880 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like Back     alignment and domain information
>PRK14186 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK06487 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional Back     alignment and domain information
>PRK12439 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>KOG0685 consensus Flavin-containing amine oxidase [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK15116 sulfur acceptor protein CsdL; Provisional Back     alignment and domain information
>PLN02897 tetrahydrofolate dehydrogenase/cyclohydrolase, putative Back     alignment and domain information
>KOG1495 consensus Lactate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK15409 bifunctional glyoxylate/hydroxypyruvate reductase B; Provisional Back     alignment and domain information
>PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 Back     alignment and domain information
>PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>TIGR00507 aroE shikimate 5-dehydrogenase Back     alignment and domain information
>TIGR01771 L-LDH-NAD L-lactate dehydrogenase Back     alignment and domain information
>TIGR02371 ala_DH_arch alanine dehydrogenase, Archaeoglobus fulgidus type Back     alignment and domain information
>PRK07679 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK09310 aroDE bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase protein; Reviewed Back     alignment and domain information
>PLN00112 malate dehydrogenase (NADP); Provisional Back     alignment and domain information
>PLN03139 formate dehydrogenase; Provisional Back     alignment and domain information
>PRK07340 ornithine cyclodeaminase; Validated Back     alignment and domain information
>COG0345 ProC Pyrroline-5-carboxylate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>cd00755 YgdL_like Family of activating enzymes (E1) of ubiquitin-like proteins related to the E Back     alignment and domain information
>TIGR03376 glycerol3P_DH glycerol-3-phosphate dehydrogenase (NAD(+)) Back     alignment and domain information
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>TIGR01327 PGDH D-3-phosphoglycerate dehydrogenase Back     alignment and domain information
>PRK06407 ornithine cyclodeaminase; Provisional Back     alignment and domain information
>cd00300 LDH_like L-lactate dehydrogenase-like enzymes Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] Back     alignment and domain information
>TIGR01381 E1_like_apg7 E1-like protein-activating enzyme Gsa7p/Apg7p Back     alignment and domain information
>PRK08618 ornithine cyclodeaminase; Validated Back     alignment and domain information
>cd08237 ribitol-5-phosphate_DH ribitol-5-phosphate dehydrogenase Back     alignment and domain information
>COG0190 FolD 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase [Coenzyme metabolism] Back     alignment and domain information
>TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase Back     alignment and domain information
>PRK06823 ornithine cyclodeaminase; Validated Back     alignment and domain information
>COG5322 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase Back     alignment and domain information
>PRK08229 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query464
2aw5_A 575 Crystal Structure Of A Human Malic Enzyme Length = 1e-139
1gq2_A 555 Malic Enzyme From Pigeon Liver Length = 555 1e-134
1gz3_A 554 Molecular Mechanism For The Regulation Of Human Mit 1e-130
1llq_A 605 Crystal Structure Of Malic Enzyme From Ascaris Suum 1e-126
1qr6_A 584 Human Mitochondrial Nad(P)-Dependent Malic Enzyme L 1e-124
1efk_A 584 Structure Of Human Malic Enzyme In Complex With Ket 1e-124
1gz4_A 551 Molecular Mechanism Of The Regulation Of Human Mito 1e-124
1do8_A 564 Crystal Structure Of A Closed Form Of Human Mitocho 1e-124
3nv9_A 487 Crystal Structure Of Entamoeba Histolytica Malic En 2e-19
2dvm_A 439 Nad Complex Structure Of Ph1275 Protein From Pyroco 3e-17
1ww8_A 439 Crystal Structure Of Malic Enzyme From Pyrococcus H 3e-17
2a9f_A398 Crystal Structure Of A Putative Malic Enzyme ((S)- 5e-12
2hae_A386 Crystal Structure Of A Putative Malic Enzyme (Malat 4e-11
1vl6_A388 Crystal Structure Of Nad-Dependent Malic Enzyme (Tm 2e-10
>pdb|2AW5|A Chain A, Crystal Structure Of A Human Malic Enzyme Length = 575 Back     alignment and structure 
Iteration: 1

 Score =  490 bits (1261), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 236/433 (54%), Positives = 309/433 (71%), Gaps = 6/433 (1%)
Query: 30  GEDFATEDQLITPWTVSVASGYTLLRDPRHNKGLAFTENERDAHYLRGLLPPALMNQELQ 89
           G D  TE+     +  S+  GY L R+P  NK LAFT  ER    + GLLPP+  +QE+Q
Sbjct: 10  GVDLGTENL----YFQSMQRGYLLTRNPHLNKDLAFTLEERQQLNIHGLLPPSFNSQEIQ 65
Query: 90  EKRLMHNLRQYKVPLQRYVAMMDLQERNERLFYKLLIDNVEELLPVVYTPTVGEACQKYG 149
             R++ N         RY+ +MDLQ+RNE+LFY++L  ++E+ +P+VYTPTVG ACQ+Y 
Sbjct: 66  VLRVVKNFEHLNSDFDRYLLLMDLQDRNEKLFYRVLTSDIEKFMPIVYTPTVGLACQQYS 125
Query: 150 SIFRRPQGLYISLKEKGKILEVLKNWPERNIQVIVVTDGERILGLGDLGCQGMGIPVGKL 209
            +FR+P+GL+I++ ++G I  VL  WPE  I+ IVVTDGERILGLGDLGC GMGIPVGKL
Sbjct: 126 LVFRKPRGLFITIHDRGHIASVLNAWPEDVIKAIVVTDGERILGLGDLGCNGMGIPVGKL 185
Query: 210 SLYTALGGLRPSACLPITIDVGTNNEQLLNDEFYIGLRQKRATGQEYAELLQEFMTAVKQ 269
           +LYTA GG+ P  CLP+ +DVGT NE+LL D  YIGLRQ+R  G EY + L EFM AV  
Sbjct: 186 ALYTACGGMNPQECLPVILDVGTENEELLKDPLYIGLRQRRVRGSEYDDFLDEFMEAVSS 245
Query: 270 NYGEKVLIQFEDFANHNAFELLSKYSSSHLVFNDDIQGTASVVLAGILSALKLVGGTLAD 329
            YG   LIQFEDFAN NAF LL+KY + +  FNDDIQGTASV +AG+L+AL++    L+D
Sbjct: 246 KYGMNCLIQFEDFANVNAFRLLNKYRNQYCTFNDDIQGTASVAVAGLLAALRITKNKLSD 305
Query: 330 QTFLFLGAGEAGTGIAELIALEMSKQTKAPIEEARKKIWLVDSKGLIVSSRKESLQHFKK 389
           QT LF GAGEA  GIA LI + + K+   P E+A KKIWLVDSKGLIV  R  SL   K+
Sbjct: 306 QTILFQGAGEAALGIAHLIVMALEKEG-LPKEKAIKKIWLVDSKGLIVKGRA-SLTQEKE 363
Query: 390 PWAHEHAPIKSLLDAVKAIKPTMLMGTSGVGKTFTKEVVEAMASFNEKPVIFALSNPTSQ 449
            +AHEH  +K+L   V+ IKPT L+G + +G  F++++++ MA+FNE+P+IFALSNPTS+
Sbjct: 364 KFAHEHEEMKNLEAIVQEIKPTALIGVAAIGGAFSEQILKDMAAFNERPIIFALSNPTSK 423
Query: 450 SECTAEEAYTWSK 462
           +EC+AE+ Y  +K
Sbjct: 424 AECSAEQCYKITK 436
>pdb|1GQ2|A Chain A, Malic Enzyme From Pigeon Liver Length = 555 Back     alignment and structure
>pdb|1GZ3|A Chain A, Molecular Mechanism For The Regulation Of Human Mitochondrial Nad(P)+-Dependent Malic Enzyme By Atp And Fumarate Length = 554 Back     alignment and structure
>pdb|1LLQ|A Chain A, Crystal Structure Of Malic Enzyme From Ascaris Suum Complexed With Nicotinamide Adenine Dinucleotide Length = 605 Back     alignment and structure
>pdb|1QR6|A Chain A, Human Mitochondrial Nad(P)-Dependent Malic Enzyme Length = 584 Back     alignment and structure
>pdb|1EFK|A Chain A, Structure Of Human Malic Enzyme In Complex With Ketomalonate Length = 584 Back     alignment and structure
>pdb|1GZ4|A Chain A, Molecular Mechanism Of The Regulation Of Human Mitochondrial Nad(P)+-Dependent Malic Enzyme By Atp And Fumarate Length = 551 Back     alignment and structure
>pdb|1DO8|A Chain A, Crystal Structure Of A Closed Form Of Human Mitochondrial Nad(P)+-Dependent Malic Enzyme Length = 564 Back     alignment and structure
>pdb|3NV9|A Chain A, Crystal Structure Of Entamoeba Histolytica Malic Enzyme Length = 487 Back     alignment and structure
>pdb|2DVM|A Chain A, Nad Complex Structure Of Ph1275 Protein From Pyrococcus Horikoshii Length = 439 Back     alignment and structure
>pdb|1WW8|A Chain A, Crystal Structure Of Malic Enzyme From Pyrococcus Horikoshii Ot3 Length = 439 Back     alignment and structure
>pdb|2A9F|A Chain A, Crystal Structure Of A Putative Malic Enzyme ((S)- Malate:nad+ Oxidoreductase (Decarboxylating)) Length = 398 Back     alignment and structure
>pdb|2HAE|A Chain A, Crystal Structure Of A Putative Malic Enzyme (Malate Oxidoreductase) Length = 386 Back     alignment and structure
>pdb|1VL6|A Chain A, Crystal Structure Of Nad-Dependent Malic Enzyme (Tm0542) From Thermotoga Maritima At 2.61 A Resolution Length = 388 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query464
1gq2_A 555 Malic enzyme; oxidoreductase, pigeon liver, NADP-d 0.0
1pj3_A 564 NAD-dependent malic enzyme, mitochondrial; oxidati 0.0
1o0s_A 605 NAD-ME, NAD-dependent malic enzyme; oxidoreductase 0.0
3nv9_A 487 Malic enzyme; rossmann fold, oxidoreductase; 2.25A 5e-31
2a9f_A398 Putative malic enzyme ((S)-malate:NAD+ oxidoreduct 2e-28
1vl6_A388 Malate oxidoreductase; TM0542, NAD-dependent malic 2e-26
2dvm_A 439 Malic enzyme, 439AA long hypothetical malate oxido 2e-23
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
>1gq2_A Malic enzyme; oxidoreductase, pigeon liver, NADP-dependent, NAD-NADP selectivity, decarboxylase, malate, Mn2+; HET: NAP; 2.5A {Columba livia} SCOP: c.2.1.7 c.58.1.3 PDB: 2aw5_A Length = 555 Back     alignment and structure
 Score =  688 bits (1778), Expect = 0.0
 Identities = 233/413 (56%), Positives = 302/413 (73%), Gaps = 2/413 (0%)

Query: 50  GYTLLRDPRHNKGLAFTENERDAHYLRGLLPPALMNQELQEKRLMHNLRQYKVPLQRYVA 109
           GY +LRDP  NKG+AFT  ER    + GLLPP  + Q+ Q   ++ N  +    L RY+ 
Sbjct: 3   GYEVLRDPHLNKGMAFTLEERQQLNIHGLLPPCFLGQDAQVYSILKNFERLTSDLDRYIL 62

Query: 110 MMDLQERNERLFYKLLIDNVEELLPVVYTPTVGEACQKYGSIFRRPQGLYISLKEKGKIL 169
           +M LQ+RNE+LFYK+L  ++E  +P+VYTPTVG ACQ YG  FRRP+GL+I++ ++G I 
Sbjct: 63  LMSLQDRNEKLFYKVLTSDIERFMPIVYTPTVGLACQHYGLAFRRPRGLFITIHDRGHIA 122

Query: 170 EVLKNWPERNIQVIVVTDGERILGLGDLGCQGMGIPVGKLSLYTALGGLRPSACLPITID 229
            +L++WPE  I+ IVVTDGERILGLGDLGC GMGIPVGKL+LYTA GG++P  CLP+ +D
Sbjct: 123 TMLQSWPESVIKAIVVTDGERILGLGDLGCYGMGIPVGKLALYTACGGVKPHQCLPVMLD 182

Query: 230 VGTNNEQLLNDEFYIGLRQKRATGQEYAELLQEFMTAVKQNYGEKVLIQFEDFANHNAFE 289
           VGT+NE LL D  YIGLR KR  GQ Y +LL EFM AV   YG   LIQFEDFAN NAF 
Sbjct: 183 VGTDNETLLKDPLYIGLRHKRIRGQAYDDLLDEFMEAVTSRYGMNCLIQFEDFANANAFR 242

Query: 290 LLSKYSSSHLVFNDDIQGTASVVLAGILSALKLVGGTLADQTFLFLGAGEAGTGIAELIA 349
           LL KY + +  FNDDIQGTASV +AG+L+AL++    L+D T LF GAGEA  GIA LI 
Sbjct: 243 LLHKYRNKYCTFNDDIQGTASVAVAGLLAALRITKNRLSDHTVLFQGAGEAALGIANLIV 302

Query: 350 LEMSKQTKAPIEEARKKIWLVDSKGLIVSSRKESLQHFKKPWAHEHAPIKSLLDAVKAIK 409
           + M K+     EEA K+IW+VDSKGLIV  R  SL   K+ +AHEH  +K+L D VK IK
Sbjct: 303 MAMQKE-GVSKEEAIKRIWMVDSKGLIVKGR-ASLTPEKEHFAHEHCEMKNLEDIVKDIK 360

Query: 410 PTMLMGTSGVGKTFTKEVVEAMASFNEKPVIFALSNPTSQSECTAEEAYTWSK 462
           PT+L+G + +G  FT+++++ MA+FN++P+IFALSNPTS++ECTAE+ Y +++
Sbjct: 361 PTVLIGVAAIGGAFTQQILQDMAAFNKRPIIFALSNPTSKAECTAEQLYKYTE 413
>1pj3_A NAD-dependent malic enzyme, mitochondrial; oxidative decarboxylase, oxidoreductase; HET: NAD; 2.10A {Homo sapiens} SCOP: c.2.1.7 c.58.1.3 PDB: 1pj2_A* 1do8_A* 1pj4_A* 1qr6_A* 1efl_A* 1pjl_A* 1efk_A* 1gz4_A* 1gz3_A* Length = 564 Back     alignment and structure
>1o0s_A NAD-ME, NAD-dependent malic enzyme; oxidoreductase, oxidative decarboxylase, rossmann fold, MAla dehydrogenase; HET: NAI; 2.00A {Ascaris suum} SCOP: c.2.1.7 c.58.1.3 PDB: 1llq_A* Length = 605 Back     alignment and structure
>3nv9_A Malic enzyme; rossmann fold, oxidoreductase; 2.25A {Entamoeba histolytica} Length = 487 Back     alignment and structure
>2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} Length = 398 Back     alignment and structure
>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Length = 388 Back     alignment and structure
>2dvm_A Malic enzyme, 439AA long hypothetical malate oxidoreductase; NAD, structural genomics, NPPSFA; HET: NAD MES; 1.60A {Pyrococcus horikoshii} PDB: 1ww8_A* Length = 439 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query464
1gq2_A 555 Malic enzyme; oxidoreductase, pigeon liver, NADP-d 100.0
1pj3_A 564 NAD-dependent malic enzyme, mitochondrial; oxidati 100.0
1o0s_A 605 NAD-ME, NAD-dependent malic enzyme; oxidoreductase 100.0
3nv9_A 487 Malic enzyme; rossmann fold, oxidoreductase; 2.25A 100.0
2a9f_A398 Putative malic enzyme ((S)-malate:NAD+ oxidoreduct 100.0
1vl6_A388 Malate oxidoreductase; TM0542, NAD-dependent malic 100.0
2dvm_A 439 Malic enzyme, 439AA long hypothetical malate oxido 100.0
3h9u_A 436 Adenosylhomocysteinase; NAD CO-factor complex, str 98.87
3gvp_A 435 Adenosylhomocysteinase 3; protein CO-factor comple 98.83
1x13_A401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 98.61
3ond_A 488 Adenosylhomocysteinase; plant protein, enzyme-subs 98.2
3n58_A 464 Adenosylhomocysteinase; ssgcid, hydrolase, structu 97.77
1l7d_A384 Nicotinamide nucleotide transhydrogenase, subunit 97.65
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 97.47
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 97.15
3k92_A424 NAD-GDH, NAD-specific glutamate dehydrogenase; ROC 96.93
3aoe_E419 Glutamate dehydrogenase; rossmann fold, NADH, oxid 96.92
4fcc_A450 Glutamate dehydrogenase; protein complex, rossmann 96.9
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 96.8
3aog_A440 Glutamate dehydrogenase; NAD(H), oxidoreducta; HET 96.77
1a4i_A301 Methylenetetrahydrofolate dehydrogenase / methenyl 96.69
3l07_A285 Bifunctional protein fold; structural genomics, ID 96.54
2yfq_A421 Padgh, NAD-GDH, NAD-specific glutamate dehydrogena 96.54
3p2o_A285 Bifunctional protein fold; structural genomics, ce 96.35
1b0a_A288 Protein (fold bifunctional protein); folate, dehyd 96.28
3ngx_A276 Bifunctional protein fold; methylenetetrahydrofola 96.27
1edz_A320 5,10-methylenetetrahydrofolate dehydrogenase; nucl 96.26
4a5o_A286 Bifunctional protein fold; oxidoreductase, hydrola 96.19
3jyo_A283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 96.08
3pwz_A272 Shikimate dehydrogenase 3; alpha-beta, oxidoreduct 96.07
2bma_A470 Glutamate dehydrogenase (NADP+); malaria, drug des 96.05
4a26_A300 Putative C-1-tetrahydrofolate synthase, cytoplasm; 96.04
3r3j_A456 Glutamate dehydrogenase; rossman fold, oxidoreduct 95.84
1v8b_A 479 Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2 95.81
1v9l_A421 Glutamate dehydrogenase; protein-NAD complex, oxid 95.59
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 95.58
2c2x_A281 Methylenetetrahydrofolate dehydrogenase- methenylt 95.58
1gpj_A 404 Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro 95.52
3u95_A 477 Glycoside hydrolase, family 4; hydrolysis, cytosol 95.46
2tmg_A415 Protein (glutamate dehydrogenase); metabolic role, 95.29
3don_A277 Shikimate dehydrogenase; alpha-beta structure, ros 95.21
1mld_A 314 Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D 95.14
1nvt_A287 Shikimate 5'-dehydrogenase; structural genomics, P 95.12
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 95.04
3d64_A 494 Adenosylhomocysteinase; structural genomics, ssgci 95.02
3t4e_A312 Quinate/shikimate dehydrogenase; structural genomi 95.02
3u62_A253 Shikimate dehydrogenase; shikimate pathway, oxidor 94.78
1pzg_A 331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 94.76
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 94.72
1c1d_A355 L-phenylalanine dehydrogenase; amino acid dehydrog 94.7
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 94.64
1hyh_A 309 L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 94.62
1bgv_A449 Glutamate dehydrogenase; oxidoreductase; HET: GLU; 94.62
1leh_A364 Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi 94.61
1ldn_A 316 L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA 94.49
3dtt_A 245 NADP oxidoreductase; structural genomics, joint ce 94.34
2rir_A300 Dipicolinate synthase, A chain; structural genomic 94.19
2o4c_A 380 Erythronate-4-phosphate dehydrogenase; erythronate 94.18
2v6b_A 304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 94.12
3ce6_A 494 Adenosylhomocysteinase; protein-substrate complex, 94.09
3mw9_A 501 GDH 1, glutamate dehydrogenase 1; allostery, inhib 94.07
1b8p_A 329 Protein (malate dehydrogenase); oxidoreductase; 1. 94.02
2ekl_A313 D-3-phosphoglycerate dehydrogenase; structural gen 93.84
1obb_A 480 Maltase, alpha-glucosidase; glycosidase, sulfinic 93.81
2i6t_A 303 Ubiquitin-conjugating enzyme E2-like isoform A; L- 93.8
1t2d_A 322 LDH-P, L-lactate dehydrogenase; ternary complex, o 93.7
3tri_A 280 Pyrroline-5-carboxylate reductase; amino acid bios 93.65
3fef_A 450 Putative glucosidase LPLD; gulosidase, structural 93.59
2hjr_A 328 Malate dehydrogenase; malaria, structural genomics 93.59
2ewd_A 317 Lactate dehydrogenase,; protein-substrate_cofactor 93.58
1o6z_A 303 MDH, malate dehydrogenase; halophilic, ION-binding 93.47
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 93.41
2zqz_A 326 L-LDH, L-lactate dehydrogenase; oxidoreductase, ro 93.41
3oet_A 381 Erythronate-4-phosphate dehydrogenase; structural 93.39
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 93.36
1s6y_A 450 6-phospho-beta-glucosidase; hydrolase, structural 93.33
3d0o_A 317 L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly 93.33
1ez4_A 318 Lactate dehydrogenase; rossmann fold, oxidoreducta 93.31
3vku_A 326 L-LDH, L-lactate dehydrogenase; rossmann fold, NAD 93.16
3fbt_A282 Chorismate mutase and shikimate 5-dehydrogenase fu 93.12
3o8q_A281 Shikimate 5-dehydrogenase I alpha; structural geno 93.04
1y6j_A 318 L-lactate dehydrogenase; southeast collaboratory f 92.95
2rcy_A 262 Pyrroline carboxylate reductase; malaria, structur 92.95
1a5z_A 319 L-lactate dehydrogenase; oxidoreductase, glycolysi 92.95
2gcg_A330 Glyoxylate reductase/hydroxypyruvate reductase; NA 92.95
2dbq_A334 Glyoxylate reductase; D-3-phosphoglycerate dehydro 92.77
1oju_A 294 MDH, malate dehydrogenase; hyperthermophilic, oxid 92.65
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 92.55
1smk_A 326 Malate dehydrogenase, glyoxysomal; tricarboxylic c 92.54
3tum_A269 Shikimate dehydrogenase family protein; rossmann-f 92.51
1u8x_X 472 Maltose-6'-phosphate glucosidase; structural genom 92.49
1gtm_A419 Glutamate dehydrogenase; oxidoreductase, NAD, NADP 92.44
1x7d_A 350 Ornithine cyclodeaminase; binds NAD+, binds L-orni 92.41
2xxj_A 310 L-LDH, L-lactate dehydrogenase; oxidoreductase, hy 92.25
1up7_A 417 6-phospho-beta-glucosidase; hydrolase, family4 hyd 92.25
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 92.12
1ur5_A 309 Malate dehydrogenase; oxidoreductase, tricarboxyli 92.08
4g2n_A345 D-isomer specific 2-hydroxyacid dehydrogenase, Na; 92.02
3gvi_A 324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 91.94
1txg_A 335 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid 91.89
1wwk_A307 Phosphoglycerate dehydrogenase; riken structural g 91.89
2hk9_A275 Shikimate dehydrogenase; shikimate pathway, drug d 91.86
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 91.83
3nep_X 314 Malate dehydrogenase; halophIle, molecular adpatat 91.73
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 91.68
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 91.67
1zud_1251 Adenylyltransferase THIF; thiamin, thiazole, prote 91.56
1lld_A 319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 91.56
3p7m_A 321 Malate dehydrogenase; putative dehydrogenase, enzy 91.53
1omo_A322 Alanine dehydrogenase; two-domain, beta-sandwich-d 91.39
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 91.38
3d1l_A 266 Putative NADP oxidoreductase BF3122; structural ge 91.37
3kkj_A 336 Amine oxidase, flavin-containing; oxidoreductase, 91.18
4dgs_A340 Dehydrogenase; structural genomics, PSI-biology, N 91.14
3ba1_A333 HPPR, hydroxyphenylpyruvate reductase; two domain 91.01
1z82_A 335 Glycerol-3-phosphate dehydrogenase; TM0378, struct 90.91
3hdj_A313 Probable ornithine cyclodeaminase; APC62486, borde 90.87
2zyd_A 480 6-phosphogluconate dehydrogenase, decarboxylating; 90.83
1xdw_A331 NAD+-dependent (R)-2-hydroxyglutarate dehydrogenas 90.83
1guz_A 310 Malate dehydrogenase; oxidoreductase, tricarboxyli 90.8
3k96_A 356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 90.76
1hye_A 313 L-lactate/malate dehydrogenase; nucleotide binding 90.7
2d4a_B 308 Malate dehydrogenase; archaea, hyperthermophIle, o 90.69
3pqe_A 326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 90.65
3tl2_A 315 Malate dehydrogenase; center for structural genomi 90.62
3k5p_A 416 D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, 90.58
1x0v_A 354 GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase 90.4
2cuk_A311 Glycerate dehydrogenase/glyoxylate reductase; stru 90.37
3gvx_A290 Glycerate dehydrogenase related protein; NYSGXRC, 90.27
3jtm_A351 Formate dehydrogenase, mitochondrial; mitochondrio 90.24
3fi9_A 343 Malate dehydrogenase; structural genomics, oxidore 90.17
1sc6_A 404 PGDH, D-3-phosphoglycerate dehydrogenase; alloster 90.16
3evt_A324 Phosphoglycerate dehydrogenase; structural genomic 90.1
2d5c_A263 AROE, shikimate 5-dehydrogenase; substrate, dimer, 90.05
3ado_A 319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 90.05
4e12_A 283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 89.99
4huj_A220 Uncharacterized protein; PSI-biology, nysgrc, stru 89.98
4hy3_A365 Phosphoglycerate oxidoreductase; PSI-biology, stru 89.95
3i83_A 320 2-dehydropantoate 2-reductase; structural genomics 89.65
1qp8_A303 Formate dehydrogenase; oxidoreductase; HET: NDP; 2 89.63
2d0i_A333 Dehydrogenase; structural genomics, NPPSFA, nation 89.61
2j6i_A364 Formate dehydrogenase; oxidoreductase, D-specific- 89.39
1j4a_A333 D-LDH, D-lactate dehydrogenase; NAD-dependent dehy 89.38
1yj8_A 375 Glycerol-3-phosphate dehydrogenase; SGPP, structur 89.19
2i99_A312 MU-crystallin homolog; thyroid hormine binding pro 89.15
3h8v_A 292 Ubiquitin-like modifier-activating enzyme 5; rossm 88.91
2yq5_A343 D-isomer specific 2-hydroxyacid dehydrogenase; oxi 88.77
2x0j_A 294 Malate dehydrogenase; oxidoreductase, hyperthermop 88.76
4e21_A 358 6-phosphogluconate dehydrogenase (decarboxylating; 88.69
1hyu_A 521 AHPF, alkyl hydroperoxide reductase subunit F; thi 88.63
1ks9_A 291 KPA reductase;, 2-dehydropantoate 2-reductase; PAN 88.39
2izz_A 322 Pyrroline-5-carboxylate reductase 1; amino-acid bi 88.35
1dxy_A333 D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxyc 88.34
2p4q_A 497 6-phosphogluconate dehydrogenase, decarboxylating; 88.26
3hg7_A324 D-isomer specific 2-hydroxyacid dehydrogenase FAM 88.1
3qsg_A 312 NAD-binding phosphogluconate dehydrogenase-like P; 88.06
3b1f_A 290 Putative prephenate dehydrogenase; enzyme, 4-hydro 87.94
3rui_A 340 Ubiquitin-like modifier-activating enzyme ATG7; au 87.94
1y7t_A 327 Malate dehydrogenase; NAD-dependent-MDH-NADPH comp 87.86
4aj2_A 331 L-lactate dehydrogenase A chain; oxidoreductase-in 87.85
3gt0_A 247 Pyrroline-5-carboxylate reductase; structural geno 87.63
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 87.45
2w2k_A348 D-mandelate dehydrogenase; 2-hydroxyacid dehydroge 87.44
1gdh_A320 D-glycerate dehydrogenase; oxidoreductase(CHOH (D) 87.43
2pi1_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 87.28
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 87.03
3ldh_A 330 Lactate dehydrogenase; oxidoreductase, CHOH donor, 86.79
2g76_A335 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor 86.67
1lss_A140 TRK system potassium uptake protein TRKA homolog; 86.26
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 86.22
2nac_A393 NAD-dependent formate dehydrogenase; oxidoreductas 86.18
2qrj_A394 Saccharopine dehydrogenase, NAD+, L-lysine- formin 86.01
3gg9_A352 D-3-phosphoglycerate dehydrogenase oxidoreductase; 85.92
1pgj_A 478 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; o 85.84
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 85.83
2h78_A 302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 85.59
1bg6_A 359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 85.59
4ej6_A370 Putative zinc-binding dehydrogenase; structural ge 85.55
3pp8_A315 Glyoxylate/hydroxypyruvate reductase A; structural 85.53
3c85_A183 Putative glutathione-regulated potassium-efflux S 85.39
4dll_A 320 2-hydroxy-3-oxopropionate reductase; structural ge 85.33
1npy_A271 Hypothetical shikimate 5-dehydrogenase-like protei 85.33
3c24_A 286 Putative oxidoreductase; YP_511008.1, structural g 85.29
4fgw_A 391 Glycerol-3-phosphate dehydrogenase [NAD(+)] 1; oxi 85.18
2uyy_A 316 N-PAC protein; long-chain dehydrogenase, cytokine; 85.07
3vrd_B 401 FCCB subunit, flavocytochrome C flavin subunit; su 85.06
2ew2_A 316 2-dehydropantoate 2-reductase, putative; alpha-str 85.05
3pef_A 287 6-phosphogluconate dehydrogenase, NAD-binding; gam 85.03
5mdh_A 333 Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH 85.03
3l6d_A 306 Putative oxidoreductase; structural genomics, prot 84.78
3doj_A 310 AT3G25530, dehydrogenase-like protein; gamma-hydro 84.59
2iz1_A 474 6-phosphogluconate dehydrogenase, decarboxylating; 84.4
3hhp_A 312 Malate dehydrogenase; MDH, citric acid cycle, TCA 84.38
1mx3_A347 CTBP1, C-terminal binding protein 1; nuclear prote 84.16
4gwg_A 484 6-phosphogluconate dehydrogenase, decarboxylating; 84.15
3h5n_A353 MCCB protein; ubiquitin-activating enzyme, microci 84.03
2g5c_A 281 Prephenate dehydrogenase; TYRA, oxidoreductase; HE 83.87
1id1_A153 Putative potassium channel protein; RCK domain, E. 83.83
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 83.82
3pdu_A 287 3-hydroxyisobutyrate dehydrogenase family protein; 83.39
1f0y_A 302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 83.25
4e5n_A330 Thermostable phosphite dehydrogenase; D-2-hydroxya 83.2
3ggo_A 314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 83.16
2dpo_A 319 L-gulonate 3-dehydrogenase; structural genomics, N 82.94
4ezb_A 317 Uncharacterized conserved protein; structural geno 82.85
1y8q_A 346 Ubiquitin-like 1 activating enzyme E1A; SUMO, hete 82.79
3ip1_A404 Alcohol dehydrogenase, zinc-containing; structural 82.74
4gsl_A 615 Ubiquitin-like modifier-activating enzyme ATG7; ub 82.59
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 82.55
3vh1_A 598 Ubiquitin-like modifier-activating enzyme ATG7; au 82.38
1yb4_A 295 Tartronic semialdehyde reductase; structural genom 82.37
3kb6_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 82.33
2pgd_A 482 6-phosphogluconate dehydrogenase; oxidoreductase ( 82.3
2f1k_A 279 Prephenate dehydrogenase; tyrosine synthesis, X-RA 82.2
4hb9_A 412 Similarities with probable monooxygenase; flavin, 82.13
4egb_A 346 DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce 82.1
3cky_A 301 2-hydroxymethyl glutarate dehydrogenase; rossmann 81.73
4b4u_A303 Bifunctional protein fold; oxidoreductase; HET: NA 81.56
3ghy_A 335 Ketopantoate reductase protein; oxidoreductase, NA 81.01
1i36_A 264 Conserved hypothetical protein MTH1747; NADP bindi 80.54
2pv7_A 298 T-protein [includes: chorismate mutase (EC 5.4.99 80.42
3abi_A 365 Putative uncharacterized protein PH1688; L-lysine 80.32
3o38_A 266 Short chain dehydrogenase; tuberculosis, ortholog 80.14
3k6j_A 460 Protein F01G10.3, confirmed by transcript evidenc; 80.07
>1gq2_A Malic enzyme; oxidoreductase, pigeon liver, NADP-dependent, NAD-NADP selectivity, decarboxylase, malate, Mn2+; HET: NAP; 2.5A {Columba livia} SCOP: c.2.1.7 c.58.1.3 PDB: 2aw5_A Back     alignment and structure
Probab=100.00  E-value=1.1e-165  Score=1304.59  Aligned_cols=414  Identities=56%  Similarity=0.985  Sum_probs=408.6

Q ss_pred             cccccccCCCCCcCCCCCHHHHhhcccCCCCCCcccCHHHHHHHHHHHhhcCCCchhHHHHhhhhhhhhhhhhHHHhhhc
Q 012398           49 SGYTLLRDPRHNKGLAFTENERDAHYLRGLLPPALMNQELQEKRLMHNLRQYKVPLQRYVAMMDLQERNERLFYKLLIDN  128 (464)
Q Consensus        49 ~g~~~l~~p~~NkgtaFt~~ER~~lgl~GLlPp~v~t~e~Q~~r~~~~~~~~~~~l~Ky~~L~~L~~~Ne~Lfy~ll~~~  128 (464)
                      +|.++|+||++|||||||.+||++|||+|||||+|+|+|+|++|||.||++++++|+||+||++||++||+||||++.+|
T Consensus         2 ~G~~lL~~p~~NKGtAFt~~ER~~l~l~GLLPp~v~t~e~Q~~r~~~~~~~~~~~l~k~~~L~~L~~~Ne~Lfy~ll~~~   81 (555)
T 1gq2_A            2 KGYEVLRDPHLNKGMAFTLEERQQLNIHGLLPPCFLGQDAQVYSILKNFERLTSDLDRYILLMSLQDRNEKLFYKVLTSD   81 (555)
T ss_dssp             CTTHHHHCTTTCCGGGSCHHHHHHTTCTTSSCSCBCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCHHHHHHHHHHT
T ss_pred             ChhhhccCCcccCCCCCCHHHHHHCCCccCCCCCcCCHHHHHHHHHHHHhcCCCcHHHHHHHHHhcCcceeeehhhHhhh
Confidence            79999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccccCCcccchhhHHHHHHHhhhhcCCCcccccccCcchHHHHHhcCCCCCeeEEEEecCceeeccCCCCCCcccccchh
Q 012398          129 VEELLPVVYTPTVGEACQKYGSIFRRPQGLYISLKEKGKILEVLKNWPERNIQVIVVTDGERILGLGDLGCQGMGIPVGK  208 (464)
Q Consensus       129 ~~e~lpivYTPtVg~ac~~~s~i~r~p~gly~s~~d~g~i~~~l~n~~~~~v~viVVTDG~rILGLGDlG~~gm~I~~GK  208 (464)
                      ++|+|||+||||||++|++||+|||+|+|+|+|++|+|+++++++|||.++|+|||||||||||||||||++||+|||||
T Consensus        82 ~~e~lpivYTP~V~~ac~~~s~i~~~p~g~yis~~d~~~i~~~l~n~~~~~~~v~VVTDG~~ILGLGD~G~~g~~ipvGK  161 (555)
T 1gq2_A           82 IERFMPIVYTPTVGLACQHYGLAFRRPRGLFITIHDRGHIATMLQSWPESVIKAIVVTDGERILGLGDLGCYGMGIPVGK  161 (555)
T ss_dssp             HHHHHHHHSTTHHHHHHHTHHHHCSSCCSEEEEGGGTTCHHHHHHTSSCSCCCEEEEECSSSCGGGCCCGGGGGHHHHHH
T ss_pred             HHHhcCcccCchHHHHHHHHHHHhcChhhhhcccCCHHHHHHHHhcCCCCCcEEEEEEccccccccCCCCCCccccchhH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhHHhhhCCCCCCceeeEEeecCCCccccccCccccccccCCCChhhHHHHHHHHHHHHHHhcCCCeeeeeecCCCccHH
Q 012398          209 LSLYTALGGLRPSACLPITIDVGTNNEQLLNDEFYIGLRQKRATGQEYAELLQEFMTAVKQNYGEKVLIQFEDFANHNAF  288 (464)
Q Consensus       209 l~Ly~a~gGI~P~~~lPV~LDvgTnne~Ll~Dp~YlG~r~~R~~g~~y~~~idefv~av~~~fGp~~lIq~EDf~~~~af  288 (464)
                      ++|||+||||||++|||||||+|||||+||+||+||||||+|++|++||+|+||||++|+++|||+++||||||++||||
T Consensus       162 l~Ly~~~aGIdP~~~lPI~LD~GTnn~~LL~DplYlG~r~~Rv~g~eyd~fvdefv~av~~~fGp~~~I~~EDf~~~~af  241 (555)
T 1gq2_A          162 LALYTACGGVKPHQCLPVMLDVGTDNETLLKDPLYIGLRHKRIRGQAYDDLLDEFMEAVTSRYGMNCLIQFEDFANANAF  241 (555)
T ss_dssp             HHHHHHTTCCCGGGEEEEEEESCCCCHHHHHCTTCCSCSSCCCCTHHHHHHHHHHHHHHHHHHCTTCEEEECSCCHHHHH
T ss_pred             HHHhHhccCCChhheeeeEeecCCCchhhcCCCccCCcCCCCCchHHHHHHHHHHHHHHHHhhCCCcEEeecccCCccHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHcCCCceeecCccchhHHHHHHHHHHHHHhCCCCCcceEEEeCcchHHHHHHHHHHHHHHHhcCCChhhhcCeEE
Q 012398          289 ELLSKYSSSHLVFNDDIQGTASVVLAGILSALKLVGGTLADQTFLFLGAGEAGTGIAELIALEMSKQTKAPIEEARKKIW  368 (464)
Q Consensus       289 ~iL~ryr~~~~~FnDDiQGTaaV~LAgll~Alk~~g~~l~d~riv~~GAGsAg~GiA~ll~~a~~~~~G~s~~eA~~~i~  368 (464)
                      +||+|||++||||||||||||+|+||||+||+|++|++|+||||||+|||+||+|||+||+++|++ +|+|+|||++|||
T Consensus       242 ~il~ryr~~ipvFnDDiqGTa~V~lAgllnAlki~gk~l~d~riv~~GAGaAg~gia~ll~~~~~~-~G~~~eeA~~~i~  320 (555)
T 1gq2_A          242 RLLHKYRNKYCTFNDDIQGTASVAVAGLLAALRITKNRLSDHTVLFQGAGEAALGIANLIVMAMQK-EGVSKEEAIKRIW  320 (555)
T ss_dssp             HHHHHHTTTSEEEETTTHHHHHHHHHHHHHHHHHHTSCGGGCCEEEECCSHHHHHHHHHHHHHHHH-HTCCHHHHHTTEE
T ss_pred             HHHHHHhccCCEecCccchHHHHHHHHHHHHHHHhCCChhhcEEEEECCCHHHHHHHHHHHHHHHH-cCCChHHHhCcEE
Confidence            999999999999999999999999999999999999999999999999999999999999999998 4999999999999


Q ss_pred             EEcccCcccCCCccCCchhchhhhhhcCCCCCHHHHHhcCCCcEEEeccCCCCCCCHHHHHHHHcCCCCcEEEEcCCCCC
Q 012398          369 LVDSKGLIVSSRKESLQHFKKPWAHEHAPIKSLLDAVKAIKPTMLMGTSGVGKTFTKEVVEAMASFNEKPVIFALSNPTS  448 (464)
Q Consensus       369 lvD~~GLl~~~r~~~l~~~k~~fa~~~~~~~~L~e~v~~vkptvLIG~S~~~g~ft~evv~~Ma~~~erPIIFaLSNPt~  448 (464)
                      |||++|||+++|. +|+++|++||++.++.++|+|||+++|||||||+|+++|+||+|||++||++|+|||||||||||+
T Consensus       321 ~~D~~Gli~~~r~-~l~~~k~~~A~~~~~~~~L~eav~~vkp~vlIG~S~~~g~ft~evv~~Ma~~~~~PIIFaLSNPt~  399 (555)
T 1gq2_A          321 MVDSKGLIVKGRA-SLTPEKEHFAHEHCEMKNLEDIVKDIKPTVLIGVAAIGGAFTQQILQDMAAFNKRPIIFALSNPTS  399 (555)
T ss_dssp             EEETTEECBTTCS-SCCTTGGGGCBSCCCCCCHHHHHHHHCCSEEEECSCCTTCSCHHHHHHHHHHCSSCEEEECCSSGG
T ss_pred             EEECCCeeeCCCC-CchHHHHHHHhhcCCCCCHHHHHhhcCCCEEEEecCCCCCCCHHHHHHHHhcCCCCEEEECCCCCC
Confidence            9999999999995 599999999998777789999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCHHHHhccccCC
Q 012398          449 QSECTAEEAYTWSKVN  464 (464)
Q Consensus       449 ~~E~tpedA~~wT~g~  464 (464)
                      ++||+||||++||+|+
T Consensus       400 ~aE~~pe~a~~~t~G~  415 (555)
T 1gq2_A          400 KAECTAEQLYKYTEGR  415 (555)
T ss_dssp             GCSSCHHHHHHHTTTC
T ss_pred             ccCcCHHHHHHhccCC
Confidence            9999999999999985
>1pj3_A NAD-dependent malic enzyme, mitochondrial; oxidative decarboxylase, oxidoreductase; HET: NAD; 2.10A {Homo sapiens} SCOP: c.2.1.7 c.58.1.3 PDB: 1pj2_A* 1do8_A* 1pj4_A* 1qr6_A* 1efl_A* 1pjl_A* 1efk_A* 1gz4_A* 1gz3_A* Back     alignment and structure
>1o0s_A NAD-ME, NAD-dependent malic enzyme; oxidoreductase, oxidative decarboxylase, rossmann fold, MAla dehydrogenase; HET: NAI; 2.00A {Ascaris suum} SCOP: c.2.1.7 c.58.1.3 PDB: 1llq_A* Back     alignment and structure
>3nv9_A Malic enzyme; rossmann fold, oxidoreductase; 2.25A {Entamoeba histolytica} Back     alignment and structure
>2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} Back     alignment and structure
>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Back     alignment and structure
>2dvm_A Malic enzyme, 439AA long hypothetical malate oxidoreductase; NAD, structural genomics, NPPSFA; HET: NAD MES; 1.60A {Pyrococcus horikoshii} PDB: 1ww8_A* Back     alignment and structure
>3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* Back     alignment and structure
>3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure
>3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>3k92_A NAD-GDH, NAD-specific glutamate dehydrogenase; ROCG, oxidoreductase; 2.30A {Bacillus subtilis} PDB: 3k8z_A Back     alignment and structure
>3aoe_E Glutamate dehydrogenase; rossmann fold, NADH, oxidoreductase; 2.60A {Thermus thermophilus} Back     alignment and structure
>4fcc_A Glutamate dehydrogenase; protein complex, rossmann fold, metabolic role, NAD, NADP, oxidoreductase; 2.00A {Escherichia coli O157} PDB: 4fhn_X 2yfg_A 3sbo_A 2yfg_E Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>3aog_A Glutamate dehydrogenase; NAD(H), oxidoreducta; HET: GLU; 2.10A {Thermus thermophilus HB27} PDB: 3aoe_A Back     alignment and structure
>1a4i_A Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase...; THF, bifunctional, oxidoreductase; HET: NDP; 1.50A {Homo sapiens} SCOP: c.2.1.7 c.58.1.2 PDB: 1dia_A* 1dib_A* 1dig_A* Back     alignment and structure
>3l07_A Bifunctional protein fold; structural genomics, IDP01849, methylenetetrahydrofolate dehydrogenase; 1.88A {Francisella tularensis} Back     alignment and structure
>2yfq_A Padgh, NAD-GDH, NAD-specific glutamate dehydrogenase; oxidoreductase; 2.94A {Peptoniphilus asaccharolyticus} Back     alignment and structure
>3p2o_A Bifunctional protein fold; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta-alpha sandwich; HET: NAD; 2.23A {Campylobacter jejuni subsp} Back     alignment and structure
>1b0a_A Protein (fold bifunctional protein); folate, dehydrogenase, cyclcohydrolase, channeling, oxidoreductase,hydrolase; 2.56A {Escherichia coli K12} SCOP: c.2.1.7 c.58.1.2 Back     alignment and structure
>3ngx_A Bifunctional protein fold; methylenetetrahydrofolate dehydrogenase/cyclohydrolase; 2.30A {Thermoplasma acidophilum} PDB: 3ngl_A Back     alignment and structure
>1edz_A 5,10-methylenetetrahydrofolate dehydrogenase; nucleotide-binding domain, monofunctional, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: c.2.1.7 c.58.1.2 PDB: 1ee9_A* Back     alignment and structure
>4a5o_A Bifunctional protein fold; oxidoreductase, hydrolase; 2.20A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} Back     alignment and structure
>2bma_A Glutamate dehydrogenase (NADP+); malaria, drug design, analysis, oligomer organization, oxidoreductase; 2.7A {Plasmodium falciparum} Back     alignment and structure
>4a26_A Putative C-1-tetrahydrofolate synthase, cytoplasm; oxidoreductase, hydrolase, leishmaniasis; 2.70A {Leishmania major} Back     alignment and structure
>3r3j_A Glutamate dehydrogenase; rossman fold, oxidoreductase, apicoplast; 3.10A {Plasmodium falciparum} Back     alignment and structure
>1v8b_A Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2.40A {Plasmodium falciparum} SCOP: c.2.1.4 c.23.12.3 Back     alignment and structure
>1v9l_A Glutamate dehydrogenase; protein-NAD complex, oxidoreductase; HET: NAD; 2.80A {Pyrobaculum islandicum} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>2c2x_A Methylenetetrahydrofolate dehydrogenase- methenyltetrahydrofolate cyclohydrolase; NADP; 2.0A {Mycobacterium tuberculosis} PDB: 2c2y_A Back     alignment and structure
>1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 Back     alignment and structure
>3u95_A Glycoside hydrolase, family 4; hydrolysis, cytosol; 2.00A {Thermotoga neapolitana} PDB: 1vjt_A* Back     alignment and structure
>2tmg_A Protein (glutamate dehydrogenase); metabolic role, mutant, oxidoreductase; 2.90A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.1 PDB: 1b26_A 1b3b_A Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>1mld_A Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D)); HET: CIT; 1.83A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 2dfd_A* Back     alignment and structure
>1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A* Back     alignment and structure
>3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* Back     alignment and structure
>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>1c1d_A L-phenylalanine dehydrogenase; amino acid dehydrogenase, oxidative deamination mechanism, oxidoreductase; HET: PHE NAD; 1.25A {Rhodococcus SP} SCOP: c.2.1.7 c.58.1.1 PDB: 1bw9_A* 1c1x_A* 1bw9_B* 1c1d_B* 1c1x_B* 1bxg_B* 1bxg_A* Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>1bgv_A Glutamate dehydrogenase; oxidoreductase; HET: GLU; 1.90A {Clostridium symbiosum} SCOP: c.2.1.7 c.58.1.1 PDB: 1hrd_A 1k89_A 1aup_A 2yfh_A Back     alignment and structure
>1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>2o4c_A Erythronate-4-phosphate dehydrogenase; erythronate-4-phsphate, NAD, tartrate, phosph oxidoreductase; HET: NAD TLA; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Back     alignment and structure
>3mw9_A GDH 1, glutamate dehydrogenase 1; allostery, inhibition, oxidoreducta; HET: GLU GTP NAD; 2.40A {Bos taurus} SCOP: c.2.1.7 c.58.1.1 PDB: 3mvo_A* 3mvq_A* 3qmu_A* 3etd_A* 3ete_A* 3etg_A* 1l1f_A 1nr1_A 1nr7_A 1nqt_A 1hwx_A* 1hwy_A* 1hwz_A* Back     alignment and structure
>1b8p_A Protein (malate dehydrogenase); oxidoreductase; 1.90A {Aquaspirillum arcticum} SCOP: c.2.1.5 d.162.1.1 PDB: 1b8u_A* 1b8v_A* 3d5t_A Back     alignment and structure
>2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} Back     alignment and structure
>1obb_A Maltase, alpha-glucosidase; glycosidase, sulfinic acid, NAD+, maltose, hydrolase; HET: MAL NAD; 1.90A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>2i6t_A Ubiquitin-conjugating enzyme E2-like isoform A; L-lactate dehydrogenase, oxidoreductase, ubiquitin-protein L unknown function; 2.10A {Homo sapiens} PDB: 3dl2_A Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} Back     alignment and structure
>3fef_A Putative glucosidase LPLD; gulosidase, structural genomics, unknown function, glycosidase, hydrolase, manganese, metal-binding, NAD, PSI- 2; 2.20A {Bacillus subtilis} Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>1o6z_A MDH, malate dehydrogenase; halophilic, ION-binding, protein-solvent interaction, oxidoreductase; HET: NAD; 1.95A {Haloarcula marismortui} SCOP: c.2.1.5 d.162.1.1 PDB: 1gt2_A* 2x0r_A* 2j5k_A 2j5q_A 2j5r_A 1d3a_A 1hlp_A* 2hlp_A Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>2zqz_A L-LDH, L-lactate dehydrogenase; oxidoreductase, rossmann fold, cytoplasm, glycolysis, NAD, phosphoprotein; 2.50A {Lactobacillus casei} PDB: 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>3oet_A Erythronate-4-phosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.36A {Salmonella enterica subsp} Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>1s6y_A 6-phospho-beta-glucosidase; hydrolase, structural genomics, PSI, protein structure initi midwest center for structural genomics; 2.31A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* Back     alignment and structure
>1ez4_A Lactate dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.30A {Lactobacillus pentosus} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* Back     alignment and structure
>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} Back     alignment and structure
>1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Back     alignment and structure
>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Back     alignment and structure
>1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A* Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>1smk_A Malate dehydrogenase, glyoxysomal; tricarboxylic cycle, glyoxysome, NAD, glyoxylate bypass, oxidoreductase; HET: CIT; 2.50A {Citrullus lanatus} PDB: 1sev_A Back     alignment and structure
>1u8x_X Maltose-6'-phosphate glucosidase; structural genomics, PSI, protein structure initiative, MCSG glucosidase, NAD-dependent; HET: G6P NAD; 2.05A {Bacillus subtilis} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>1gtm_A Glutamate dehydrogenase; oxidoreductase, NAD, NADP; 2.20A {Pyrococcus furiosus} SCOP: c.2.1.7 c.58.1.1 PDB: 1bvu_A 1euz_A Back     alignment and structure
>1x7d_A Ornithine cyclodeaminase; binds NAD+, binds L-ornithine, binds L-proline, 2 bundle, beta barrel, rossmann fold, lyase; HET: NAD ORN MES; 1.60A {Pseudomonas putida} SCOP: c.2.1.13 PDB: 1u7h_A* Back     alignment and structure
>2xxj_A L-LDH, L-lactate dehydrogenase; oxidoreductase, hyperthermophIle; HET: NAD; 1.964A {Thermus thermophilus} PDB: 2xxb_A* 3zzn_A* 2v7p_A* 2e37_A* 2v6m_A* 2xxe_A 4a73_A Back     alignment and structure
>1up7_A 6-phospho-beta-glucosidase; hydrolase, family4 hydrolase, Na dependent; HET: G6P NAD; 2.4A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.2 PDB: 1up6_A* 1up4_A Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* Back     alignment and structure
>4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP} Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 Back     alignment and structure
>1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>3nep_X Malate dehydrogenase; halophIle, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle; 1.55A {Salinibacter ruber} Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Back     alignment and structure
>1omo_A Alanine dehydrogenase; two-domain, beta-sandwich-dimer, rossmann-fold NAD domain, human MU crystallin homolog; HET: NAD; 2.32A {Archaeoglobus fulgidus} SCOP: c.2.1.13 PDB: 1vll_A Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* Back     alignment and structure
>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} Back     alignment and structure
>3hdj_A Probable ornithine cyclodeaminase; APC62486, bordetella pertussis TOH structural genomics, PSI-2, protein structure initiative; 1.70A {Bordetella pertussis} Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Back     alignment and structure
>1xdw_A NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans} Back     alignment and structure
>1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>1hye_A L-lactate/malate dehydrogenase; nucleotide binding domain, oxidoreductase; HET: NAP; 1.90A {Methanocaldococcus jannaschii} SCOP: c.2.1.5 d.162.1.1 PDB: 1hyg_A* Back     alignment and structure
>2d4a_B Malate dehydrogenase; archaea, hyperthermophIle, oxidoreductase; 2.87A {Aeropyrum pernix} Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} Back     alignment and structure
>1x0v_A GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic; two independent domains, GXGXXG motif, oxidoreductase; 2.30A {Homo sapiens} PDB: 1x0x_A* 1wpq_A* 2pla_A* Back     alignment and structure
>2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structur genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus} Back     alignment and structure
>3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} Back     alignment and structure
>3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A Back     alignment and structure
>3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} Back     alignment and structure
>1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* Back     alignment and structure
>3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} Back     alignment and structure
>2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>4hy3_A Phosphoglycerate oxidoreductase; PSI-biology, structural genomics, protein structure initiati acid transport and metabolism, NAD binding domain.; 2.80A {Rhizobium etli} Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>1qp8_A Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A {Pyrobaculum aerophilum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} Back     alignment and structure
>2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A Back     alignment and structure
>1j4a_A D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp} SCOP: c.2.1.4 c.23.12.1 PDB: 1j49_A* 2dld_A* Back     alignment and structure
>1yj8_A Glycerol-3-phosphate dehydrogenase; SGPP, structural genomics, PSI; 2.85A {Plasmodium falciparum} Back     alignment and structure
>2i99_A MU-crystallin homolog; thyroid hormine binding protein, oxidoreductase; HET: NDP; 2.60A {Homo sapiens} Back     alignment and structure
>3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Back     alignment and structure
>2yq5_A D-isomer specific 2-hydroxyacid dehydrogenase; oxidoreductase; HET: NAD; 2.75A {Lactobacillus delbrueckii subsp} PDB: 2yq4_A* Back     alignment and structure
>2x0j_A Malate dehydrogenase; oxidoreductase, hyperthermophilic, tricarboxylic acid cycle; HET: ENA; 2.79A {Archaeoglobus fulgidus dsm 4304} PDB: 2x0i_A* Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* Back     alignment and structure
>2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* Back     alignment and structure
>1dxy_A D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarboxylate dehydrogenase, D-lactate dehydrogenas oxidoreductase; HET: NAD; 1.86A {Lactobacillus casei} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} Back     alignment and structure
>3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A Back     alignment and structure
>3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* Back     alignment and structure
>1y7t_A Malate dehydrogenase; NAD-dependent-MDH-NADPH complex, oxidoreductase; HET: NDP; 1.65A {Thermus thermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1iz9_A* 2cvq_A* 1bmd_A* 1bdm_A* 1wze_A* 1wzi_A* Back     alignment and structure
>4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... Back     alignment and structure
>3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B Back     alignment and structure
>1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 Back     alignment and structure
>2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* 3fn4_A Back     alignment and structure
>2qrj_A Saccharopine dehydrogenase, NAD+, L-lysine- forming; sulfate, rossmann fold, alpha-aminoadipate pathway, fungal lysine biosynthesis; 1.60A {Saccharomyces cerevisiae} PDB: 2qrk_A* 2qrl_A* 2q99_A 3ugk_A 3uh1_A* 3uha_A* Back     alignment and structure
>3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} Back     alignment and structure
>1pgj_A 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; oxidoreductase, CHOH(D)-NADP+(B); 2.82A {Trypanosoma brucei} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* Back     alignment and structure
>3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>1npy_A Hypothetical shikimate 5-dehydrogenase-like protein HI0607; structural genomics, PSI, protein structure initiative; 1.75A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>4fgw_A Glycerol-3-phosphate dehydrogenase [NAD(+)] 1; oxidoreductase; 2.45A {Saccharomyces cerevisiae} Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>5mdh_A Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH(D)); HET: NAD; 2.40A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 4mdh_A* Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* Back     alignment and structure
>3hhp_A Malate dehydrogenase; MDH, citric acid cycle, TCA cycle, NAD, oxidoreductase, tricarboxylic acid cycle; 1.45A {Escherichia coli k-12} PDB: 2pwz_A 2cmd_A* 1emd_A* 1ib6_A* 1ie3_A* 4e0b_A* Back     alignment and structure
>1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepresso transcription repressor; HET: NAD; 1.95A {Homo sapiens} SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A* 3ga0_A 2ome_A* Back     alignment and structure
>4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A Back     alignment and structure
>3h5n_A MCCB protein; ubiquitin-activating enzyme, microcin, protein structure, MCCC7, peptide antibiotics, N-P bond formation, transferase; HET: ATP; 1.90A {Escherichia coli} PDB: 3h5r_A 3h9g_A 3h9j_A* 3h9q_A 3h5a_A Back     alignment and structure
>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A* Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>1y8q_A Ubiquitin-like 1 activating enzyme E1A; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_A* 3kyc_A* 3kyd_A* Back     alignment and structure
>3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} Back     alignment and structure
>4gsl_A Ubiquitin-like modifier-activating enzyme ATG7; ubiquitin-like protein activation enzyme, ubiquitin-like Pro transfer enzyme, protein transport; 2.70A {Saccharomyces cerevisiae} PDB: 3vh2_A 4gsk_A 3vh1_A Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>3vh1_A Ubiquitin-like modifier-activating enzyme ATG7; autophagy, zinc binding, metal binding protein; 3.00A {Saccharomyces cerevisiae} PDB: 3vh2_A Back     alignment and structure
>1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} Back     alignment and structure
>3kb6_A D-lactate dehydrogenase; oxidoreductase, D-LDH, NAD, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; HET: MSE NAD 1PE; 2.12A {Aquifex aeolicus} Back     alignment and structure
>2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* Back     alignment and structure
>2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Back     alignment and structure
>4b4u_A Bifunctional protein fold; oxidoreductase; HET: NAP; 1.45A {Acinetobacter baumannii atcc 19606} PDB: 4b4v_A* 4b4w_A* Back     alignment and structure
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} Back     alignment and structure
>1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6 Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 464
d1o0sa2294 c.58.1.3 (A:2-295) Mitochondrial NAD(P)-dependent 1e-142
d1gq2a2257 c.58.1.3 (A:23-279) Mitochondrial NAD(P)-dependent 1e-140
d1pj3a2259 c.58.1.3 (A:21-279) Mitochondrial NAD(P)-dependent 1e-138
d1pj3a1 294 c.2.1.7 (A:280-573) Mitochondrial NAD(P)-dependent 8e-47
d1o0sa1 308 c.2.1.7 (A:296-603) Mitochondrial NAD(P)-dependent 3e-46
d1gq2a1 298 c.2.1.7 (A:280-580) Mitochondrial NAD(P)-dependent 4e-45
d1vl6a1222 c.2.1.7 (A:155-376) Malate oxidoreductase (malic e 9e-30
d1vl6a2154 c.58.1.3 (A:1-154) Malate oxidoreductase (malic en 5e-06
>d1o0sa2 c.58.1.3 (A:2-295) Mitochondrial NAD(P)-dependent malic enzyme {Pig roundworm (Ascaris suum) [TaxId: 6253]} Length = 294 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Aminoacid dehydrogenase-like, N-terminal domain
superfamily: Aminoacid dehydrogenase-like, N-terminal domain
family: Malic enzyme N-domain
domain: Mitochondrial NAD(P)-dependent malic enzyme
species: Pig roundworm (Ascaris suum) [TaxId: 6253]

 Score =  407 bits (1047), Expect = e-142
 Identities = 150/288 (52%), Positives = 194/288 (67%), Gaps = 10/288 (3%)

Query: 27  DVYGEDFATEDQLITP--------WTVSVASGYTLLRDPRHNKGLAFTENERDAHYLRGL 78
           DVY  +    D+                      LL++PR NKG+ F+  ER    L GL
Sbjct: 7   DVYSHNLPPMDEKEMALYKLYRPERVTPKKRSAELLKEPRLNKGMGFSLYERQYLGLHGL 66

Query: 79  LPPALMNQELQEKRLMHNLRQYKVPLQRYVAMMDLQERNERLFYKLLIDNVEELLPVVYT 138
           LPPA M QE Q  R++  LR+    L RY+ +  LQ+RNE+LFY+++ D+V+EL+P+VYT
Sbjct: 67  LPPAFMTQEQQAYRVITKLREQPNDLARYIQLDGLQDRNEKLFYRVVCDHVKELMPIVYT 126

Query: 139 PTVGEACQKYGSIFRRPQGLYISLKEK--GKILEVLKNWPERNIQVIVVTDGERILGLGD 196
           PTVG ACQ +G I+R+P+GLYI++ +    KI ++L NW E +++ IVVTDGERILGLGD
Sbjct: 127 PTVGLACQNFGYIYRKPKGLYITINDNSVSKIYQILSNWHEEDVRAIVVTDGERILGLGD 186

Query: 197 LGCQGMGIPVGKLSLYTALGGLRPSACLPITIDVGTNNEQLLNDEFYIGLRQKRATGQEY 256
           LG  G+GIPVGKL+LY ALGG++P  CLP+ +DVGTNN  LLND FYIGLR KR  G++Y
Sbjct: 187 LGAYGIGIPVGKLALYVALGGVQPKWCLPVLLDVGTNNMDLLNDPFYIGLRHKRVRGKDY 246

Query: 257 AELLQEFMTAVKQNYGEKVLIQFEDFANHNAFELLSKYSSSHLVFNDD 304
             LL  FM A  + YG+K LIQFEDFAN NAF LL KY   + +FNDD
Sbjct: 247 DTLLDNFMKACTKKYGQKTLIQFEDFANPNAFRLLDKYQDKYTMFNDD 294
>d1gq2a2 c.58.1.3 (A:23-279) Mitochondrial NAD(P)-dependent malic enzyme {Domestic pigeon (Columba livia) [TaxId: 8932]} Length = 257 Back     information, alignment and structure
>d1pj3a2 c.58.1.3 (A:21-279) Mitochondrial NAD(P)-dependent malic enzyme {Human (Homo sapiens) [TaxId: 9606]} Length = 259 Back     information, alignment and structure
>d1pj3a1 c.2.1.7 (A:280-573) Mitochondrial NAD(P)-dependent malic enzyme {Human (Homo sapiens) [TaxId: 9606]} Length = 294 Back     information, alignment and structure
>d1o0sa1 c.2.1.7 (A:296-603) Mitochondrial NAD(P)-dependent malic enzyme {Pig roundworm (Ascaris suum) [TaxId: 6253]} Length = 308 Back     information, alignment and structure
>d1gq2a1 c.2.1.7 (A:280-580) Mitochondrial NAD(P)-dependent malic enzyme {Domestic pigeon (Columba livia) [TaxId: 8932]} Length = 298 Back     information, alignment and structure
>d1vl6a1 c.2.1.7 (A:155-376) Malate oxidoreductase (malic enzyme) {Thermotoga maritima [TaxId: 2336]} Length = 222 Back     information, alignment and structure
>d1vl6a2 c.58.1.3 (A:1-154) Malate oxidoreductase (malic enzyme) {Thermotoga maritima [TaxId: 2336]} Length = 154 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query464
d1gq2a2257 Mitochondrial NAD(P)-dependent malic enzyme {Domes 100.0
d1pj3a2259 Mitochondrial NAD(P)-dependent malic enzyme {Human 100.0
d1o0sa2294 Mitochondrial NAD(P)-dependent malic enzyme {Pig r 100.0
d1gq2a1 298 Mitochondrial NAD(P)-dependent malic enzyme {Domes 100.0
d1pj3a1 294 Mitochondrial NAD(P)-dependent malic enzyme {Human 100.0
d1o0sa1 308 Mitochondrial NAD(P)-dependent malic enzyme {Pig r 100.0
d1vl6a1222 Malate oxidoreductase (malic enzyme) {Thermotoga m 100.0
d1vl6a2154 Malate oxidoreductase (malic enzyme) {Thermotoga m 100.0
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 98.33
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 97.13
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 96.59
d1c1da1201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 96.49
d1v9la1242 Glutamate dehydrogenase {Pyrobaculum islandicum [T 96.33
d1b26a1234 Glutamate dehydrogenase {Thermotoga maritima [TaxI 96.28
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 96.21
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 96.15
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 96.09
d1gtma1239 Glutamate dehydrogenase {Archaeon Pyrococcus furio 96.04
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 95.9
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 95.89
d1obba1171 Alpha-glucosidase AglA {Thermotoga maritima [TaxId 95.83
d1vjta1193 Putative alpha-glucosidase TM0752 {Thermotoga mari 95.8
d1u8xx1167 Maltose-6'-phosphate glucosidase GlvA {Bacillus su 95.74
d1s6ya1169 6-phospho-beta-glucosidase {Bacillus stearothermop 95.73
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 95.65
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 95.57
d1bgva1255 Glutamate dehydrogenase {Clostridium symbiosum [Ta 95.47
d1up7a1162 6-phospho-beta-glucosidase {Thermotoga maritima [T 95.24
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 95.15
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 95.14
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 95.08
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 95.07
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 95.03
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 95.02
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 94.9
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 94.89
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 94.78
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 94.76
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 94.46
d1sc6a1188 Phosphoglycerate dehydrogenase {Escherichia coli [ 94.46
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 94.31
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 94.23
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 94.23
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 94.08
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 93.87
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 93.8
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 93.77
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 93.58
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 93.52
d1leha1230 Leucine dehydrogenase {Bacillus sphaericus [TaxId: 93.5
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 93.46
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 93.39
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 93.09
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 93.04
d1gdha1191 D-glycerate dehydrogenase {Hyphomicrobium methylov 92.9
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 92.75
d1b5qa1 347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 92.35
d1hwxa1 293 Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 92.25
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 92.08
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 92.04
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 92.02
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 91.96
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 91.88
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 91.64
d1seza1 373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 91.61
d1c0pa1 268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 91.3
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 91.21
d1b0aa1166 Methylenetetrahydrofolate dehydrogenase/cyclohydro 91.06
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 90.99
d2voua1 265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 90.96
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 90.64
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 90.46
d2iida1 370 L-aminoacid oxidase {Malayan pit viper (Calloselas 90.35
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 90.32
d1ygya1184 Phosphoglycerate dehydrogenase {Mycobacterium tube 90.28
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 90.21
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 89.98
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 89.83
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 89.73
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 89.61
d2dw4a2 449 Lysine-specific histone demethylase 1, LSD1 {Human 88.93
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 88.86
d1a4ia1170 Methylenetetrahydrofolate dehydrogenase/cyclohydro 88.13
d5mdha1154 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 87.79
d1cjca2 230 Adrenodoxin reductase of mitochondrial p450 system 87.76
d2bi7a1 314 UDP-galactopyranose mutase, N-terminal domain {Kle 87.48
d1lqta2 239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 87.39
d1w4xa1 298 Phenylacetone monooxygenase {Thermobifida fusca [T 87.35
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 86.46
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 86.22
d2ivda1 347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 86.04
d2gv8a1 335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 85.98
d1d5ta1 336 Guanine nucleotide dissociation inhibitor, GDI {Co 85.93
d2bcgg1 297 Guanine nucleotide dissociation inhibitor, GDI {Ba 85.8
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 85.48
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 85.47
d1pj5a2 305 N,N-dimethylglycine oxidase {Arthrobacter globifor 84.89
d3c96a1 288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 84.83
d1pn0a1 360 Phenol hydroxylase {Soil-living yeast (Trichosporo 84.53
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 84.5
d1k0ia1 292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 83.57
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 83.08
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 82.71
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 82.04
d1i8ta1 298 UDP-galactopyranose mutase, N-terminal domain {Esc 81.66
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 81.48
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 81.22
d1edza1171 Methylenetetrahydrofolate dehydrogenase/cyclohydro 80.9
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 80.34
d2v5za1 383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 80.21
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 80.18
>d1gq2a2 c.58.1.3 (A:23-279) Mitochondrial NAD(P)-dependent malic enzyme {Domestic pigeon (Columba livia) [TaxId: 8932]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Aminoacid dehydrogenase-like, N-terminal domain
superfamily: Aminoacid dehydrogenase-like, N-terminal domain
family: Malic enzyme N-domain
domain: Mitochondrial NAD(P)-dependent malic enzyme
species: Domestic pigeon (Columba livia) [TaxId: 8932]

Probab=100.00  E-value=4.8e-116  Score=850.04  Aligned_cols=257  Identities=58%  Similarity=1.054  Sum_probs=255.6

Q ss_pred             ccccccccCCCCCcCCCCCHHHHhhcccCCCCCCcccCHHHHHHHHHHHhhcCCCchhHHHHhhhhhhhhhhhhHHHhhh
Q 012398           48 ASGYTLLRDPRHNKGLAFTENERDAHYLRGLLPPALMNQELQEKRLMHNLRQYKVPLQRYVAMMDLQERNERLFYKLLID  127 (464)
Q Consensus        48 ~~g~~~l~~p~~NkgtaFt~~ER~~lgl~GLlPp~v~t~e~Q~~r~~~~~~~~~~~l~Ky~~L~~L~~~Ne~Lfy~ll~~  127 (464)
                      ++|.++|++|.+|||||||.+||++|||+|||||+|+|+|+|++|||.||++++++|+||+||++||++||+|||+++++
T Consensus         1 krG~~lL~~p~~NKGtAFt~~ER~~l~l~GLLP~~v~tle~Qv~r~~~~~~~~~~~l~Ky~yL~~L~~~Ne~LFY~ll~~   80 (257)
T d1gq2a2           1 KKGYEVLRDPHLNKGMAFTLEERQQLNIHGLLPPCFLGQDAQVYSILKNFERLTSDLDRYILLMSLQDRNEKLFYKVLTS   80 (257)
T ss_dssp             CCTTHHHHCTTTCCGGGSCHHHHHHTTCTTSSCSCBCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCHHHHHHHHHH
T ss_pred             CChHHHhcCCCccCccCCCHHHHHHcCCccCCCCCccCHHHHHHHHHHHHHhcCCcHHHHHHHHHHHHhChHHHHHHHHH
Confidence            48999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cccccCCcccchhhHHHHHHHhhhhcCCCcccccccCcchHHHHHhcCCCCCeeEEEEecCceeeccCCCCCCcccccch
Q 012398          128 NVEELLPVVYTPTVGEACQKYGSIFRRPQGLYISLKEKGKILEVLKNWPERNIQVIVVTDGERILGLGDLGCQGMGIPVG  207 (464)
Q Consensus       128 ~~~e~lpivYTPtVg~ac~~~s~i~r~p~gly~s~~d~g~i~~~l~n~~~~~v~viVVTDG~rILGLGDlG~~gm~I~~G  207 (464)
                      |++|+||||||||||+||++||++||+|+|||+|++|+|+|+++|+|||.++|++||||||+|||||||+|++|||||+|
T Consensus        81 ~~~e~~PivYTPTVG~Ac~~ys~~yr~prGlyis~~d~g~i~~il~nwp~~~V~~iVVTDG~rILGlGD~G~~Gm~I~~g  160 (257)
T d1gq2a2          81 DIERFMPIVYTPTVGLACQHYGLAFRRPRGLFITIHDRGHIATMLQSWPESVIKAIVVTDGERILGLGDLGCYGMGIPVG  160 (257)
T ss_dssp             THHHHHHHHSTTHHHHHHHTHHHHCSSCCSEEEEGGGTTCHHHHHHTSSCSCCCEEEEECSSSCGGGCCCGGGGGHHHHH
T ss_pred             HHHHhcCcccCccHHHHHHHHhhhhccccceeeccCChHHHHHHHHhCCCCCeeEEEEecCceeeecCCcCcCccchhhh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhhHHhhhCCCCCCceeeEEeecCCCccccccCccccccccCCCChhhHHHHHHHHHHHHHHhcCCCeeeeeecCCCccH
Q 012398          208 KLSLYTALGGLRPSACLPITIDVGTNNEQLLNDEFYIGLRQKRATGQEYAELLQEFMTAVKQNYGEKVLIQFEDFANHNA  287 (464)
Q Consensus       208 Kl~Ly~a~gGI~P~~~lPV~LDvgTnne~Ll~Dp~YlG~r~~R~~g~~y~~~idefv~av~~~fGp~~lIq~EDf~~~~a  287 (464)
                      |++|||+||||||++|||||||||||||+||+||+|+|+||+|++|++|++||||||+||+++|||+++||||||+++||
T Consensus       161 Kl~lyta~~Gi~P~~~LPv~LDvGTnNe~LL~DP~YlG~R~~R~~g~eY~~fvdefv~av~~~~p~~~~i~~EDf~~~na  240 (257)
T d1gq2a2         161 KLALYTACGGVKPHQCLPVMLDVGTDNETLLKDPLYIGLRHKRIRGQAYDDLLDEFMEAVTSRYGMNCLIQFEDFANANA  240 (257)
T ss_dssp             HHHHHHHTTCCCGGGEEEEEEESCCCCHHHHHCTTCCSCSSCCCCTHHHHHHHHHHHHHHHHHHCTTCEEEECSCCHHHH
T ss_pred             HHHHHHHhcCCCHhhcCCeeecCCCChHHHhcCcccccccCCCCcchHHHHHHHHHHHHHHHhCCCCCEEehhhcCCchH
Confidence            99999999999999999999999999999999999999999999999999999999999999998899999999999999


Q ss_pred             HHHHHHHcCCCceeecC
Q 012398          288 FELLSKYSSSHLVFNDD  304 (464)
Q Consensus       288 f~iL~ryr~~~~~FnDD  304 (464)
                      |++|+|||+++||||||
T Consensus       241 ~~~L~~yr~~~~~FNDD  257 (257)
T d1gq2a2         241 FRLLHKYRNKYCTFNDD  257 (257)
T ss_dssp             HHHHHHHTTTSEEEETT
T ss_pred             HHHHHHHccCCCccCCC
Confidence            99999999999999998
>d1pj3a2 c.58.1.3 (A:21-279) Mitochondrial NAD(P)-dependent malic enzyme {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o0sa2 c.58.1.3 (A:2-295) Mitochondrial NAD(P)-dependent malic enzyme {Pig roundworm (Ascaris suum) [TaxId: 6253]} Back     information, alignment and structure
>d1gq2a1 c.2.1.7 (A:280-580) Mitochondrial NAD(P)-dependent malic enzyme {Domestic pigeon (Columba livia) [TaxId: 8932]} Back     information, alignment and structure
>d1pj3a1 c.2.1.7 (A:280-573) Mitochondrial NAD(P)-dependent malic enzyme {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o0sa1 c.2.1.7 (A:296-603) Mitochondrial NAD(P)-dependent malic enzyme {Pig roundworm (Ascaris suum) [TaxId: 6253]} Back     information, alignment and structure
>d1vl6a1 c.2.1.7 (A:155-376) Malate oxidoreductase (malic enzyme) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vl6a2 c.58.1.3 (A:1-154) Malate oxidoreductase (malic enzyme) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d1v9la1 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} Back     information, alignment and structure
>d1b26a1 c.2.1.7 (A:179-412) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1gtma1 c.2.1.7 (A:181-419) Glutamate dehydrogenase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1obba1 c.2.1.5 (A:2-172) Alpha-glucosidase AglA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1u8xx1 c.2.1.5 (X:3-169) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1s6ya1 c.2.1.5 (A:4-172) 6-phospho-beta-glucosidase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1bgva1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} Back     information, alignment and structure
>d1up7a1 c.2.1.5 (A:1-162) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1a4ia1 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1edza1 c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure