Citrus Sinensis ID: 012402

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460----
MDTHAHSAHLTAPNRSRSSQTPSPSHSASASATSSIHKRKLAATAAAGASEDHAPHAFPPSFSADTRDGALTSNDDLESISARGADSDADDSEDAVVDDDEDEFENDNDSSMRTFTAARLENNNSVGSARNTKLKTENSTVKIENSDGGKEGVTSGSGVLGSTALAGSSVLGTAGKEDTVKIFTENIQASGAYSAREELLKREEEAGNLKFVCLSNDGIDEHMVWLIGLKNIFARQLPNMPKEYIVRLVMDRSHKSVMVIRGNVVVGGITYRPYVSQKFGEIAFCAITADEQVKGYGTRLMNHLKQHARDVDGLTHFLTYADNNAVGYFIKQGFTKEIYLEKDRWQGYIKDYDGGILMECKIDPKLPYTDLSTMIRRQRQAIDEKIRELSNCHIVYPGIDFQKKEAGVPKKIIKVEDIPGLREAGWTPDQWGHSRFRTLTAATDGASNQKHLTAFMRSLLKASL
cccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccEEEEEEEcccccHHHHHHHHHHHHHHHHccccHHHHHHHHHccccccEEEEEEccEEEEEEEEEEccccccEEEEEEEEEcccccccHHHHHHHHHHHHHHHHcccEEEEEEcccHHHHHHHHHcccccEEEcccccccccccccccEEEcEEEccccccccHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHcccccccccccccccHHHHcccccccccccHHHHHHHHHHcccccccccHHHHHHHHccc
cccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccHHcccccccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccEEcccccccccccccccccccccccccccccccccccccEEEEEccccccccHHHHHcHHHHHHHccccEEEEEEccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHcccccEEEEEEEccEEEEEEEEEEEHHHcEEEEEEEEEccccccccHHHHHHHHHHHHHHHHccccEEEEEEcHHHHHHHHHcccEccccccHHHHccccccccccEEEEEEcccccccccHHHHHHHHHHHHHHHHHHHccccEEcccHHHHccccccccccccHcccHHHHHcccccccccccccccccccccccccHHHHHHHHHHHHHHcc
mdthahsahltapnrsrssqtpspshsasasatSSIHKRKLAATAaagasedhaphafppsfsadtrdgaltsnddlesisargadsdaddsedavvdddedefendndssmRTFTAARLennnsvgsarntklktenstvkiensdggkegvtsgsgvlgstalagssvlgtagkeDTVKIFTENIQASGAYSAREELLKREEEAGNLKFVCLSNDGIDEHMVWLIGLKNIFarqlpnmpkEYIVRLVMDRSHKSVMVIRGNVVVGGityrpyvsqkfgEIAFCAITADEQVKGYGTRLMNHLKQHARDVDGLTHFLTYADNNAVGYFIKQGFTKEIYLEKDrwqgyikdydggilmeckidpklpytdlsTMIRRQRQAIDEKIRELSnchivypgidfqkkeagvpkkiikvedipglreagwtpdqwghsrfrtltaatdgasnQKHLTAFMRSLLKASL
mdthahsahltapnrsrssqtpsPSHSASASATSSIHKRKLAATAAAGASEDHAPHAFPPSFSADTRDGALTSNDDLESisargadsdaddseDAVVdddedefendndssmRTFTAarlennnsvgsarntklktenstvkiensdggkegvTSGSGVLGSTALAGSSVLGTAGKEDTVKIFTeniqasgaySAREELLKREEEAGNLKFVCLSNDGIDEHMVWLIGLKNIFARQLPNMPKEYIVRLVMDRSHKSVMVIRGNVVVGGITYRPYVSQKFGEIAFCAITADEQVKGYGTRLMNHLKQHARDVDGLTHFLTYADNNAVGYFIKQGFTKEIYLEKDRWQGYIKDYDGGILMECKIDPKLPYTDLSTMIRRQRQAIDEKIRELSNCHIVYPGidfqkkeagvpKKIIkvedipglreagwtpdqwghSRFRTLTaatdgasnqKHLTAFMRSLLKASL
MDTHAHSAHLTAPNrsrssqtpspshsasasatssIHKRKLaataaagaSEDHAPHAFPPSFSADTRDGALTSNDDLESISARGAdsdaddsedavvdddedefendndssMRTFTAARLENNNSVGSARNTKLKTENSTVKIENSDGGKEgvtsgsgvlgstalagssVLGTAGKEDTVKIFTENIQASGAYSareellkreeeaGNLKFVCLSNDGIDEHMVWLIGLKNIFARQLPNMPKEYIVRLVMDRSHKSVMVIRGNVVVGGITYRPYVSQKFGEIAFCAITADEQVKGYGTRLMNHLKQHARDVDGLTHFLTYADNNAVGYFIKQGFTKEIYLEKDRWQGYIKDYDGGILMECKIDPKLPYTDLSTMIRRQRQAIDEKIRELSNCHIVYPGIDFQKKEAGVPKKIIKVEDIPGLREAGWTPDQWGHSRFRTLTAATDGASNQKHLTAFMRSLLKASL
**************************************************************************************************************************************************************************LGTAGKEDTVKIFTENIQASGAY***********EAGNLKFVCLSNDGIDEHMVWLIGLKNIFARQLPNMPKEYIVRLVMDRSHKSVMVIRGNVVVGGITYRPYVSQKFGEIAFCAITADEQVKGYGTRLMNHLKQHARDVDGLTHFLTYADNNAVGYFIKQGFTKEIYLEKDRWQGYIKDYDGGILMECKIDPKLPYTDLSTMIRRQRQAIDEKIRELSNCHIVYPGIDFQKKEAGVPKKIIKVEDIPGLREAGWTPDQWGHSRFRTLTA***********************
************************************************************************************************************************************************************************************************************EAGNLKFVCLSNDGIDEHMVWLIGLKNIFARQLPNMPKEYIVRLVMDRSHKSVMVIRGNVVVGGITYRPYVSQKFGEIAFCAITADEQVKGYGTRLMNHLKQHARDVDGLTHFLTYADNNAVGYFIKQGFTKEIYLEKDRWQGYIKDYDGGILMECKIDPKLPYTDLSTMIRRQRQAIDEKIRE******VYP*IDFQKKEAGVPKKIIKVEDIPGLREAGWTPDQW*******************HLTAFMRSLLK***
*****************************************************APHAFPPSFSADTRDGALTSNDDLESISA***************************SSMRTFTAARLENNNSVGSARNTKLKTENSTVKIENSDGGKEGVTSGSGVLGSTALAGSSVLGTAGKEDTVKIFTENIQASGAYSAREELLKREEEAGNLKFVCLSNDGIDEHMVWLIGLKNIFARQLPNMPKEYIVRLVMDRSHKSVMVIRGNVVVGGITYRPYVSQKFGEIAFCAITADEQVKGYGTRLMNHLKQHARDVDGLTHFLTYADNNAVGYFIKQGFTKEIYLEKDRWQGYIKDYDGGILMECKIDPKLPYTDLSTMIRRQRQAIDEKIRELSNCHIVYPGIDFQKKEAGVPKKIIKVEDIPGLREAGWTPDQWGHSRFRTLTAATDGASNQKHLTAFMRSLLKASL
*******************************************TA***********************************************************************************************************************************EDTVKIFTENIQASGAYSAREELLKREEEAGNLKFVCLSNDGIDEHMVWLIGLKNIFARQLPNMPKEYIVRLVMDRSHKSVMVIRGNVVVGGITYRPYVSQKFGEIAFCAITADEQVKGYGTRLMNHLKQHARDVDGLTHFLTYADNNAVGYFIKQGFTKEIYLEKDRWQGYIKDYDGGILMECKIDPKLPYTDLSTMIRRQRQAIDEKIRELSNCHIVYPGIDFQKKEAGVPKKIIKVEDIPGLREAGWTP***************DGASNQKHLTAFMRSLLKA*L
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDTHAHSAHLTAPNRSRSSQTPSPSHSASASATSSIHKRKLAATAAAGASEDHAPHAFPPSFSADTRDGALTSNDDLESISARGADSDADDSEDAVVDDDEDEFENDNDSSMRTFTAARLENNNSVGSARNTKLKTENSTVKIENSDGGKEGVTSGSGVLGSTALAGSSVLGTAGKEDTVKIFTENIQASGAYSAREELLKREEEAGNLKFVCLSNDGIDEHMVWLIGLKNIFARQLPNMPKEYIVRLVMDRSHKSVMVIRGNVVVGGITYRPYVSQKFGEIAFCAITADEQVKGYGTRLMNHLKQHARDVDGLTHFLTYADNNAVGYFIKQGFTKEIYLEKDRWQGYIKDYDGGILMECKIDPKLPYTDLSTMIRRQRQAIDEKIRELSNCHIVYPGIDFQKKEAGVPKKIIKVEDIPGLREAGWTPDQWGHSRFRTLTAATDGASNQKHLTAFMRSLLKASL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query464 2.2.26 [Sep-21-2011]
Q9AR19568 Histone acetyltransferase yes no 0.984 0.804 0.758 0.0
Q338B9511 Histone acetyltransferase yes no 0.728 0.661 0.72 1e-147
Q756G9452 Histone acetyltransferase yes no 0.629 0.646 0.478 5e-69
Q03330439 Histone acetyltransferase yes no 0.625 0.660 0.457 4e-68
Q6FTW5546 Histone acetyltransferase yes no 0.482 0.410 0.537 5e-68
Q6CXW4516 Histone acetyltransferase yes no 0.504 0.453 0.527 2e-67
Q9UUK2454 Histone acetyltransferase yes no 0.474 0.484 0.506 5e-65
Q8WZM0464 Histone acetyltransferase yes no 0.502 0.502 0.491 7e-65
Q6BGW1455 Histone acetyltransferase yes no 0.502 0.512 0.506 3e-64
Q9JHD2830 Histone acetyltransferase yes no 0.5 0.279 0.475 2e-57
>sp|Q9AR19|GCN5_ARATH Histone acetyltransferase GCN5 OS=Arabidopsis thaliana GN=HAG1 PE=1 SV=1 Back     alignment and function desciption
 Score =  643 bits (1659), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/467 (75%), Positives = 398/467 (85%), Gaps = 10/467 (2%)

Query: 5   AHSAHLTAPNRSRSSQTPSPSHSASASATSSIHKRKLAATAAAGA--SEDHAPHAFPPSF 62
           +HS+HL A NRSRSSQTPSPSHSASAS TSS+HKRKLAAT AA A  SEDHAP +     
Sbjct: 3   SHSSHLNAANRSRSSQTPSPSHSASASVTSSLHKRKLAATTAANAAASEDHAPPSSSFPP 62

Query: 63  S---ADTRDGALTSNDDLESISARGAD--SDADDSEDAVVDDDEDEF--ENDNDSSMRTF 115
           S   ADTRDGALTSND+LESISARGAD  SD D+SED VVDDDEDEF  E D DSS+RTF
Sbjct: 63  SSFSADTRDGALTSNDELESISARGADTDSDPDESEDIVVDDDEDEFAPEQDQDSSIRTF 122

Query: 116 TAARLENNNSV-GSARNTKLKTENSTVKIENSDGGKEGVTSGSGVLGSTALAGSSVLGTA 174
           TAARL++++ V GS+RNTKLKTE+STVK+E+SDGGK+G +S  G   S  + GSS+ G  
Sbjct: 123 TAARLDSSSGVNGSSRNTKLKTESSTVKLESSDGGKDGGSSVVGTGVSGTVGGSSISGLV 182

Query: 175 GKEDTVKIFTENIQASGAYSAREELLKREEEAGNLKFVCLSNDGIDEHMVWLIGLKNIFA 234
            K+++VK+  EN Q SGAY AREE LKREE+AG LKFVC SND IDEHM+ LIGLKNIFA
Sbjct: 183 PKDESVKVLAENFQTSGAYIAREEALKREEQAGRLKFVCYSNDSIDEHMMCLIGLKNIFA 242

Query: 235 RQLPNMPKEYIVRLVMDRSHKSVMVIRGNVVVGGITYRPYVSQKFGEIAFCAITADEQVK 294
           RQLPNMPKEYIVRL+MDR HKSVMV+RGN+VVGGITYRPY SQKFGEIAFCAITADEQVK
Sbjct: 243 RQLPNMPKEYIVRLLMDRKHKSVMVLRGNLVVGGITYRPYHSQKFGEIAFCAITADEQVK 302

Query: 295 GYGTRLMNHLKQHARDVDGLTHFLTYADNNAVGYFIKQGFTKEIYLEKDRWQGYIKDYDG 354
           GYGTRLMNHLKQHARDVDGLTHFLTYADNNAVGYF+KQGFTKEIYLEKD W G+IKDYDG
Sbjct: 303 GYGTRLMNHLKQHARDVDGLTHFLTYADNNAVGYFVKQGFTKEIYLEKDVWHGFIKDYDG 362

Query: 355 GILMECKIDPKLPYTDLSTMIRRQRQAIDEKIRELSNCHIVYPGIDFQKKEAGVPKKIIK 414
           G+LMECKIDPKLPYTDLS+MIR+QR+AIDE+IRELSNC  VYP I+F K EAG+P+KIIK
Sbjct: 363 GLLMECKIDPKLPYTDLSSMIRQQRKAIDERIRELSNCQNVYPKIEFLKNEAGIPRKIIK 422

Query: 415 VEDIPGLREAGWTPDQWGHSRFRTLTAATDGASNQKHLTAFMRSLLK 461
           VE+I GLREAGWTPDQWGH+RF+    + D  +NQK L A MR+LLK
Sbjct: 423 VEEIRGLREAGWTPDQWGHTRFKLFNGSADMVTNQKQLNALMRALLK 469
Acetylates histone H3 and ADA2 proteins in vitro. Acetylates 'Lys-14' of histone H3. Acetylation of histones gives a specific tag for epigenetic transcription activation. Operates in concert with certain DNA-binding transcriptional activators. Acts via the formation of large multiprotein complexes that modify the chromatin.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 3EC: .EC: 1EC: .EC: 4EC: 8
>sp|Q338B9|GCN5_ORYSJ Histone acetyltransferase GCN5 OS=Oryza sativa subsp. japonica GN=GCN5 PE=2 SV=1 Back     alignment and function description
>sp|Q756G9|GCN5_ASHGO Histone acetyltransferase GCN5 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=GCN5 PE=3 SV=1 Back     alignment and function description
>sp|Q03330|GCN5_YEAST Histone acetyltransferase GCN5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GCN5 PE=1 SV=1 Back     alignment and function description
>sp|Q6FTW5|GCN5_CANGA Histone acetyltransferase GCN5 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=GCN5 PE=3 SV=1 Back     alignment and function description
>sp|Q6CXW4|GCN5_KLULA Histone acetyltransferase GCN5 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GCN5 PE=3 SV=1 Back     alignment and function description
>sp|Q9UUK2|GCN5_SCHPO Histone acetyltransferase gcn5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gcn5 PE=1 SV=1 Back     alignment and function description
>sp|Q8WZM0|GCN5_YARLI Histone acetyltransferase GCN5 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=GCN5 PE=3 SV=1 Back     alignment and function description
>sp|Q6BGW1|GCN5_DEBHA Histone acetyltransferase GCN5 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=GCN5 PE=3 SV=2 Back     alignment and function description
>sp|Q9JHD2|KAT2A_MOUSE Histone acetyltransferase KAT2A OS=Mus musculus GN=Kat2a PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query464
224082720564 histone acetyltransferase [Populus trich 0.984 0.810 0.829 0.0
255559909561 histone acetyltransferase gcn5, putative 0.974 0.805 0.824 0.0
449433487561 PREDICTED: histone acetyltransferase GCN 0.969 0.802 0.772 0.0
356503570543 PREDICTED: histone acetyltransferase GCN 0.887 0.758 0.793 0.0
356570608540 PREDICTED: histone acetyltransferase GCN 0.885 0.761 0.789 0.0
18410098 568 histone acetyltransferase GCN5 [Arabidop 0.984 0.804 0.758 0.0
297816758 568 hypothetical protein ARALYDRAFT_485863 [ 0.984 0.804 0.753 0.0
7258364 586 histon acetyltransferase HAT1 [Arabidops 0.984 0.779 0.729 1e-179
359479577541 PREDICTED: histone acetyltransferase GCN 0.941 0.807 0.724 1e-178
147844069445 hypothetical protein VITISV_039350 [Viti 0.857 0.894 0.718 1e-157
>gi|224082720|ref|XP_002306812.1| histone acetyltransferase [Populus trichocarpa] gi|222856261|gb|EEE93808.1| histone acetyltransferase [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  704 bits (1816), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/468 (82%), Positives = 415/468 (88%), Gaps = 11/468 (2%)

Query: 1   MDTHAHSAHLTAPNRSRSSQTPSPSHSASASATSS----IHKRKLAATAAAGASEDHAPH 56
           MDTH+H   LTAPNRSRSSQ+PSPSHSASASA++S    IHKRKLAA AAA   +DH P 
Sbjct: 1   MDTHSH---LTAPNRSRSSQSPSPSHSASASASASATSSIHKRKLAAAAAA--YDDHLPP 55

Query: 57  AFPPSFSADTRDGALTSNDDLESISARGADSDADDSEDAVVDDDEDEFENDNDSSMRTFT 116
             P S SADTRDGALTSNDDLESISARGADSD+DD+ED+    D+DE + DNDSSMRTFT
Sbjct: 56  FAPSSLSADTRDGALTSNDDLESISARGADSDSDDAEDSDTVLDDDEEDFDNDSSMRTFT 115

Query: 117 AARLENNNSVGSA-RNTKLKTENSTVKIENSDGGKEGVTSGSGVLGSTALAGSSVLGTAG 175
            ARLE  N+ GS+ RNTK+K EN+ VKIENSD GK+G  +G+G +G  A AGSS  G   
Sbjct: 116 TARLETTNAAGSSSRNTKIKMENTNVKIENSDSGKDGGHTGTGAVGPAA-AGSSGPGIVV 174

Query: 176 KEDTVKIFTENIQASGAYSAREELLKREEEAGNLKFVCLSNDGIDEHMVWLIGLKNIFAR 235
           KED+VKIFTEN+QASGAYSAREE LKREEEAG LKFVC SND +DEHMVWLIGLKNIFAR
Sbjct: 175 KEDSVKIFTENLQASGAYSAREESLKREEEAGKLKFVCYSNDDVDEHMVWLIGLKNIFAR 234

Query: 236 QLPNMPKEYIVRLVMDRSHKSVMVIRGNVVVGGITYRPYVSQKFGEIAFCAITADEQVKG 295
           QLPNMPKEYIVRLVMDRSHKSVM+IR N VVGGITYRPYVSQ+FGEIAFCAITADEQVKG
Sbjct: 235 QLPNMPKEYIVRLVMDRSHKSVMIIRRNQVVGGITYRPYVSQRFGEIAFCAITADEQVKG 294

Query: 296 YGTRLMNHLKQHARDVDGLTHFLTYADNNAVGYFIKQGFTKEIYLEKDRWQGYIKDYDGG 355
           YGTRLMNHLKQHARDVDGLTHFLTYADNNAVGYFIKQGFTKEIYLEKDRWQGYIKDYDGG
Sbjct: 295 YGTRLMNHLKQHARDVDGLTHFLTYADNNAVGYFIKQGFTKEIYLEKDRWQGYIKDYDGG 354

Query: 356 ILMECKIDPKLPYTDLSTMIRRQRQAIDEKIRELSNCHIVYPGIDFQKKEAGVPKKIIKV 415
           ILMECKID KLPYTDLSTMIRRQRQAIDEKIRELSNCHI+YPGIDFQKKEAG+PKKIIKV
Sbjct: 355 ILMECKIDQKLPYTDLSTMIRRQRQAIDEKIRELSNCHIIYPGIDFQKKEAGIPKKIIKV 414

Query: 416 EDIPGLREAGWTPDQWGHSRFRTLTAATDGASNQKHLTAFMRSLLKAS 463
           EDIPGLREAGWT DQWGHSRFRTL  ATD A+NQKHLTAFMRSLLKA+
Sbjct: 415 EDIPGLREAGWTLDQWGHSRFRTLNTATDSATNQKHLTAFMRSLLKAT 462

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255559909|ref|XP_002520973.1| histone acetyltransferase gcn5, putative [Ricinus communis] gi|223539810|gb|EEF41390.1| histone acetyltransferase gcn5, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449433487|ref|XP_004134529.1| PREDICTED: histone acetyltransferase GCN5-like [Cucumis sativus] gi|449490675|ref|XP_004158674.1| PREDICTED: histone acetyltransferase GCN5-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356503570|ref|XP_003520580.1| PREDICTED: histone acetyltransferase GCN5-like [Glycine max] Back     alignment and taxonomy information
>gi|356570608|ref|XP_003553477.1| PREDICTED: histone acetyltransferase GCN5-like [Glycine max] Back     alignment and taxonomy information
>gi|18410098|ref|NP_567002.1| histone acetyltransferase GCN5 [Arabidopsis thaliana] gi|75167544|sp|Q9AR19.1|GCN5_ARATH RecName: Full=Histone acetyltransferase GCN5; Short=AtGCN5; AltName: Full=BIG TOP protein gi|13591696|gb|AAK31318.1|AF338768_1 histone acetyltransferase GCN5 [Arabidopsis thaliana] gi|13591702|gb|AAK31321.1| histone acetyltransferase GCN5 [Arabidopsis thaliana] gi|25083382|gb|AAN72068.1| Expressed protein [Arabidopsis thaliana] gi|31711984|gb|AAP68348.1| At3g54610 [Arabidopsis thaliana] gi|332645734|gb|AEE79255.1| histone acetyltransferase GCN5 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297816758|ref|XP_002876262.1| hypothetical protein ARALYDRAFT_485863 [Arabidopsis lyrata subsp. lyrata] gi|297322100|gb|EFH52521.1| hypothetical protein ARALYDRAFT_485863 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|7258364|emb|CAB77581.1| histon acetyltransferase HAT1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|359479577|ref|XP_002275146.2| PREDICTED: histone acetyltransferase GCN5-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147844069|emb|CAN79015.1| hypothetical protein VITISV_039350 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query464
TAIR|locus:3354973568 HAG1 "histone acetyltransferas 0.984 0.804 0.631 1.2e-152
SGD|S000003484439 GCN5 "Acetyltransferase, modif 0.476 0.503 0.549 1.3e-63
DICTYBASE|DDB_G0283459412 gcn5 "HAG group protein" [Dict 0.461 0.519 0.520 2.4e-60
POMBASE|SPAC1952.05454 gcn5 "SAGA complex histone ace 0.465 0.475 0.515 1.5e-58
ASPGD|ASPL0000015187414 gcnE [Emericella nidulans (tax 0.471 0.528 0.5 1.9e-58
GENEDB_PFALCIPARUM|PF08_00341465 gcn5 "histone acetyltransferas 0.463 0.146 0.518 4.1e-58
UNIPROTKB|Q8IB671465 gcn5 "Histone acetyltransferas 0.463 0.146 0.518 4.1e-58
CGD|CAL0001703449 GCN5 [Candida albicans (taxid: 0.474 0.489 0.524 2.8e-57
UNIPROTKB|Q59PZ5449 GCN5 "Likely histone acetyltra 0.474 0.489 0.524 2.8e-57
ZFIN|ZDB-GENE-080403-11800 kat2a "K(lysine) acetyltransfe 0.450 0.261 0.516 4.2e-56
TAIR|locus:3354973 HAG1 "histone acetyltransferase of the GNAT family 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1489 (529.2 bits), Expect = 1.2e-152, P = 1.2e-152
 Identities = 295/467 (63%), Positives = 335/467 (71%)

Query:     5 AHSAHLTAPNXXXXXXXXXXXXXXXXXXXXXIHKRKLXXXXXX--XXSEDHAP--HAFPP 60
             +HS+HL A N                     +HKRKL          SEDHAP   +FPP
Sbjct:     3 SHSSHLNAANRSRSSQTPSPSHSASASVTSSLHKRKLAATTAANAAASEDHAPPSSSFPP 62

Query:    61 S-FSADTRDGALTSNDDLESISARGAXXXXXXXXXXXXXXXXXXXXXX----XXXXMRTF 115
             S FSADTRDGALTSND+LESISARGA                              +RTF
Sbjct:    63 SSFSADTRDGALTSNDELESISARGADTDSDPDESEDIVVDDDEDEFAPEQDQDSSIRTF 122

Query:   116 TAARLENNNSV-GSARNTKLKTENSTVKIENSDGGKEXXXXXXXXXXXXXXXXXXVLGTA 174
             TAARL++++ V GS+RNTKLKTE+STVK+E+SDGGK+                  + G  
Sbjct:   123 TAARLDSSSGVNGSSRNTKLKTESSTVKLESSDGGKDGGSSVVGTGVSGTVGGSSISGLV 182

Query:   175 GKEDTVKIFTENIQASGAYSXXXXXXXXXXXXGNLKFVCLSNDGIDEHMVWLIGLKNIFA 234
              K+++VK+  EN Q SGAY             G LKFVC SND IDEHM+ LIGLKNIFA
Sbjct:   183 PKDESVKVLAENFQTSGAYIAREEALKREEQAGRLKFVCYSNDSIDEHMMCLIGLKNIFA 242

Query:   235 RQLPNMPKEYIVRLVMDRSHKSVMVIRGNVVVGGITYRPYVSQKFGEIAFCAITADEQVK 294
             RQLPNMPKEYIVRL+MDR HKSVMV+RGN+VVGGITYRPY SQKFGEIAFCAITADEQVK
Sbjct:   243 RQLPNMPKEYIVRLLMDRKHKSVMVLRGNLVVGGITYRPYHSQKFGEIAFCAITADEQVK 302

Query:   295 GYGTRLMNHLKQHARDVDGLTHFLTYADNNAVGYFIKQGFTKEIYLEKDRWQGYIKDYDG 354
             GYGTRLMNHLKQHARDVDGLTHFLTYADNNAVGYF+KQGFTKEIYLEKD W G+IKDYDG
Sbjct:   303 GYGTRLMNHLKQHARDVDGLTHFLTYADNNAVGYFVKQGFTKEIYLEKDVWHGFIKDYDG 362

Query:   355 GILMECKIDPKLPYTDLSTMIRRQRQAIDEKIRELSNCHIVYPGIDFQKKEAGVPKKIIK 414
             G+LMECKIDPKLPYTDLS+MIR+QR+AIDE+IRELSNC  VYP I+F K EAG+P+KIIK
Sbjct:   363 GLLMECKIDPKLPYTDLSSMIRQQRKAIDERIRELSNCQNVYPKIEFLKNEAGIPRKIIK 422

Query:   415 VEDIPGLREAGWTPDQWGHSRFRTLTAATDGASNQKHLTAFMRSLLK 461
             VE+I GLREAGWTPDQWGH+RF+    + D  +NQK L A MR+LLK
Sbjct:   423 VEEIRGLREAGWTPDQWGHTRFKLFNGSADMVTNQKQLNALMRALLK 469
GO:0005634 "nucleus" evidence=ISM;IDA
GO:0008080 "N-acetyltransferase activity" evidence=IEA
GO:0000123 "histone acetyltransferase complex" evidence=IPI
GO:0004402 "histone acetyltransferase activity" evidence=ISS;IDA
GO:0045893 "positive regulation of transcription, DNA-dependent" evidence=RCA;TAS
GO:0009908 "flower development" evidence=IMP
GO:0005515 "protein binding" evidence=IPI
GO:0003677 "DNA binding" evidence=IDA
GO:0009416 "response to light stimulus" evidence=IMP
GO:0010015 "root morphogenesis" evidence=IMP
GO:0016573 "histone acetylation" evidence=IDA
GO:0010484 "H3 histone acetyltransferase activity" evidence=IDA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=RCA
GO:0009410 "response to xenobiotic stimulus" evidence=RCA
GO:0009640 "photomorphogenesis" evidence=RCA
GO:0010388 "cullin deneddylation" evidence=RCA
GO:0016567 "protein ubiquitination" evidence=RCA
GO:0016571 "histone methylation" evidence=RCA
GO:0016579 "protein deubiquitination" evidence=RCA
GO:0043687 "post-translational protein modification" evidence=RCA
GO:0048522 "positive regulation of cellular process" evidence=RCA
SGD|S000003484 GCN5 "Acetyltransferase, modifies N-terminal lysines on histones H2B and H3" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0283459 gcn5 "HAG group protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
POMBASE|SPAC1952.05 gcn5 "SAGA complex histone acetyltransferase catalytic subunit Gcn5" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
ASPGD|ASPL0000015187 gcnE [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
GENEDB_PFALCIPARUM|PF08_0034 gcn5 "histone acetyltransferase Gcn5, putative" [Plasmodium falciparum (taxid:5833)] Back     alignment and assigned GO terms
UNIPROTKB|Q8IB67 gcn5 "Histone acetyltransferase GCN5, putative" [Plasmodium falciparum 3D7 (taxid:36329)] Back     alignment and assigned GO terms
CGD|CAL0001703 GCN5 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
UNIPROTKB|Q59PZ5 GCN5 "Likely histone acetyltransferase Gcn5" [Candida albicans SC5314 (taxid:237561)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-080403-11 kat2a "K(lysine) acetyltransferase 2A" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9AR19GCN5_ARATH2, ., 3, ., 1, ., 4, 80.75800.98490.8045yesno
Q338B9GCN5_ORYSJ2, ., 3, ., 1, ., 4, 80.720.72840.6614yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.3.10.976
3rd Layer2.3.1.480.991

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
gw1.II.1641.1
annotation not avaliable (561 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query464
COG5076371 COG5076, COG5076, Transcription factor involved in 2e-22
pfam0058380 pfam00583, Acetyltransf_1, Acetyltransferase (GNAT 5e-10
pfam1350879 pfam13508, Acetyltransf_7, Acetyltransferase (GNAT 5e-08
COG1246153 COG1246, ArgA, N-acetylglutamate synthase and rela 9e-06
cd0430165 cd04301, NAT_SF, N-Acyltransferase superfamily: Va 1e-05
TIGR01890429 TIGR01890, N-Ac-Glu-synth, amino-acid N-acetyltran 8e-04
pfam13673118 pfam13673, Acetyltransf_10, Acetyltransferase (GNA 0.001
>gnl|CDD|227408 COG5076, COG5076, Transcription factor involved in chromatin remodeling, contains bromodomain [Chromatin structure and dynamics / Transcription] Back     alignment and domain information 
 Score = 98.0 bits (244), Expect = 2e-22
 Identities = 68/246 (27%), Positives = 99/246 (40%), Gaps = 18/246 (7%)

Query: 192 AYSAREELLKREEEAGNLKFVCLSNDGIDE-HMVWLIGLKNIFARQLPNMPKEYIVRLVM 250
           +YS        +EE GN     + ND     +     G KN+F +QL  MPKEYI  +V 
Sbjct: 7   SYSQLGRPSVLKEEFGNELLRLVDNDSSPFPNAPEEEGSKNLFQKQLKRMPKEYITSIVD 66

Query: 251 DRSHKSVMVIRGNV-VVGGITYRPYV-----SQKFGEIAFCAITADEQVKGYGTRLMNHL 304
           DR   S+  +  ++  VGGITY P+      S +F EI F AI +     G G+ LM HL
Sbjct: 67  DREPGSMANVNDDLENVGGITYSPFEKNRPESLRFDEIVFLAIESVTPESGLGSLLMAHL 126

Query: 305 KQHA--RDVDGLTHFLTYADNNAVGYFIKQGFTKEIYLEKDRWQGYIKDYDGGILMECKI 362
           K     R    +   L YADN A+  F KQ F ++       + G     +     E   
Sbjct: 127 KTSVKKRKTPKIEDELLYADNKAIAKFKKQLFLRDGRFLSSIFLGLPSKREYPDYYEIIK 186

Query: 363 DPKLPYTDLSTM---IRRQRQAIDEKIRELSNCHIVYPGIDFQKKEAGVPKKIIKVEDIP 419
            P     DL T+   ++  R    E+     N       + +   ++ V     K  +  
Sbjct: 187 SP----MDLLTIQKKLKNGRYKSFEEFVSDLNLMFDNCKL-YNGPDSSVY-VDAKELEKY 240

Query: 420 GLREAG 425
            L+   
Sbjct: 241 FLKLIE 246

Length = 371
>gnl|CDD|216007 pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family Back     alignment and domain information
>gnl|CDD|222185 pfam13508, Acetyltransf_7, Acetyltransferase (GNAT) domain Back     alignment and domain information
>gnl|CDD|224167 COG1246, ArgA, N-acetylglutamate synthase and related acetyltransferases [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|173926 cd04301, NAT_SF, N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate Back     alignment and domain information
>gnl|CDD|233620 TIGR01890, N-Ac-Glu-synth, amino-acid N-acetyltransferase Back     alignment and domain information
>gnl|CDD|222309 pfam13673, Acetyltransf_10, Acetyltransferase (GNAT) domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 464
KOG1472 720 consensus Histone acetyltransferase SAGA/ADA, cata 100.0
PRK07757152 acetyltransferase; Provisional 99.58
PRK10146144 aminoalkylphosphonic acid N-acetyltransferase; Pro 99.48
PF1350879 Acetyltransf_7: Acetyltransferase (GNAT) domain; P 99.44
PRK10140162 putative acetyltransferase YhhY; Provisional 99.44
PF13673117 Acetyltransf_10: Acetyltransferase (GNAT) domain; 99.43
PF0058383 Acetyltransf_1: Acetyltransferase (GNAT) family; I 99.4
PTZ00330147 acetyltransferase; Provisional 99.4
COG1246153 ArgA N-acetylglutamate synthase and related acetyl 99.38
TIGR03827266 GNAT_ablB putative beta-lysine N-acetyltransferase 99.37
PRK03624140 putative acetyltransferase; Provisional 99.36
TIGR01575131 rimI ribosomal-protein-alanine acetyltransferase. 99.35
COG0456177 RimI Acetyltransferases [General function predicti 99.33
PRK07922169 N-acetylglutamate synthase; Validated 99.3
PRK12308614 bifunctional argininosuccinate lyase/N-acetylgluta 99.29
PF13527127 Acetyltransf_9: Acetyltransferase (GNAT) domain; P 99.28
PRK10314153 putative acyltransferase; Provisional 99.28
TIGR01890429 N-Ac-Glu-synth amino-acid N-acetyltransferase. Thi 99.27
PRK09491146 rimI ribosomal-protein-alanine N-acetyltransferase 99.26
PHA00673154 acetyltransferase domain containing protein 99.24
PF13420155 Acetyltransf_4: Acetyltransferase (GNAT) domain; P 99.24
TIGR02382191 wecD_rffC TDP-D-fucosamine acetyltransferase. This 99.22
PLN02706150 glucosamine 6-phosphate N-acetyltransferase 99.21
PRK10514145 putative acetyltransferase; Provisional 99.19
PRK09831147 putative acyltransferase; Provisional 99.18
PLN02825515 amino-acid N-acetyltransferase 99.17
PRK10151179 ribosomal-protein-L7/L12-serine acetyltransferase; 99.14
PF13523152 Acetyltransf_8: Acetyltransferase (GNAT) domain; P 99.11
PRK05279441 N-acetylglutamate synthase; Validated 99.11
PRK10975194 TDP-fucosamine acetyltransferase; Provisional 99.11
PRK15130186 spermidine N1-acetyltransferase; Provisional 99.09
KOG3139165 consensus N-acetyltransferase [General function pr 99.09
TIGR02406157 ectoine_EctA L-2,4-diaminobutyric acid acetyltrans 99.09
cd02169297 Citrate_lyase_ligase Citrate lyase ligase. Citrate 99.07
TIGR03585156 PseH pseudaminic acid biosynthesis N-acetyl transf 99.04
PRK13688156 hypothetical protein; Provisional 99.04
TIGR01686320 FkbH FkbH-like domain. The C-terminal portion of t 99.02
PRK10809194 ribosomal-protein-S5-alanine N-acetyltransferase; 99.01
PHA01807153 hypothetical protein 99.0
TIGR00124332 cit_ly_ligase [citrate (pro-3S)-lyase] ligase. ATP 98.97
TIGR03448292 mycothiol_MshD mycothiol biosynthesis acetyltransf 98.96
TIGR03103 547 trio_acet_GNAT GNAT-family acetyltransferase TIGR0 98.96
PRK10562145 putative acetyltransferase; Provisional 98.91
TIGR03448292 mycothiol_MshD mycothiol biosynthesis acetyltransf 98.88
KOG3216163 consensus Diamine acetyltransferase [Amino acid tr 98.81
PRK01346 411 hypothetical protein; Provisional 98.76
COG3153171 Predicted acetyltransferase [General function pred 98.7
COG1247169 Sortase and related acyltransferases [Cell envelop 98.68
PF13302142 Acetyltransf_3: Acetyltransferase (GNAT) domain; P 98.65
KOG3396150 consensus Glucosamine-phosphate N-acetyltransferas 98.63
PF0844586 FR47: FR47-like protein; InterPro: IPR013653 Prote 98.55
cd0430165 NAT_SF N-Acyltransferase superfamily: Various enzy 98.54
TIGR01211522 ELP3 histone acetyltransferase, ELP3 family. The S 98.46
KOG2488202 consensus Acetyltransferase (GNAT) domain-containi 98.44
KOG3138187 consensus Predicted N-acetyltransferase [General f 98.36
PF1454278 Acetyltransf_CG: GCN5-related N-acetyl-transferase 98.35
PF13718196 GNAT_acetyltr_2: GNAT acetyltransferase 2; PDB: 2Z 98.26
COG1670187 RimL Acetyltransferases, including N-acetylases of 98.24
COG3393268 Predicted acetyltransferase [General function pred 98.18
KOG3397225 consensus Acetyltransferases [General function pre 98.18
COG5076371 Transcription factor involved in chromatin remodel 98.1
KOG3235193 consensus Subunit of the major N alpha-acetyltrans 98.09
KOG3234173 consensus Acetyltransferase, (GNAT) family [Genera 98.02
COG2153155 ElaA Predicted acyltransferase [General function p 97.92
COG0454156 WecD Histone acetyltransferase HPA2 and related ac 97.9
COG1444758 Predicted P-loop ATPase fused to an acetyltransfer 97.82
PF12746265 GNAT_acetyltran: GNAT acetyltransferase; PDB: 3G3S 97.79
PF12568128 DUF3749: Acetyltransferase (GNAT) domain; InterPro 97.55
PF13480142 Acetyltransf_6: Acetyltransferase (GNAT) domain 97.54
COG3053 352 CitC Citrate lyase synthetase [Energy production a 97.44
COG3981174 Predicted acetyltransferase [General function pred 97.4
COG4552 389 Eis Predicted acetyltransferase involved in intrac 97.27
COG238899 Predicted acetyltransferase [General function pred 96.79
PF00765182 Autoind_synth: Autoinducer synthetase; InterPro: I 96.33
PRK13834207 putative autoinducer synthesis protein; Provisiona 96.33
TIGR03694241 exosort_acyl putative PEP-CTERM/exosortase system- 96.22
KOG4135185 consensus Predicted phosphoglucosamine acetyltrans 95.95
PF06852181 DUF1248: Protein of unknown function (DUF1248); In 95.6
KOG4144190 consensus Arylalkylamine N-acetyltransferase [Gene 95.42
COG1243515 ELP3 Histone acetyltransferase [Transcription / Ch 95.04
PF01233162 NMT: Myristoyl-CoA:protein N-myristoyltransferase, 94.85
cd0426499 DUF619-NAGS DUF619 domain of various N-acetylgluta 94.63
PF0844489 Gly_acyl_tr_C: Aralkyl acyl-CoA:amino acid N-acylt 93.99
COG3882574 FkbH Predicted enzyme involved in methoxymalonyl-A 93.88
COG5628143 Predicted acetyltransferase [General function pred 93.57
KOG2535554 consensus RNA polymerase II elongator complex, sub 93.35
COG3916209 LasI N-acyl-L-homoserine lactone synthetase [Signa 93.18
cd0426599 DUF619-NAGS-U DUF619 domain of various N-acetylglu 92.97
TIGR03019330 pepcterm_femAB FemAB-related protein, PEP-CTERM sy 92.68
TIGR03827266 GNAT_ablB putative beta-lysine N-acetyltransferase 92.37
PF1388070 Acetyltransf_13: ESCO1/2 acetyl-transferase 91.95
PF05301120 Mec-17: Touch receptor neuron protein Mec-17; Inte 90.75
PF01853188 MOZ_SAS: MOZ/SAS family; InterPro: IPR002717 Moz i 89.38
COG3818167 Predicted acetyltransferase, GNAT superfamily [Gen 86.82
PLN03238290 probable histone acetyltransferase MYST; Provision 84.98
KOG2036 1011 consensus Predicted P-loop ATPase fused to an acet 83.66
PLN03239351 histone acetyltransferase; Provisional 83.39
KOG2747396 consensus Histone acetyltransferase (MYST family) 82.91
PTZ00064552 histone acetyltransferase; Provisional 82.41
PRK01305240 arginyl-tRNA-protein transferase; Provisional 82.03
>KOG1472 consensus Histone acetyltransferase SAGA/ADA, catalytic subunit PCAF/GCN5 and related proteins [Chromatin structure and dynamics; Transcription] Back     alignment and domain information 
Probab=100.00  E-value=1.3e-44  Score=390.23  Aligned_cols=259  Identities=44%  Similarity=0.767  Sum_probs=237.3

Q ss_pred             CccchhhHHHHHHHhcCcEEEEEecCCCc----hhhHHHHHHHHHHHhhcCCCCcHHHHHHHhhcCCceEEEEEECCE-E
Q 012402          191 GAYSAREELLKREEEAGNLKFVCLSNDGI----DEHMVWLIGLKNIFARQLPNMPKEYIVRLVMDRSHKSVMVIRGNV-V  265 (464)
Q Consensus       191 ~~~~~rd~~a~~eE~~G~I~f~vv~Nd~~----~~~liwL~~LkniFskQLPkMpkEYI~RLVfD~~h~s~VlikdGk-V  265 (464)
                      -....|++.+..||..|.|.|++|.|+.+    ....+||.+++++|++|||+||++||.|++||..|.+++++.+++ |
T Consensus       352 ~~~~~n~~~~n~ee~~~~~~~~vv~~~~s~~~~~~~~~~li~~~~~f~~qL~empkEyi~rlv~d~~h~~~~~~~d~~g~  431 (720)
T KOG1472|consen  352 MLIWRNCEKYNSEESHGLIEFAVIMNSKSLALIKEIPIELIGLRNEFSKQLPEMPKEYISRLVFDTSHHVMARIKDNEGV  431 (720)
T ss_pred             HHHHhcchhhccccchhhhhhhhhhccCcHhHhccchhhhccchhHHHhhcccchHHHHHhhccccccccceeecccccc
Confidence            34567999999999999999999999987    678899999999999999999999999999999999999998765 9


Q ss_pred             EEEEEEEEecCCceEEEEEEEeCCCccccCHHHHHHHHHHHHHHhhCC-CcEEEEccCccchhhhhhcCCeEeeeccccc
Q 012402          266 VGGITYRPYVSQKFGEIAFCAITADEQVKGYGTRLMNHLKQHARDVDG-LTHFLTYADNNAVGYFIKQGFTKEIYLEKDR  344 (464)
Q Consensus       266 IGGI~~R~f~~~~faEIvfIAVsps~QGKGyGS~LMnhLke~Are~~G-i~~LLTyADn~AIgFYkKqGFtkeI~lpk~i  344 (464)
                      |||||+|+|+.++|.||+||||+.+.|.+|||++||+|++++.+. .+ +.++++|+|+.|+++|+||||+++|.+++.+
T Consensus       432 vggi~~r~f~~k~f~eivf~av~~~eqv~g~g~hlmnhlkd~~~~-~~~i~~~ltyad~~aigyfkkqgfs~ei~~~~~~  510 (720)
T KOG1472|consen  432 VGGICFRPFPEKGFTEIVFCAVTTDEQVKGSGTHLMNHLKDYVRS-SSTIDYALTYADEGAIGYFKKQGFSKEIKFEKSP  510 (720)
T ss_pred             ccccccCcCcccCCcceeeccccCcccccccCcCchhhHHHHhhc-cchHHHHHHhhhhcccccccCccchhhcccccCc
Confidence            999999999999999999999999999999999999999999998 55 8899999999999999999999999999999


Q ss_pred             ccccccCCCCceeeeeecCCCCCCcCHHHHHH-HHHHHHHHHHH-hhhccccccCCcchhccccCCCCcccCCCCCcchh
Q 012402          345 WQGYIKDYDGGILMECKIDPKLPYTDLSTMIR-RQRQAIDEKIR-ELSNCHIVYPGIDFQKKEAGVPKKIIKVEDIPGLR  422 (464)
Q Consensus       345 w~GyIKDYEgatLMEC~L~Pki~Y~~l~~mI~-~Qk~~l~~ki~-~~~~~~~v~~gl~~~~~~~g~~~~~i~~~~IPGl~  422 (464)
                      |.||||+|++||+|.|.+.|.|+|+++..++. .|+..+.++|. .+..+++|||||.||+.  |+  +.+++..|||++
T Consensus       511 ~~g~ikdye~~tl~~c~l~~~i~~t~~~~~~~~~~~a~l~~~i~~~~~~~~kv~~gl~~~~~--~~--~~~~~~~iPg~~  586 (720)
T KOG1472|consen  511 YVGYIKDYEGGTLMPCELLPEIPYTELSAIVEHPQKAKLGREIEPEIDEYFKVYPGLECFKD--GV--PQIPPRKIPGFR  586 (720)
T ss_pred             CccccccccCccccchhhccCcchhhhhhhhhhhHHHHHHHhhccccccccccccccccccc--cc--cccCcccCCCch
Confidence            99999999999999999999999999999999 99999999999 77999999999999997  44  679999999999


Q ss_pred             ccCCCCCCcCCCcccccccccCCccchHHHHHHHHHHHHhh
Q 012402          423 EAGWTPDQWGHSRFRTLTAATDGASNQKHLTAFMRSLLKAS  463 (464)
Q Consensus       423 e~GW~p~~~~~~~~r~~~~~~~~~~~~~~l~~~~~~l~~~~  463 (464)
                      |+||.|.+....+         .......++..++.+|..+
T Consensus       587 E~~~~~~~~~~r~---------~~~~~~~~~s~~~~il~~l  618 (720)
T KOG1472|consen  587 ESGWKPEKESYRQ---------EYKKPGKLFSAIQNILDQL  618 (720)
T ss_pred             hhccCcchHHHHh---------hhcccchhhHHHHhHHhhh
Confidence            9999999776443         1133456777777777653

>PRK07757 acetyltransferase; Provisional Back     alignment and domain information
>PRK10146 aminoalkylphosphonic acid N-acetyltransferase; Provisional Back     alignment and domain information
>PF13508 Acetyltransf_7: Acetyltransferase (GNAT) domain; PDB: 3EY5_A 3FRM_B 3D8P_B 3GY9_A 3GYA_A 3S6F_A 2Q7B_A 1CM0_B 1XEB_B 1Y7R_A Back     alignment and domain information
>PRK10140 putative acetyltransferase YhhY; Provisional Back     alignment and domain information
>PF13673 Acetyltransf_10: Acetyltransferase (GNAT) domain; PDB: 2FIW_A 1BOB_A 3FNC_B 3EXN_A Back     alignment and domain information
>PF00583 Acetyltransf_1: Acetyltransferase (GNAT) family; InterPro: IPR000182 The N-acetyltransferases (NAT) (EC 2 Back     alignment and domain information
>PTZ00330 acetyltransferase; Provisional Back     alignment and domain information
>COG1246 ArgA N-acetylglutamate synthase and related acetyltransferases [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03827 GNAT_ablB putative beta-lysine N-acetyltransferase Back     alignment and domain information
>PRK03624 putative acetyltransferase; Provisional Back     alignment and domain information
>TIGR01575 rimI ribosomal-protein-alanine acetyltransferase Back     alignment and domain information
>COG0456 RimI Acetyltransferases [General function prediction only] Back     alignment and domain information
>PRK07922 N-acetylglutamate synthase; Validated Back     alignment and domain information
>PRK12308 bifunctional argininosuccinate lyase/N-acetylglutamate synthase; Provisional Back     alignment and domain information
>PF13527 Acetyltransf_9: Acetyltransferase (GNAT) domain; PDB: 3SXN_C 2I00_D 1M4D_B 1M44_A 1M4G_B 1M4I_A 2OZG_A 2HV2_F 3N7Z_A 3RYO_B Back     alignment and domain information
>PRK10314 putative acyltransferase; Provisional Back     alignment and domain information
>TIGR01890 N-Ac-Glu-synth amino-acid N-acetyltransferase Back     alignment and domain information
>PRK09491 rimI ribosomal-protein-alanine N-acetyltransferase; Provisional Back     alignment and domain information
>PHA00673 acetyltransferase domain containing protein Back     alignment and domain information
>PF13420 Acetyltransf_4: Acetyltransferase (GNAT) domain; PDB: 3DR8_A 3DR6_A 2AE6_B 2JLM_C 2J8R_A 1YVO_B 2J8M_A 2J8N_A 2BL1_A 3IWG_A Back     alignment and domain information
>TIGR02382 wecD_rffC TDP-D-fucosamine acetyltransferase Back     alignment and domain information
>PLN02706 glucosamine 6-phosphate N-acetyltransferase Back     alignment and domain information
>PRK10514 putative acetyltransferase; Provisional Back     alignment and domain information
>PRK09831 putative acyltransferase; Provisional Back     alignment and domain information
>PLN02825 amino-acid N-acetyltransferase Back     alignment and domain information
>PRK10151 ribosomal-protein-L7/L12-serine acetyltransferase; Provisional Back     alignment and domain information
>PF13523 Acetyltransf_8: Acetyltransferase (GNAT) domain; PDB: 2VQY_A 2BUE_A 1V0C_A 1YK3_D 2PR8_A 2QIR_A 2PRB_A 2QML_A 2PC1_A Back     alignment and domain information
>PRK05279 N-acetylglutamate synthase; Validated Back     alignment and domain information
>PRK10975 TDP-fucosamine acetyltransferase; Provisional Back     alignment and domain information
>PRK15130 spermidine N1-acetyltransferase; Provisional Back     alignment and domain information
>KOG3139 consensus N-acetyltransferase [General function prediction only] Back     alignment and domain information
>TIGR02406 ectoine_EctA L-2,4-diaminobutyric acid acetyltransferase Back     alignment and domain information
>cd02169 Citrate_lyase_ligase Citrate lyase ligase Back     alignment and domain information
>TIGR03585 PseH pseudaminic acid biosynthesis N-acetyl transferase Back     alignment and domain information
>PRK13688 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01686 FkbH FkbH-like domain Back     alignment and domain information
>PRK10809 ribosomal-protein-S5-alanine N-acetyltransferase; Provisional Back     alignment and domain information
>PHA01807 hypothetical protein Back     alignment and domain information
>TIGR00124 cit_ly_ligase [citrate (pro-3S)-lyase] ligase Back     alignment and domain information
>TIGR03448 mycothiol_MshD mycothiol biosynthesis acetyltransferase Back     alignment and domain information
>TIGR03103 trio_acet_GNAT GNAT-family acetyltransferase TIGR03103 Back     alignment and domain information
>PRK10562 putative acetyltransferase; Provisional Back     alignment and domain information
>TIGR03448 mycothiol_MshD mycothiol biosynthesis acetyltransferase Back     alignment and domain information
>KOG3216 consensus Diamine acetyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK01346 hypothetical protein; Provisional Back     alignment and domain information
>COG3153 Predicted acetyltransferase [General function prediction only] Back     alignment and domain information
>COG1247 Sortase and related acyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF13302 Acetyltransf_3: Acetyltransferase (GNAT) domain; PDB: 3TTH_C 3JUW_A 2ZXV_A 2Z0Z_A 2VI7_B 3EG7_F 1YRE_C 3IGR_B 3FBU_A 2FCK_A Back     alignment and domain information
>KOG3396 consensus Glucosamine-phosphate N-acetyltransferase [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PF08445 FR47: FR47-like protein; InterPro: IPR013653 Proteins in this entry have a conserved region similar to the C-terminal region of the Drosophila melanogaster (Fruit fly) hypothetical protein FR47 (Q9VR51 from SWISSPROT) Back     alignment and domain information
>cd04301 NAT_SF N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate Back     alignment and domain information
>TIGR01211 ELP3 histone acetyltransferase, ELP3 family Back     alignment and domain information
>KOG2488 consensus Acetyltransferase (GNAT) domain-containing protein [General function prediction only] Back     alignment and domain information
>KOG3138 consensus Predicted N-acetyltransferase [General function prediction only] Back     alignment and domain information
>PF14542 Acetyltransf_CG: GCN5-related N-acetyl-transferase; PDB: 2H5M_A 2Q44_A 1XMT_A 2Q4Y_A 2IL4_A 2EVN_A 1R57_A Back     alignment and domain information
>PF13718 GNAT_acetyltr_2: GNAT acetyltransferase 2; PDB: 2ZPA_B Back     alignment and domain information
>COG1670 RimL Acetyltransferases, including N-acetylases of ribosomal proteins [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG3393 Predicted acetyltransferase [General function prediction only] Back     alignment and domain information
>KOG3397 consensus Acetyltransferases [General function prediction only] Back     alignment and domain information
>COG5076 Transcription factor involved in chromatin remodeling, contains bromodomain [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>KOG3235 consensus Subunit of the major N alpha-acetyltransferase [General function prediction only] Back     alignment and domain information
>KOG3234 consensus Acetyltransferase, (GNAT) family [General function prediction only] Back     alignment and domain information
>COG2153 ElaA Predicted acyltransferase [General function prediction only] Back     alignment and domain information
>COG0454 WecD Histone acetyltransferase HPA2 and related acetyltransferases [Transcription / General function prediction only] Back     alignment and domain information
>COG1444 Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only] Back     alignment and domain information
>PF12746 GNAT_acetyltran: GNAT acetyltransferase; PDB: 3G3S_B Back     alignment and domain information
>PF12568 DUF3749: Acetyltransferase (GNAT) domain; InterPro: IPR024612 This domain is found in uncharacterised proteins from Gammaproteobacteria, and is approximately 40 amino acids in length Back     alignment and domain information
>PF13480 Acetyltransf_6: Acetyltransferase (GNAT) domain Back     alignment and domain information
>COG3053 CitC Citrate lyase synthetase [Energy production and conversion] Back     alignment and domain information
>COG3981 Predicted acetyltransferase [General function prediction only] Back     alignment and domain information
>COG4552 Eis Predicted acetyltransferase involved in intracellular survival and related acetyltransferases [General function prediction only] Back     alignment and domain information
>COG2388 Predicted acetyltransferase [General function prediction only] Back     alignment and domain information
>PF00765 Autoind_synth: Autoinducer synthetase; InterPro: IPR001690 Bacterial species have many methods of controlling gene expression and cell growth Back     alignment and domain information
>PRK13834 putative autoinducer synthesis protein; Provisional Back     alignment and domain information
>TIGR03694 exosort_acyl putative PEP-CTERM/exosortase system-associated acyltransferase Back     alignment and domain information
>KOG4135 consensus Predicted phosphoglucosamine acetyltransferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF06852 DUF1248: Protein of unknown function (DUF1248); InterPro: IPR009658 This entry represents a conserved region within a number of proteins of unknown function that seem to be specific to Caenorhabditis elegans Back     alignment and domain information
>KOG4144 consensus Arylalkylamine N-acetyltransferase [General function prediction only] Back     alignment and domain information
>COG1243 ELP3 Histone acetyltransferase [Transcription / Chromatin structure and dynamics] Back     alignment and domain information
>PF01233 NMT: Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain; InterPro: IPR022676 Myristoyl-CoA:protein N-myristoyltransferase (2 Back     alignment and domain information
>cd04264 DUF619-NAGS DUF619 domain of various N-acetylglutamate Synthases of the fungal arginine-biosynthetic pathway and urea cycle found in humans and fish Back     alignment and domain information
>PF08444 Gly_acyl_tr_C: Aralkyl acyl-CoA:amino acid N-acyltransferase, C-terminal region; InterPro: IPR013652 This entry represents mammalian-specific glycine N-acyltransferase (also called aralkyl acyl-CoA:amino acid N-acyltransferase; 2 Back     alignment and domain information
>COG3882 FkbH Predicted enzyme involved in methoxymalonyl-ACP biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG5628 Predicted acetyltransferase [General function prediction only] Back     alignment and domain information
>KOG2535 consensus RNA polymerase II elongator complex, subunit ELP3/histone acetyltransferase [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>COG3916 LasI N-acyl-L-homoserine lactone synthetase [Signal transduction mechanisms / Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>cd04265 DUF619-NAGS-U DUF619 domain of various N-acetylglutamate Synthases (NAGS) of the urea (U) cycle of humans and fish Back     alignment and domain information
>TIGR03019 pepcterm_femAB FemAB-related protein, PEP-CTERM system-associated Back     alignment and domain information
>TIGR03827 GNAT_ablB putative beta-lysine N-acetyltransferase Back     alignment and domain information
>PF13880 Acetyltransf_13: ESCO1/2 acetyl-transferase Back     alignment and domain information
>PF05301 Mec-17: Touch receptor neuron protein Mec-17; InterPro: IPR007965 Mec-17 is the protein product of one of the 18 genes required for the development and function of the touch receptor neuron for gentle touch Back     alignment and domain information
>PF01853 MOZ_SAS: MOZ/SAS family; InterPro: IPR002717 Moz is a monocytic leukemia Zn_finger protein and the SAS protein from Saccharomyces cerevisiae (Baker's yeast) is involved in silencing the Hmr locus Back     alignment and domain information
>COG3818 Predicted acetyltransferase, GNAT superfamily [General function prediction only] Back     alignment and domain information
>PLN03238 probable histone acetyltransferase MYST; Provisional Back     alignment and domain information
>KOG2036 consensus Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only] Back     alignment and domain information
>PLN03239 histone acetyltransferase; Provisional Back     alignment and domain information
>KOG2747 consensus Histone acetyltransferase (MYST family) [Chromatin structure and dynamics] Back     alignment and domain information
>PTZ00064 histone acetyltransferase; Provisional Back     alignment and domain information
>PRK01305 arginyl-tRNA-protein transferase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query464
1ygh_A164 Hat Domain Of Gcn5 From Saccharomyces Cerevisiae Le 3e-54
5gcn_A166 Catalytic Domain Of Tetrahymena Gcn5 Histone Acetyl 1e-49
1qst_A160 Crystal Structure Of Tetrahymena Gcn5 Length = 160 2e-49
1qsn_A162 Crystal Structure Of Tetrahymena Gcn5 With Bound Co 3e-49
1m1d_A163 Tetrahymena Gcn5 With Bound Bisubstrate Analog Inhi 3e-49
1z4r_A168 Human Gcn5 Acetyltransferase Length = 168 1e-47
1cm0_B168 Crystal Structure Of The PcafCOENZYME-A Complex Len 2e-47
>pdb|1YGH|A Chain A, Hat Domain Of Gcn5 From Saccharomyces Cerevisiae Length = 164 Back     alignment and structure 
Iteration: 1

 Score =  209 bits (531), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 97/163 (59%), Positives = 123/163 (75%), Gaps = 1/163 (0%)
Query: 209 LKFVCLSNDGIDEHMVWLIGLKNIFARQLPNMPKEYIVRLVMDRSHKSVMVIRGNV-VVG 267
           ++F  ++ND   E+M+ L GLKNIF +QLP MPKEYI RLV DRSH S+ VIR  + VVG
Sbjct: 2   IEFRVVNNDNTKENMMVLTGLKNIFQKQLPKMPKEYIARLVYDRSHLSMAVIRKPLTVVG 61
Query: 268 GITYRPYVSQKFGEIAFCAITADEQVKGYGTRLMNHLKQHARDVDGLTHFLTYADNNAVG 327
           GITYRP+  ++F EI FCAI++ EQV+GYG  LMNHLK + R+   + +FLTYADN A+G
Sbjct: 62  GITYRPFDKREFAEIVFCAISSTEQVRGYGAHLMNHLKDYVRNTSNIKYFLTYADNYAIG 121
Query: 328 YFIKQGFTKEIYLEKDRWQGYIKDYDGGILMECKIDPKLPYTD 370
           YF KQGFTKEI L+K  W GYIKDY+GG LM+C + P++ Y D
Sbjct: 122 YFKKQGFTKEITLDKSIWMGYIKDYEGGTLMQCSMLPRIRYLD 164
>pdb|5GCN|A Chain A, Catalytic Domain Of Tetrahymena Gcn5 Histone Acetyltransferase In Complex With Coenzyme A Length = 166 Back     alignment and structure
>pdb|1QST|A Chain A, Crystal Structure Of Tetrahymena Gcn5 Length = 160 Back     alignment and structure
>pdb|1QSN|A Chain A, Crystal Structure Of Tetrahymena Gcn5 With Bound Coenzyme A And Histone H3 Peptide Length = 162 Back     alignment and structure
>pdb|1M1D|A Chain A, Tetrahymena Gcn5 With Bound Bisubstrate Analog Inhibitor Length = 163 Back     alignment and structure
>pdb|1Z4R|A Chain A, Human Gcn5 Acetyltransferase Length = 168 Back     alignment and structure
>pdb|1CM0|B Chain B, Crystal Structure Of The PcafCOENZYME-A Complex Length = 168 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query464
1ygh_A164 ADA4, protein (transcriptional activator GCN5); tr 3e-93
1z4r_A168 General control of amino acid synthesis protein 5- 3e-84
1qst_A160 TGCN5 histone acetyl transferase; GCN5-related N-a 3e-83
1yvk_A163 Hypothetical protein BSU33890; ALPHS-beta protein, 8e-08
2fiw_A172 GCN5-related N-acetyltransferase:aminotransferase 1e-07
2kcw_A147 Uncharacterized acetyltransferase YJAB; GNAT fold, 3e-07
2atr_A138 Acetyltransferase, GNAT family; MCSG, structural g 4e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-07
3frm_A254 Uncharacterized conserved protein; APC61048, staph 1e-06
3ey5_A181 Acetyltransferase-like, GNAT family; structural ge 2e-06
1mk4_A157 Hypothetical protein YQJY; alpha-beta-alpha sandwi 3e-06
3exn_A160 Probable acetyltransferase; GCN5-related N-acetylt 4e-06
2aj6_A159 Hypothetical protein MW0638; structural genomics, 5e-06
1y7r_A133 Hypothetical protein SA2161; structural genomics, 9e-06
3f8k_A160 Protein acetyltransferase; GCN5-related N-acetyltr 1e-05
1n71_A180 AAC(6')-II; aminoglycoside 6'-N-acetyltransferase, 1e-05
3s6f_A145 Hypothetical acetyltransferase; acyl-COA N-acyltra 2e-05
3e0k_A150 Amino-acid acetyltransferase; N-acetylglutamate sy 4e-05
1y9k_A157 IAA acetyltransferase; structural genomics, midwes 5e-05
2i79_A172 Acetyltransferase, GNAT family; acetyl coenzyme *A 5e-05
2gan_A190 182AA long hypothetical protein; alpha-beta protei 8e-05
3owc_A188 Probable acetyltransferase; structural genomics, P 1e-04
3mgd_A157 Predicted acetyltransferase; structural genomics, 1e-04
1bo4_A168 Protein (serratia marcescens aminoglycoside-3-N- a 2e-04
3c26_A266 Putative acetyltransferase TA0821; NP_394282.1, A 2e-04
1y9w_A140 Acetyltransferase; structural genomics, Pro struct 2e-04
1vkc_A158 Putative acetyl transferase; structural genomics, 2e-04
1i12_A160 Glucosamine-phosphate N-acetyltransferase; GNAT, a 3e-04
2q0y_A153 GCN5-related N-acetyltransferase; YP_295895.1, ace 3e-04
3g8w_A169 Lactococcal prophage PS3 protein 05; APC61042, ace 3e-04
3t9y_A150 Acetyltransferase, GNAT family; PSI-biology, struc 4e-04
2r7h_A177 Putative D-alanine N-acetyltransferase of GNAT FA; 4e-04
2jdc_A146 Glyphosate N-acetyltransferase; GNAT; HET: CAO; 1. 5e-04
1on0_A158 YYCN protein; structural genomics, alpha-beta prot 7e-04
3d2m_A456 Putative acetylglutamate synthase; protein-COA-Glu 7e-04
>1ygh_A ADA4, protein (transcriptional activator GCN5); transcriptional regulation, histone acetylation; 1.90A {Saccharomyces cerevisiae} SCOP: d.108.1.1 Length = 164 Back     alignment and structure
 Score =  278 bits (712), Expect = 3e-93
 Identities = 97/163 (59%), Positives = 122/163 (74%), Gaps = 1/163 (0%)

Query: 209 LKFVCLSNDGIDEHMVWLIGLKNIFARQLPNMPKEYIVRLVMDRSHKSVMVIR-GNVVVG 267
           ++F  ++ND   E+M+ L GLKNIF +QLP MPKEYI RLV DRSH S+ VIR    VVG
Sbjct: 2   IEFRVVNNDNTKENMMVLTGLKNIFQKQLPKMPKEYIARLVYDRSHLSMAVIRKPLTVVG 61

Query: 268 GITYRPYVSQKFGEIAFCAITADEQVKGYGTRLMNHLKQHARDVDGLTHFLTYADNNAVG 327
           GITYRP+  ++F EI FCAI++ EQV+GYG  LMNHLK + R+   + +FLTYADN A+G
Sbjct: 62  GITYRPFDKREFAEIVFCAISSTEQVRGYGAHLMNHLKDYVRNTSNIKYFLTYADNYAIG 121

Query: 328 YFIKQGFTKEIYLEKDRWQGYIKDYDGGILMECKIDPKLPYTD 370
           YF KQGFTKEI L+K  W GYIKDY+GG LM+C + P++ Y D
Sbjct: 122 YFKKQGFTKEITLDKSIWMGYIKDYEGGTLMQCSMLPRIRYLD 164
>1z4r_A General control of amino acid synthesis protein 5-like 2; GCN5, acetyltransferase, SGC, structural genomics, structural genomics consortium; HET: ACO; 1.74A {Homo sapiens} SCOP: d.108.1.1 PDB: 1cm0_B* Length = 168 Back     alignment and structure
>1qst_A TGCN5 histone acetyl transferase; GCN5-related N-acetyltransferase, COA binding protein; HET: EPE; 1.70A {Tetrahymena thermophila} SCOP: d.108.1.1 PDB: 1m1d_A* 1pu9_A* 1pua_A* 5gcn_A* 1qsr_A* 1q2d_A* 1q2c_A* 1qsn_A* Length = 160 Back     alignment and structure
>1yvk_A Hypothetical protein BSU33890; ALPHS-beta protein, structural genomics, PSI, protein structure initiative; HET: COA; 3.01A {Bacillus subtilis subsp} SCOP: d.108.1.1 Length = 163 Back     alignment and structure
>2fiw_A GCN5-related N-acetyltransferase:aminotransferase II; alpha-beta-alpha sandwich, GCN4-related acetyltransferase, S genomics, PSI; HET: ACO; 2.35A {Rhodopseudomonas palustris} SCOP: d.108.1.1 Length = 172 Back     alignment and structure
>2kcw_A Uncharacterized acetyltransferase YJAB; GNAT fold, acyltransferase; NMR {Escherichia coli} Length = 147 Back     alignment and structure
>2atr_A Acetyltransferase, GNAT family; MCSG, structural genomics, PSI, protein structure INIT midwest center for structural genomics; 2.01A {Streptococcus pneumoniae} SCOP: d.108.1.1 Length = 138 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3frm_A Uncharacterized conserved protein; APC61048, staphylococcus epidermidis ATCC structural genomics, PSI-2, protein structure initiative; HET: MES; 2.32A {Staphylococcus epidermidis} Length = 254 Back     alignment and structure
>3ey5_A Acetyltransferase-like, GNAT family; structural genomics, APC60148, GNAT famil protein structure initiative; 2.15A {Bacteroides thetaiotaomicron} Length = 181 Back     alignment and structure
>1mk4_A Hypothetical protein YQJY; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: d.108.1.1 Length = 157 Back     alignment and structure
>3exn_A Probable acetyltransferase; GCN5-related N-acetyltransferase, MCSG, P structural genomics, protein structure initiative; HET: ACO; 1.80A {Thermus thermophilus} Length = 160 Back     alignment and structure
>2aj6_A Hypothetical protein MW0638; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL; 1.63A {Staphylococcus aureus subsp} SCOP: d.108.1.1 Length = 159 Back     alignment and structure
>1y7r_A Hypothetical protein SA2161; structural genomics, protein structure initiative, PSI, midwest center for structural genomics; 1.70A {Staphylococcus aureus} SCOP: d.108.1.1 Length = 133 Back     alignment and structure
>3f8k_A Protein acetyltransferase; GCN5-related N-acetyltransferase; HET: COA; 1.84A {Sulfolobus solfataricus P2} Length = 160 Back     alignment and structure
>1n71_A AAC(6')-II; aminoglycoside 6'-N-acetyltransferase, antibiotic resistance, coenzyme A; HET: COA; 1.80A {Enterococcus faecium} SCOP: d.108.1.1 PDB: 2a4n_A* 1b87_A* Length = 180 Back     alignment and structure
>3s6f_A Hypothetical acetyltransferase; acyl-COA N-acyltransferases, structural genomics, joint CENT structural genomics, JCSG; HET: MSE COA; 1.19A {Deinococcus radiodurans} Length = 145 Back     alignment and structure
>3e0k_A Amino-acid acetyltransferase; N-acetylglutamate synthase, structu genomics, PSI-2, protein structure initiative; HET: MSE; 2.52A {Vibrio parahaemolyticus} Length = 150 Back     alignment and structure
>1y9k_A IAA acetyltransferase; structural genomics, midwest center for structural genomics bacillus cereus ATCC 14579, PSI; 2.39A {Bacillus cereus atcc 14579} SCOP: d.108.1.1 Length = 157 Back     alignment and structure
>2i79_A Acetyltransferase, GNAT family; acetyl coenzyme *A, structur genomics, PSI-2, protein structure initiative; HET: ACO; 2.10A {Streptococcus pneumoniae} Length = 172 Back     alignment and structure
>2gan_A 182AA long hypothetical protein; alpha-beta protein., structural genomics, PSI, protein struc initiative; 2.10A {Pyrococcus horikoshii} SCOP: d.108.1.1 Length = 190 Back     alignment and structure
>3owc_A Probable acetyltransferase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: COA; 1.90A {Pseudomonas aeruginosa} Length = 188 Back     alignment and structure
>3mgd_A Predicted acetyltransferase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; HET: ACO; 1.90A {Clostridium acetobutylicum} Length = 157 Back     alignment and structure
>1bo4_A Protein (serratia marcescens aminoglycoside-3-N- acetyltransferase); eubacterial aminoglyco resistance, GCN5-related N-acetyltransferase; HET: SPD COA; 2.30A {Serratia marcescens} SCOP: d.108.1.1 Length = 168 Back     alignment and structure
>3c26_A Putative acetyltransferase TA0821; NP_394282.1, A putative acetyltransferase, acetyltransferase family, structural genomics; 2.00A {Thermoplasma acidophilum dsm 1728} Length = 266 Back     alignment and structure
>1y9w_A Acetyltransferase; structural genomics, Pro structure initiative, PSI, midwest center for structural GE MCSG; 1.90A {Bacillus cereus} SCOP: d.108.1.1 Length = 140 Back     alignment and structure
>1vkc_A Putative acetyl transferase; structural genomics, pyrococcus furiosus southeast collaboratory for structural genomics, secsg; 1.89A {Pyrococcus furiosus} SCOP: d.108.1.1 Length = 158 Back     alignment and structure
>1i12_A Glucosamine-phosphate N-acetyltransferase; GNAT, alpha/beta; HET: ACO; 1.30A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 1i1d_A* 1i21_A Length = 160 Back     alignment and structure
>2q0y_A GCN5-related N-acetyltransferase; YP_295895.1, acetyltransferase (GNAT) family, structural genomics, joint center for ST genomics; HET: MSE; 1.80A {Ralstonia eutropha JMP134} Length = 153 Back     alignment and structure
>3g8w_A Lactococcal prophage PS3 protein 05; APC61042, acetyltransferase, staphylococcus epidermidis ATCC structural genomics; HET: NHE FLC; 2.70A {Staphylococcus epidermidis atcc 12228} Length = 169 Back     alignment and structure
>3t9y_A Acetyltransferase, GNAT family; PSI-biology, structural genomics, midwest center for structu genomics, MCSG; HET: PGE; 2.00A {Staphylococcus aureus} Length = 150 Back     alignment and structure
>2r7h_A Putative D-alanine N-acetyltransferase of GNAT FA; putative acetyltransferase of the GNAT family; 1.85A {Desulfovibrio desulfuricans subsp} Length = 177 Back     alignment and structure
>2jdc_A Glyphosate N-acetyltransferase; GNAT; HET: CAO; 1.6A {Bacillus licheniformis} SCOP: d.108.1.1 PDB: 2bsw_A* 2jdd_A* Length = 146 Back     alignment and structure
>1on0_A YYCN protein; structural genomics, alpha-beta protein with anti-parallel B strands, PSI, protein structure initiative; 2.20A {Bacillus subtilis} SCOP: d.108.1.1 Length = 158 Back     alignment and structure
>3d2m_A Putative acetylglutamate synthase; protein-COA-Glu ternary complex, transferase; HET: COA GLU; 2.21A {Neisseria gonorrhoeae} PDB: 2r8v_A* 3b8g_A* 2r98_A* 3d2p_A* Length = 456 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query464
1ygh_A164 ADA4, protein (transcriptional activator GCN5); tr 99.96
1qst_A160 TGCN5 histone acetyl transferase; GCN5-related N-a 99.95
1z4r_A168 General control of amino acid synthesis protein 5- 99.93
1n71_A180 AAC(6')-II; aminoglycoside 6'-N-acetyltransferase, 99.72
3lod_A162 Putative acyl-COA N-acyltransferase; structural ge 99.67
2x7b_A168 N-acetyltransferase SSO0209; HET: COA; 1.95A {Sulf 99.64
1tiq_A180 Protease synthase and sporulation negative regulat 99.64
2q0y_A153 GCN5-related N-acetyltransferase; YP_295895.1, ace 99.63
1cjw_A166 Protein (serotonin N-acetyltransferase); HET: COT; 99.62
4e0a_A164 BH1408 protein; structural genomics, PSI-biology, 99.61
3ey5_A181 Acetyltransferase-like, GNAT family; structural ge 99.61
1ghe_A177 Acetyltransferase; acyl coenzyme A complex; HET: A 99.61
2ob0_A170 Human MAK3 homolog; acetyltransferase, structural 99.61
2dxq_A150 AGR_C_4057P, acetyltransferase; structural genomic 99.61
3mgd_A157 Predicted acetyltransferase; structural genomics, 99.6
1bo4_A168 Protein (serratia marcescens aminoglycoside-3-N- a 99.6
2pdo_A144 Acetyltransferase YPEA; alpha-beta-alpha sandwich, 99.6
4evy_A166 Aminoglycoside N(6')-acetyltransferase type 1; cen 99.59
2eui_A153 Probable acetyltransferase; dimer, structural geno 99.59
3kkw_A182 Putative uncharacterized protein; acetyltransferas 99.59
1z4e_A153 Transcriptional regulator; nysgxrc target T2017, G 99.58
4h89_A173 GCN5-related N-acetyltransferase; N-acyltransferas 99.58
2i6c_A160 Putative acetyltransferase; GNAT family, structura 99.58
3efa_A147 Putative acetyltransferase; structural genom 2, pr 99.57
2fia_A162 Acetyltransferase; structural genomics, PSI, prote 99.57
2ree_A224 CURA; GNAT, S-acetyltransferase, decarboxylase, po 99.57
3g8w_A169 Lactococcal prophage PS3 protein 05; APC61042, ace 99.57
1kux_A207 Aralkylamine, serotonin N-acetyltransferase; enzym 99.57
1s3z_A165 Aminoglycoside 6'-N-acetyltransferase; GNAT, amino 99.57
2g3a_A152 Acetyltransferase; structural genomics, PSI, prote 99.56
2jdc_A146 Glyphosate N-acetyltransferase; GNAT; HET: CAO; 1. 99.56
2r7h_A177 Putative D-alanine N-acetyltransferase of GNAT FA; 99.56
3gy9_A150 GCN5-related N-acetyltransferase; YP_001815201.1, 99.56
2ae6_A166 Acetyltransferase, GNAT family; GCN5-related N-ace 99.56
2i79_A172 Acetyltransferase, GNAT family; acetyl coenzyme *A 99.55
3e0k_A150 Amino-acid acetyltransferase; N-acetylglutamate sy 99.55
3fix_A183 N-acetyltransferase; termoplasma acidophilum, stru 99.55
2ge3_A170 Probable acetyltransferase; structural GEN PSI, pr 99.55
3dr6_A174 YNCA; acetyltransferase, csgid target, essential g 99.54
2cy2_A174 TTHA1209, probable acetyltransferase; structural g 99.54
3i9s_A183 Integron cassette protein; oyster POND, woods HOLE 99.54
3bln_A143 Acetyltransferase GNAT family; NP_981174.1, struct 99.53
3t9y_A150 Acetyltransferase, GNAT family; PSI-biology, struc 99.53
3owc_A188 Probable acetyltransferase; structural genomics, P 99.53
3d8p_A163 Acetyltransferase of GNAT family; NP_373092.1, str 99.53
2fl4_A149 Spermine/spermidine acetyltransferase; structural 99.53
2atr_A138 Acetyltransferase, GNAT family; MCSG, structural g 99.53
1qsm_A152 HPA2 histone acetyltransferase; protein-acetyl coe 99.53
3fnc_A163 Protein LIN0611, putative acetyltransferase; GNAT, 99.52
3jvn_A166 Acetyltransferase; alpha-beta protein, structural 99.52
2bei_A170 Diamine acetyltransferase 2; SSAT2, BC011751, AAH1 99.52
3dsb_A157 Putative acetyltransferase; APC60368.2, ST genomic 99.51
1wwz_A159 Hypothetical protein PH1933; structural genomics, 99.51
2fe7_A166 Probable N-acetyltransferase; structural genomics, 99.51
3pp9_A187 Putative streptothricin acetyltransferase; toxin p 99.51
1mk4_A157 Hypothetical protein YQJY; alpha-beta-alpha sandwi 99.51
2oh1_A179 Acetyltransferase, GNAT family; YP_013287.1, struc 99.51
2q7b_A181 Acetyltransferase, GNAT family; NP_689019.1, struc 99.51
1q2y_A140 Protein YJCF, similar to hypothetical proteins; GC 99.51
2cnt_A160 Modification of 30S ribosomal subunit protein S18; 99.51
1u6m_A199 Acetyltransferase, GNAT family; structural genomic 99.5
3exn_A160 Probable acetyltransferase; GCN5-related N-acetylt 99.5
1y9k_A157 IAA acetyltransferase; structural genomics, midwes 99.5
1xeb_A150 Hypothetical protein PA0115; midwest center for st 99.5
1vkc_A158 Putative acetyl transferase; structural genomics, 99.5
2fiw_A172 GCN5-related N-acetyltransferase:aminotransferase 99.5
4ag7_A165 Glucosamine-6-phosphate N-acetyltransferase; HET: 99.5
3fyn_A176 Integron gene cassette protein HFX_CASS3; integron 99.5
1vhs_A175 Similar to phosphinothricin acetyltransferase; str 99.49
3i3g_A161 N-acetyltransferase; malaria, structural genomics, 99.49
1y9w_A140 Acetyltransferase; structural genomics, Pro struct 99.49
3igr_A184 Ribosomal-protein-S5-alanine N-acetyltransferase; 99.49
2bue_A202 AAC(6')-IB; GNAT, transferase, aminoglycoside, flu 99.49
4fd4_A217 Arylalkylamine N-acetyltransferase like 5B; GNAT; 99.49
3t90_A149 Glucose-6-phosphate acetyltransferase 1; GNAT fold 99.48
1y7r_A133 Hypothetical protein SA2161; structural genomics, 99.48
2j8m_A172 Acetyltransferase PA4866 from P. aeruginosa; GCN5 99.47
2ozh_A142 Hypothetical protein XCC2953; structural genomics, 99.47
3ld2_A197 SMU.2055, putative acetyltransferase; HET: COA; 2. 99.47
1s7k_A182 Acetyl transferase; GNAT; 1.80A {Salmonella typhim 99.47
3r9f_A188 MCCE protein; microcin C7, acetyltransferase, SELF 99.47
2vi7_A177 Acetyltransferase PA1377; GNAT, GCN5 family, N-ace 99.47
1yre_A197 Hypothetical protein PA3270; APC5563, midwest cent 99.46
2pc1_A201 Acetyltransferase, GNAT family; NP_688560.1, struc 99.46
1yx0_A159 Hypothetical protein YSNE; NESG, GFT structral gen 99.46
2r1i_A172 GCN5-related N-acetyltransferase; YP_831484.1, put 99.45
1yvk_A163 Hypothetical protein BSU33890; ALPHS-beta protein, 99.45
2aj6_A159 Hypothetical protein MW0638; structural genomics, 99.45
1nsl_A184 Probable acetyltransferase; structural genomics, h 99.45
3tth_A170 Spermidine N1-acetyltransferase; central intermedi 99.44
3f5b_A182 Aminoglycoside N(6')acetyltransferase; APC60744, l 99.44
3eo4_A164 Uncharacterized protein MJ1062; APC60792.2,MJ_1062 99.44
1ufh_A180 YYCN protein; alpha and beta, fold, acetyltransfer 99.44
3pzj_A209 Probable acetyltransferases; MCSG, PSI-2, structur 99.44
2o28_A184 Glucosamine 6-phosphate N-acetyltransferase; struc 99.44
2jlm_A182 Putative phosphinothricin N-acetyltransferase; met 99.43
3fbu_A168 Acetyltransferase, GNAT family; structur genomics, 99.43
1m4i_A181 Aminoglycoside 2'-N-acetyltransferase; COA binding 99.43
3eg7_A176 Spermidine N1-acetyltransferase; structural genomi 99.43
3f8k_A160 Protein acetyltransferase; GCN5-related N-acetyltr 99.43
2gan_A190 182AA long hypothetical protein; alpha-beta protei 99.42
2qec_A204 Histone acetyltransferase HPA2 and related acetylt 99.42
2z10_A194 Ribosomal-protein-alanine acetyltransferase; alpha 99.41
3frm_A254 Uncharacterized conserved protein; APC61048, staph 99.41
3qb8_A197 A654L protein; GNAT N-acetyltransferase, acetyltra 99.41
2vez_A190 Putative glucosamine 6-phosphate acetyltransferase 99.41
1on0_A158 YYCN protein; structural genomics, alpha-beta prot 99.41
1yr0_A175 AGR_C_1654P, phosphinothricin acetyltransferase; s 99.41
1i12_A160 Glucosamine-phosphate N-acetyltransferase; GNAT, a 99.41
3d3s_A189 L-2,4-diaminobutyric acid acetyltransferase; alpha 99.41
2b5g_A171 Diamine acetyltransferase 1; structural genomics, 99.39
2q04_A211 Acetoin utilization protein; ZP_00540088.1, struct 99.39
2wpx_A339 ORF14; transferase, acetyl transferase, antibiotic 99.37
2k5t_A128 Uncharacterized protein YHHK; N-acetyl transferase 99.37
3s6f_A145 Hypothetical acetyltransferase; acyl-COA N-acyltra 99.36
2fck_A181 Ribosomal-protein-serine acetyltransferase, putat; 99.35
4fd5_A222 Arylalkylamine N-acetyltransferase 2; GNAT; 1.64A 99.35
2g0b_A198 FEEM; N-acyl transferase, environmental DNA, prote 99.35
3h4q_A188 Putative acetyltransferase; NP_371943.1, structura 99.35
2kcw_A147 Uncharacterized acetyltransferase YJAB; GNAT fold, 99.34
3ddd_A288 Putative acetyltransferase; NP_142035.1, structura 99.34
2qml_A198 BH2621 protein; structural genomics, joint center 99.32
3ec4_A228 Putative acetyltransferase from the GNAT family; Y 99.31
3te4_A215 GH12636P, dopamine N acetyltransferase, isoform A; 99.31
2fsr_A195 Acetyltransferase; alpha-beta-sandwich, structural 99.31
3tcv_A246 GCN5-related N-acetyltransferase; GRAM negative co 99.31
1yk3_A210 Hypothetical protein RV1347C/MT1389; acyltransfera 99.3
3juw_A175 Probable GNAT-family acetyltransferase; structural 99.3
2zpa_A671 Uncharacterized protein YPFI; RNA modification enz 99.28
3d2m_A456 Putative acetylglutamate synthase; protein-COA-Glu 99.27
4ava_A333 Lysine acetyltransferase; allosteric regulation, d 99.25
4fd7_A238 Putative arylalkylamine N-acetyltransferase 7; GNA 99.24
3iwg_A276 Acetyltransferase, GNAT family; structural genomic 99.23
2vzy_A218 RV0802C; transferase, GCN5-related N-acetyltransfe 99.23
1r57_A102 Conserved hypothetical protein; GCN5, N-acetyltran 99.19
2pr1_A163 Uncharacterized N-acetyltransferase YLBP; YIBP pro 99.18
2wpx_A339 ORF14; transferase, acetyl transferase, antibiotic 99.18
3tt2_A330 GCN5-related N-acetyltransferase; structural genom 99.18
2ozg_A 396 GCN5-related N-acetyltransferase; YP_325469.1, ace 99.15
3c26_A266 Putative acetyltransferase TA0821; NP_394282.1, A 99.15
3g3s_A249 GCN5-related N-acetyltransferase; ZP_00874857.1, a 99.14
3r1k_A 428 Enhanced intracellular surviVal protein; GNAT, ace 99.13
2hv2_A 400 Hypothetical protein; PSI, protein structure initi 99.12
2i00_A 406 Acetyltransferase, GNAT family; structural genomic 99.12
3n7z_A 388 Acetyltransferase, GNAT family; PSI2, MCSG, struct 99.05
2zw5_A301 Bleomycin acetyltransferase; dimer, two domains; H 99.05
1p0h_A318 Hypothetical protein RV0819; GNAT fold, acetyltran 99.04
3sxn_A 422 Enhanced intracellular surviVal protein; GNAT fold 99.03
3tt2_A330 GCN5-related N-acetyltransferase; structural genom 99.0
1sqh_A312 Hypothetical protein CG14615-PA; structural genomi 98.84
2d4p_A141 Hypothetical protein TTHA1254; structural genomics 98.82
2ft0_A235 TDP-fucosamine acetyltransferase; GNAT fold acetyl 98.81
1ro5_A201 Autoinducer synthesis protein LASI; alpha-beta-alp 98.75
1p0h_A318 Hypothetical protein RV0819; GNAT fold, acetyltran 98.74
1xmt_A103 Putative acetyltransferase; structural genomics, p 98.67
3p2h_A201 AHL synthase; acyl-ACP binding, SAM binding, signa 98.61
1kzf_A230 Acyl-homoserinelactone synthase ESAI; alpha-beta, 98.51
3shp_A176 Putative acetyltransferase STHE_0691; PSI-biology, 98.32
3dns_A135 Ribosomal-protein-alanine acetyltransferase; N-ter 97.88
1bob_A320 HAT1, histone acetyltransferase; histone modificat 97.55
1yle_A342 Arginine N-succinyltransferase, alpha chain; struc 97.11
3s6g_A460 N-acetylglutamate kinase / N-acetylglutamate SYNT; 95.16
4b14_A385 Glycylpeptide N-tetradecanoyltransferase; malaria, 95.14
3gkr_A336 FEMX; FEMX, peptidoglycan, hexapeptide, transferas 94.7
2p0w_A324 Histone acetyltransferase type B catalytic subuni; 94.5
3iu1_A383 Glycylpeptide N-tetradecanoyltransferase 1; N-myri 93.52
2wuu_A421 N-myristoyltransferase; acyltransferase; HET: NHM; 93.01
3ddd_A288 Putative acetyltransferase; NP_142035.1, structura 92.63
4b5o_A200 Alpha-tubulin N-acetyltransferase; microtubules, c 92.54
1iic_A 422 Peptide N-myristoyltransferase; HET: MYA; 2.20A {S 92.13
1iyk_A392 Myristoyl-COA:protein N-myristoyltransferase; HET: 92.04
4hkf_A191 Alpha-tubulin N-acetyltransferase; tubulin acetylt 91.9
1rxt_A496 Myristoyl-, glycylpeptide N-tetradecanoyltransfera 91.23
4h6u_A200 Alpha-tubulin N-acetyltransferase; tubulin acetylt 90.48
4gs4_A240 Alpha-tubulin N-acetyltransferase; acetyl coenzyme 90.32
3s6k_A467 Acetylglutamate kinase; synthase, transferase; 2.8 89.45
3iwg_A276 Acetyltransferase, GNAT family; structural genomic 87.34
2ozu_A284 Histone acetyltransferase MYST3; structural genomi 85.75
3to7_A276 Histone acetyltransferase ESA1; MYST family; HET: 85.27
2ou2_A280 Histone acetyltransferase htatip; structural genom 83.23
2pq8_A278 Probable histone acetyltransferase MYST1; MOF, str 80.99
>1ygh_A ADA4, protein (transcriptional activator GCN5); transcriptional regulation, histone acetylation; 1.90A {Saccharomyces cerevisiae} SCOP: d.108.1.1 Back     alignment and structure
Probab=99.96  E-value=1.7e-28  Score=212.11  Aligned_cols=163  Identities=60%  Similarity=1.041  Sum_probs=146.9

Q ss_pred             cEEEEEecCCCchhhHHHHHHHHHHHhhcCCCCcHHHHHHHhhcCCceEEEEEE-CCEEEEEEEEEEecCCceEEEEEEE
Q 012402          208 NLKFVCLSNDGIDEHMVWLIGLKNIFARQLPNMPKEYIVRLVMDRSHKSVMVIR-GNVVVGGITYRPYVSQKFGEIAFCA  286 (464)
Q Consensus       208 ~I~f~vv~Nd~~~~~liwL~~LkniFskQLPkMpkEYI~RLVfD~~h~s~Vlik-dGkVIGGI~~R~f~~~~faEIvfIA  286 (464)
                      +|+|+.+++++.++.+.||..++++|..++|.++.+|+.+++.++.+..+++.. +|++||++.+..+......+|..++
T Consensus         1 ~i~~r~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~ivG~~~~~~~~~~~~~~i~~l~   80 (164)
T 1ygh_A            1 KIEFRVVNNDNTKENMMVLTGLKNIFQKQLPKMPKEYIARLVYDRSHLSMAVIRKPLTVVGGITYRPFDKREFAEIVFCA   80 (164)
T ss_dssp             CEEEEEECCSSCHHHHHHHHHHHHHHHHHCTTSCHHHHHHHHHCTTCEEEEEEETTTEEEEEEEEEEEGGGTEEEEEEEE
T ss_pred             CeeEEEecCCCchhhHHHHHHHHHHHHhhcccCCHHHHHHHhhCCCceEEEEECCCCEEEEEEEEEEcCCCCceEEEEEE
Confidence            589999999999999999999999999999999999999999988877755554 7899999988876555678899999


Q ss_pred             eCCCccccCHHHHHHHHHHHHHHhhCCCcEEEEccCccchhhhhhcCCeEeeecccccccccccCCCCceeeeeecCCCC
Q 012402          287 ITADEQVKGYGTRLMNHLKQHARDVDGLTHFLTYADNNAVGYFIKQGFTKEIYLEKDRWQGYIKDYDGGILMECKIDPKL  366 (464)
Q Consensus       287 Vsps~QGKGyGS~LMnhLke~Are~~Gi~~LLTyADn~AIgFYkKqGFtkeI~lpk~iw~GyIKDYEgatLMEC~L~Pki  366 (464)
                      |+|++||||||+.||+++++++++..|+..+.+..+|.|++||+|+||+....++...|.|++++|+++++|+|.|.|.|
T Consensus        81 V~p~~rg~Gig~~ll~~~~~~a~~~~g~~~l~v~~~n~a~~~y~k~GF~~~~~~~~~~~~~~~~~~~~~~~m~~~l~~~~  160 (164)
T 1ygh_A           81 ISSTEQVRGYGAHLMNHLKDYVRNTSNIKYFLTYADNYAIGYFKKQGFTKEITLDKSIWMGYIKDYEGGTLMQCSMLPRI  160 (164)
T ss_dssp             ECTTCCCTTHHHHHHHHHHHHHHHHSCCCEEEEEECGGGHHHHHHTTCBSSCCSCHHHHBTTBCCTTCCEEEEEECCCCC
T ss_pred             ECHHHcCCCHHHHHHHHHHHHHHhcCCceEEEEecCChHHHHHHHcCCEecceeccceEEEEEEEecCeEEEEeeccccC
Confidence            99999999999999999999998646888666777778999999999998888888889999999999999999999999


Q ss_pred             CCcC
Q 012402          367 PYTD  370 (464)
Q Consensus       367 ~Y~~  370 (464)
                      +|++
T Consensus       161 ~~~~  164 (164)
T 1ygh_A          161 RYLD  164 (164)
T ss_dssp             CCCC
T ss_pred             cCCC
Confidence            9985
>1qst_A TGCN5 histone acetyl transferase; GCN5-related N-acetyltransferase, COA binding protein; HET: EPE; 1.70A {Tetrahymena thermophila} SCOP: d.108.1.1 PDB: 1m1d_A* 1pu9_A* 1pua_A* 5gcn_A* 1qsr_A* 1q2d_A* 1q2c_A* 1qsn_A* Back     alignment and structure
>1z4r_A General control of amino acid synthesis protein 5-like 2; GCN5, acetyltransferase, SGC, structural genomics, structural genomics consortium; HET: ACO; 1.74A {Homo sapiens} SCOP: d.108.1.1 PDB: 1cm0_B* Back     alignment and structure
>1n71_A AAC(6')-II; aminoglycoside 6'-N-acetyltransferase, antibiotic resistance, coenzyme A; HET: COA; 1.80A {Enterococcus faecium} SCOP: d.108.1.1 PDB: 2a4n_A* 1b87_A* Back     alignment and structure
>3lod_A Putative acyl-COA N-acyltransferase; structural genomics, PSI2, MCSG, structure initiative; 2.50A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2x7b_A N-acetyltransferase SSO0209; HET: COA; 1.95A {Sulfolobus solfataricus} Back     alignment and structure
>1tiq_A Protease synthase and sporulation negative regulatory protein PAI 1; alpha-beta protein, structural genomics, PSI; HET: COA; 1.90A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>2q0y_A GCN5-related N-acetyltransferase; YP_295895.1, acetyltransferase (GNAT) family, structural genomics, joint center for ST genomics; HET: MSE; 1.80A {Ralstonia eutropha JMP134} Back     alignment and structure
>1cjw_A Protein (serotonin N-acetyltransferase); HET: COT; 1.80A {Ovis aries} SCOP: d.108.1.1 PDB: 1b6b_A Back     alignment and structure
>4e0a_A BH1408 protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG, transferase; 1.80A {Bacillus halodurans} PDB: 4f6a_A* Back     alignment and structure
>3ey5_A Acetyltransferase-like, GNAT family; structural genomics, APC60148, GNAT famil protein structure initiative; 2.15A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ghe_A Acetyltransferase; acyl coenzyme A complex; HET: ACO; 1.55A {Pseudomonas syringae PV} SCOP: d.108.1.1 PDB: 1j4j_A* Back     alignment and structure
>2ob0_A Human MAK3 homolog; acetyltransferase, structural genomics consortium, SGC; HET: ACO; 1.80A {Homo sapiens} PDB: 2psw_A* 3tfy_A* Back     alignment and structure
>2dxq_A AGR_C_4057P, acetyltransferase; structural genomics, PSI-2, protein struc initiative, midwest center for structural genomics, MCSG; 1.80A {Agrobacterium tumefaciens str} Back     alignment and structure
>3mgd_A Predicted acetyltransferase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; HET: ACO; 1.90A {Clostridium acetobutylicum} Back     alignment and structure
>1bo4_A Protein (serratia marcescens aminoglycoside-3-N- acetyltransferase); eubacterial aminoglyco resistance, GCN5-related N-acetyltransferase; HET: SPD COA; 2.30A {Serratia marcescens} SCOP: d.108.1.1 Back     alignment and structure
>2pdo_A Acetyltransferase YPEA; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: MSE; 2.00A {Shigella flexneri 2A} Back     alignment and structure
>4evy_A Aminoglycoside N(6')-acetyltransferase type 1; center for structural genomics of infectious diseases (csgid national institute of allergy and infectious diseases; HET: TOY; 1.77A {Acinetobacter haemolyticus} PDB: 4f0y_A 4e8o_A Back     alignment and structure
>2eui_A Probable acetyltransferase; dimer, structural genomics, PSI, protein structure initiative; 2.80A {Pseudomonas aeruginosa PAO1} SCOP: d.108.1.1 Back     alignment and structure
>3kkw_A Putative uncharacterized protein; acetyltransferase, GNAT family, structural genomics, PSI, protein structure initiative; 1.41A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>1z4e_A Transcriptional regulator; nysgxrc target T2017, GNAT fold, structural genomics, PSI, P structure initiative; 2.00A {Bacillus halodurans} SCOP: d.108.1.1 Back     alignment and structure
>4h89_A GCN5-related N-acetyltransferase; N-acyltransferase superfamily, structural genomics, PSI-BIOL midwest center for structural genomics, MCSG; 1.37A {Kribbella flavida} Back     alignment and structure
>2i6c_A Putative acetyltransferase; GNAT family, structural genomic, structur genomics, PSI-2, protein structure initiative; HET: MSE EPE; 1.30A {Pseudomonas aeruginosa} SCOP: d.108.1.1 PDB: 3pgp_A* Back     alignment and structure
>3efa_A Putative acetyltransferase; structural genom 2, protein structure initiative, midwest center for structu genomics, MCSG; 2.42A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>2fia_A Acetyltransferase; structural genomics, PSI, protein structu initiative, midwest center for structural genomics, MCSG; 2.60A {Enterococcus faecalis} SCOP: d.108.1.1 Back     alignment and structure
>2ree_A CURA; GNAT, S-acetyltransferase, decarboxylase, polyketid synthase, loading, phosphopantetheine, transferase, lyase; HET: SO4; 1.95A {Lyngbya majuscula} PDB: 2ref_A* Back     alignment and structure
>3g8w_A Lactococcal prophage PS3 protein 05; APC61042, acetyltransferase, staphylococcus epidermidis ATCC structural genomics; HET: NHE FLC; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>1kux_A Aralkylamine, serotonin N-acetyltransferase; enzyme-inhibitor complex, bisubstrate analog, alternate conformations; HET: CA3; 1.80A {Ovis aries} SCOP: d.108.1.1 PDB: 1kuv_A* 1kuy_A* 1l0c_A* 1ib1_E* Back     alignment and structure
>1s3z_A Aminoglycoside 6'-N-acetyltransferase; GNAT, aminoglycoside ribostamycin; HET: COA RIO; 2.00A {Salmonella enteritidis} SCOP: d.108.1.1 PDB: 1s5k_A* 1s60_A* 2vbq_A* Back     alignment and structure
>2g3a_A Acetyltransferase; structural genomics, PSI, protein structu initiative, midwest center for structural genomics, MCSG; 1.90A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 Back     alignment and structure
>2jdc_A Glyphosate N-acetyltransferase; GNAT; HET: CAO; 1.6A {Bacillus licheniformis} SCOP: d.108.1.1 PDB: 2bsw_A* 2jdd_A* Back     alignment and structure
>2r7h_A Putative D-alanine N-acetyltransferase of GNAT FA; putative acetyltransferase of the GNAT family; 1.85A {Desulfovibrio desulfuricans subsp} Back     alignment and structure
>3gy9_A GCN5-related N-acetyltransferase; YP_001815201.1, putative acetyltransferase; HET: MSE COA SO4; 1.52A {Exiguobacterium sibiricum 255-15} PDB: 3gya_A* Back     alignment and structure
>2ae6_A Acetyltransferase, GNAT family; GCN5-related N-acetyltransferase (GNAT), alpha-beta, structu genomics, PSI, protein structure initiative; HET: GOL; 2.19A {Enterococcus faecalis} SCOP: d.108.1.1 Back     alignment and structure
>2i79_A Acetyltransferase, GNAT family; acetyl coenzyme *A, structur genomics, PSI-2, protein structure initiative; HET: ACO; 2.10A {Streptococcus pneumoniae} Back     alignment and structure
>3e0k_A Amino-acid acetyltransferase; N-acetylglutamate synthase, structu genomics, PSI-2, protein structure initiative; HET: MSE; 2.52A {Vibrio parahaemolyticus} Back     alignment and structure
>3fix_A N-acetyltransferase; termoplasma acidophilum, structural GEN PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 2.30A {Thermoplasma acidophilum} PDB: 3f0a_A* 3k9u_A* 3ne7_A* Back     alignment and structure
>2ge3_A Probable acetyltransferase; structural GEN PSI, protein structure initiative, midwest center for struc genomics, MCSG; HET: ACO; 2.25A {Agrobacterium tumefaciens} SCOP: d.108.1.1 Back     alignment and structure
>3dr6_A YNCA; acetyltransferase, csgid target, essential gene, IDP00086, structural genomics, center for STRU genomics of infectious diseases; HET: MSE; 1.75A {Salmonella typhimurium} SCOP: d.108.1.1 PDB: 3dr8_A* Back     alignment and structure
>2cy2_A TTHA1209, probable acetyltransferase; structural genomics, unknown function, NPPSFA; HET: ACO; 2.00A {Thermus thermophilus} SCOP: d.108.1.1 PDB: 1wk4_A* Back     alignment and structure
>3i9s_A Integron cassette protein; oyster POND, woods HOLE, acetyltransferase, structural genomics, PSI-2, protein structure initiative; 2.20A {Vibrio cholerae} Back     alignment and structure
>3bln_A Acetyltransferase GNAT family; NP_981174.1, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE MRD GOL; 1.31A {Bacillus cereus} Back     alignment and structure
>3t9y_A Acetyltransferase, GNAT family; PSI-biology, structural genomics, midwest center for structu genomics, MCSG; HET: PGE; 2.00A {Staphylococcus aureus} Back     alignment and structure
>3owc_A Probable acetyltransferase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; HET: COA; 1.90A {Pseudomonas aeruginosa} Back     alignment and structure
>3d8p_A Acetyltransferase of GNAT family; NP_373092.1, structural GE joint center for structural genomics, JCSG, protein structu initiative; 2.20A {Staphylococcus aureus subsp} Back     alignment and structure
>2fl4_A Spermine/spermidine acetyltransferase; structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 1.60A {Enterococcus faecalis} SCOP: d.108.1.1 Back     alignment and structure
>2atr_A Acetyltransferase, GNAT family; MCSG, structural genomics, PSI, protein structure INIT midwest center for structural genomics; 2.01A {Streptococcus pneumoniae} SCOP: d.108.1.1 Back     alignment and structure
>1qsm_A HPA2 histone acetyltransferase; protein-acetyl coenzyme A complex; HET: ACO; 2.40A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 1qso_A Back     alignment and structure
>3fnc_A Protein LIN0611, putative acetyltransferase; GNAT, RIMI, structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.75A {Listeria innocua} SCOP: d.108.1.0 Back     alignment and structure
>3jvn_A Acetyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.61A {Vibrio fischeri} Back     alignment and structure
>2bei_A Diamine acetyltransferase 2; SSAT2, BC011751, AAH11751, thialysine N-acetyltransferase, structural genomics, protein structure initiative, PSI; HET: ACO; 1.84A {Homo sapiens} SCOP: d.108.1.1 PDB: 2q4v_A* Back     alignment and structure
>3dsb_A Putative acetyltransferase; APC60368.2, ST genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; HET: MSE; 1.48A {Clostridium difficile} Back     alignment and structure
>1wwz_A Hypothetical protein PH1933; structural genomics, pyrococcus horikoshii OT3, riken struct genomics/proteomics initiative, RSGI; HET: ACO; 1.75A {Pyrococcus horikoshii} SCOP: d.108.1.1 Back     alignment and structure
>2fe7_A Probable N-acetyltransferase; structural genomics, pseudomonas aerugi PSI, protein structure initiative; 2.00A {Pseudomonas aeruginosa ucbpp-pa14} SCOP: d.108.1.1 Back     alignment and structure
>3pp9_A Putative streptothricin acetyltransferase; toxin production resistance, infectious diseases, structural genomics; HET: MSE ACO; 1.60A {Bacillus anthracis} Back     alignment and structure
>1mk4_A Hypothetical protein YQJY; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>2oh1_A Acetyltransferase, GNAT family; YP_013287.1, structural genom joint center for structural genomics, JCSG, protein structu initiative; HET: MSE UNL; 1.46A {Listeria monocytogenes str} Back     alignment and structure
>2q7b_A Acetyltransferase, GNAT family; NP_689019.1, structural GEN joint center for structural genomics, JCSG; HET: MSE FLC; 2.00A {Streptococcus agalactiae 2603V} Back     alignment and structure
>1q2y_A Protein YJCF, similar to hypothetical proteins; GCN5-related N-acetyltransferase superfamily fold, NYSGXRC, PSI, protein structure initiative; 2.00A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>2cnt_A Modification of 30S ribosomal subunit protein S18; N-alpha acetylation, GCN5-N-acetyltransferase, ribosomal Pro acetyltransferase, GNAT; HET: COA; 2.4A {Salmonella typhimurium} PDB: 2cnm_A* 2cns_A* Back     alignment and structure
>1u6m_A Acetyltransferase, GNAT family; structural genomics, PSI, protein structure initiative; 2.40A {Enterococcus faecalis} SCOP: d.108.1.1 Back     alignment and structure
>3exn_A Probable acetyltransferase; GCN5-related N-acetyltransferase, MCSG, P structural genomics, protein structure initiative; HET: ACO; 1.80A {Thermus thermophilus} Back     alignment and structure
>1y9k_A IAA acetyltransferase; structural genomics, midwest center for structural genomics bacillus cereus ATCC 14579, PSI; 2.39A {Bacillus cereus atcc 14579} SCOP: d.108.1.1 Back     alignment and structure
>1xeb_A Hypothetical protein PA0115; midwest center for structural genomics, MCSG, structural GEN protein structure initiative, PSI, APC22065; 2.35A {Pseudomonas aeruginosa} SCOP: d.108.1.1 Back     alignment and structure
>1vkc_A Putative acetyl transferase; structural genomics, pyrococcus furiosus southeast collaboratory for structural genomics, secsg; 1.89A {Pyrococcus furiosus} SCOP: d.108.1.1 Back     alignment and structure
>2fiw_A GCN5-related N-acetyltransferase:aminotransferase II; alpha-beta-alpha sandwich, GCN4-related acetyltransferase, S genomics, PSI; HET: ACO; 2.35A {Rhodopseudomonas palustris} SCOP: d.108.1.1 Back     alignment and structure
>4ag7_A Glucosamine-6-phosphate N-acetyltransferase; HET: COA; 1.55A {Caenorhabditis elegans} PDB: 4ag9_A* Back     alignment and structure
>3fyn_A Integron gene cassette protein HFX_CASS3; integron cassette protein, mobIle metagenome, structural genomics, PSI-2; 1.45A {Uncultured bacterium} Back     alignment and structure
>1vhs_A Similar to phosphinothricin acetyltransferase; structural genomics, unknown function; 1.80A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>3i3g_A N-acetyltransferase; malaria, structural genomics, structural genomics consortium, SGC,; 1.86A {Trypanosoma brucei} PDB: 3fb3_A Back     alignment and structure
>1y9w_A Acetyltransferase; structural genomics, Pro structure initiative, PSI, midwest center for structural GE MCSG; 1.90A {Bacillus cereus} SCOP: d.108.1.1 Back     alignment and structure
>3igr_A Ribosomal-protein-S5-alanine N-acetyltransferase; fisch MCSG, structural genomics, midwest center for structural GE protein structure initiative; HET: MSE; 2.00A {Vibrio fischeri} SCOP: d.108.1.0 Back     alignment and structure
>2bue_A AAC(6')-IB; GNAT, transferase, aminoglycoside, fluoroquinolone, acetyltransferase, antibiotic resistance; HET: COA RIO; 1.7A {Escherichia coli} PDB: 1v0c_A* 2vqy_A* 2prb_A* 2qir_A* 2pr8_A* Back     alignment and structure
>4fd4_A Arylalkylamine N-acetyltransferase like 5B; GNAT; 1.95A {Aedes aegypti} Back     alignment and structure
>3t90_A Glucose-6-phosphate acetyltransferase 1; GNAT fold, glcnac biosynthesis, alpha/beta protein; HET: EPE; 1.50A {Arabidopsis thaliana} Back     alignment and structure
>1y7r_A Hypothetical protein SA2161; structural genomics, protein structure initiative, PSI, midwest center for structural genomics; 1.70A {Staphylococcus aureus} SCOP: d.108.1.1 Back     alignment and structure
>2j8m_A Acetyltransferase PA4866 from P. aeruginosa; GCN5 family, phosphinothricin, methionine sulfone, methionine sulfoximine; 1.44A {Pseudomonas aeruginosa} PDB: 2bl1_A 2j8n_A 2j8r_A* 1yvo_A Back     alignment and structure
>2ozh_A Hypothetical protein XCC2953; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.40A {Xanthomonas campestris PV} Back     alignment and structure
>3ld2_A SMU.2055, putative acetyltransferase; HET: COA; 2.50A {Streptococcus mutans} Back     alignment and structure
>1s7k_A Acetyl transferase; GNAT; 1.80A {Salmonella typhimurium} SCOP: d.108.1.1 PDB: 1s7l_A* 1s7n_A* 1s7f_A 1z9u_A Back     alignment and structure
>3r9f_A MCCE protein; microcin C7, acetyltransferase, SELF immunity, resistance, A coenzyme A, transferase; HET: COA GSU; 1.20A {Escherichia coli} PDB: 3r95_A* 3r96_A* 3r9e_A* 3r9g_A* Back     alignment and structure
>2vi7_A Acetyltransferase PA1377; GNAT, GCN5 family, N-acetyltransferase, hypothetical protein; 2.25A {Pseudomonas aeruginosa} Back     alignment and structure
>1yre_A Hypothetical protein PA3270; APC5563, midwest center for structural genomics, MSC protein structure initiative, PSI, MCSG; HET: COA; 2.15A {Pseudomonas aeruginosa} SCOP: d.108.1.1 Back     alignment and structure
>2pc1_A Acetyltransferase, GNAT family; NP_688560.1, structural genom joint center for structural genomics, JCSG; HET: MSE; 1.28A {Streptococcus agalactiae 2603V} Back     alignment and structure
>1yx0_A Hypothetical protein YSNE; NESG, GFT structral genomics, SR220, structural genomics, PSI, protein structure initiative; NMR {Bacillus subtilis subsp} SCOP: d.108.1.1 Back     alignment and structure
>2r1i_A GCN5-related N-acetyltransferase; YP_831484.1, putative acetyltransferase, arthrobacter SP. FB acetyltransferase (GNAT) family; HET: MSE; 1.65A {Arthrobacter SP} Back     alignment and structure
>1yvk_A Hypothetical protein BSU33890; ALPHS-beta protein, structural genomics, PSI, protein structure initiative; HET: COA; 3.01A {Bacillus subtilis subsp} SCOP: d.108.1.1 Back     alignment and structure
>2aj6_A Hypothetical protein MW0638; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL; 1.63A {Staphylococcus aureus subsp} SCOP: d.108.1.1 Back     alignment and structure
>1nsl_A Probable acetyltransferase; structural genomics, hexamer, alpha-beta, PSI, protein struc initiative, midwest center for structural genomics; 2.70A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>3tth_A Spermidine N1-acetyltransferase; central intermediary metabolism; 3.30A {Coxiella burnetii} Back     alignment and structure
>3f5b_A Aminoglycoside N(6')acetyltransferase; APC60744, legionella pneumophila subsp. pneumophila, structural genomics, PSI-2; HET: MSE; 2.00A {Legionella pneumophila subsp} Back     alignment and structure
>3eo4_A Uncharacterized protein MJ1062; APC60792.2,MJ_1062,methanocaldococcus jannaschii DSM 2661, S genomics, PSI-2; HET: MES PG6; 2.19A {Methanocaldococcus jannaschii} Back     alignment and structure
>1ufh_A YYCN protein; alpha and beta, fold, acetyltransferase, structural genomics, PSI, protein structure initiative; 2.20A {Bacillus subtilis subsp} SCOP: d.108.1.1 Back     alignment and structure
>3pzj_A Probable acetyltransferases; MCSG, PSI-2, structural genomics, protein structure initiati midwest center for structural genomics; HET: MSE; 1.85A {Chromobacterium violaceum} Back     alignment and structure
>2o28_A Glucosamine 6-phosphate N-acetyltransferase; structural genomics, structural genomics consortium, SGC; HET: 16G COA; 1.80A {Homo sapiens} PDB: 2huz_A* 3cxq_A* 3cxs_A 3cxp_A Back     alignment and structure
>2jlm_A Putative phosphinothricin N-acetyltransferase; methionine sulfoximine; 2.35A {Acinetobacter baylyi} Back     alignment and structure
>3fbu_A Acetyltransferase, GNAT family; structur genomics, PSI2, MCSG, protein structure initiative, midwest for structural genomics; HET: COA; 1.80A {Bacillus anthracis str} Back     alignment and structure
>1m4i_A Aminoglycoside 2'-N-acetyltransferase; COA binding motif; HET: COA KAN PAP; 1.50A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1m4d_A* 1m4g_A* 1m44_A* Back     alignment and structure
>3eg7_A Spermidine N1-acetyltransferase; structural genomics, IDP016 transferase, center for structural genomics of infectious D csgid; HET: MSE; 2.38A {Vibrio cholerae} SCOP: d.108.1.0 Back     alignment and structure
>3f8k_A Protein acetyltransferase; GCN5-related N-acetyltransferase; HET: COA; 1.84A {Sulfolobus solfataricus P2} Back     alignment and structure
>2gan_A 182AA long hypothetical protein; alpha-beta protein., structural genomics, PSI, protein struc initiative; 2.10A {Pyrococcus horikoshii} SCOP: d.108.1.1 Back     alignment and structure
>2qec_A Histone acetyltransferase HPA2 and related acetyltransferases; NP_600742.1, acetyltransferase (GNAT) family; 1.90A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2z10_A Ribosomal-protein-alanine acetyltransferase; alpha/beta protein, acyltransferase, structural genomics, NPPSFA; HET: IYR; 1.77A {Thermus thermophilus} PDB: 2z0z_A* 2z11_A* 2zxv_A* Back     alignment and structure
>3frm_A Uncharacterized conserved protein; APC61048, staphylococcus epidermidis ATCC structural genomics, PSI-2, protein structure initiative; HET: MES; 2.32A {Staphylococcus epidermidis} Back     alignment and structure
>3qb8_A A654L protein; GNAT N-acetyltransferase, acetyltransferase, COA, spermine, spermidine, transferase; HET: COA; 1.50A {Paramecium bursaria chlorella virus 1} Back     alignment and structure
>2vez_A Putative glucosamine 6-phosphate acetyltransferase; acyltransferase; HET: ACO G6P; 1.45A {Aspergillus fumigatus} PDB: 2vxk_A* Back     alignment and structure
>1on0_A YYCN protein; structural genomics, alpha-beta protein with anti-parallel B strands, PSI, protein structure initiative; 2.20A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>1yr0_A AGR_C_1654P, phosphinothricin acetyltransferase; structural genomics, protein structure initiative, NYSGXRC, PSI; 2.00A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 Back     alignment and structure
>1i12_A Glucosamine-phosphate N-acetyltransferase; GNAT, alpha/beta; HET: ACO; 1.30A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 1i1d_A* 1i21_A Back     alignment and structure
>3d3s_A L-2,4-diaminobutyric acid acetyltransferase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: MSE; 1.87A {Bordetella parapertussis 12822} Back     alignment and structure
>2b5g_A Diamine acetyltransferase 1; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: ALY; 1.70A {Homo sapiens} SCOP: d.108.1.1 PDB: 2b4d_A* 2jev_A* 2g3t_A 2f5i_A 2b3u_A 2b3v_A* 2b4b_A* 2b58_A* 2fxf_A* 3bj7_A* 3bj8_A* Back     alignment and structure
>2q04_A Acetoin utilization protein; ZP_00540088.1, structural genom joint center for structural genomics, JCSG, protein structu initiative; HET: MSE; 2.33A {Exiguobacterium sibiricum} Back     alignment and structure
>2wpx_A ORF14; transferase, acetyl transferase, antibiotic biosynthesis; HET: ACO; 2.31A {Streptomyces clavuligerus} PDB: 2wpw_A* Back     alignment and structure
>2k5t_A Uncharacterized protein YHHK; N-acetyl transferase, COA, bound ligand, coenzyme A, structural genomics, PSI-2, protein structure initiative; HET: COA; NMR {Escherichia coli K12} Back     alignment and structure
>3s6f_A Hypothetical acetyltransferase; acyl-COA N-acyltransferases, structural genomics, joint CENT structural genomics, JCSG; HET: MSE COA; 1.19A {Deinococcus radiodurans} Back     alignment and structure
>2fck_A Ribosomal-protein-serine acetyltransferase, putat; ribosomal-protein structural genomics, PSI, protein structure initiative; HET: MSE; 1.70A {Vibrio cholerae o1 biovar eltor} SCOP: d.108.1.1 Back     alignment and structure
>4fd5_A Arylalkylamine N-acetyltransferase 2; GNAT; 1.64A {Aedes aegypti} PDB: 4fd6_A Back     alignment and structure
>2g0b_A FEEM; N-acyl transferase, environmental DNA, protein-product compl antibiotic synthase, transferase; HET: NLT; 3.00A {Uncultured bacterium} Back     alignment and structure
>3h4q_A Putative acetyltransferase; NP_371943.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE P33; 2.50A {Staphylococcus aureus subsp} Back     alignment and structure
>2kcw_A Uncharacterized acetyltransferase YJAB; GNAT fold, acyltransferase; NMR {Escherichia coli} Back     alignment and structure
>3ddd_A Putative acetyltransferase; NP_142035.1, structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: COA; 2.25A {Pyrococcus horikoshii} Back     alignment and structure
>2qml_A BH2621 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, unknown function; HET: MSE; 1.55A {Bacillus halodurans} Back     alignment and structure
>3ec4_A Putative acetyltransferase from the GNAT family; YP_497011.1, joint center for structural genomics; 1.80A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} Back     alignment and structure
>3te4_A GH12636P, dopamine N acetyltransferase, isoform A; dopamine/acetyl COA, N-acetyltransferase domain; HET: ACO; 1.46A {Drosophila melanogaster} PDB: 3v8i_A* Back     alignment and structure
>2fsr_A Acetyltransferase; alpha-beta-sandwich, structural genomics, PSI, protein struc initiative, midwest center for structural genomics; HET: PEG; 1.52A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 Back     alignment and structure
>3tcv_A GCN5-related N-acetyltransferase; GRAM negative coccobacillus, brucellosis, acyl CO-A, arylami transferase; 1.75A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} Back     alignment and structure
>1yk3_A Hypothetical protein RV1347C/MT1389; acyltransferase, GCN5-related fold, structural genomics, PSI, protein structure initiative; HET: BOG; 2.20A {Mycobacterium tuberculosis} SCOP: d.108.1.1 Back     alignment and structure
>3juw_A Probable GNAT-family acetyltransferase; structural genomics, APC60242, acetyltransferas protein structure initiative; HET: MSE; 2.11A {Bordetella pertussis} Back     alignment and structure
>2zpa_A Uncharacterized protein YPFI; RNA modification enzyme, RNA helicase, acetyltransferase, GCN5 acetyltransferase; HET: ACO ADP; 2.35A {Escherichia coli K12} Back     alignment and structure
>3d2m_A Putative acetylglutamate synthase; protein-COA-Glu ternary complex, transferase; HET: COA GLU; 2.21A {Neisseria gonorrhoeae} PDB: 2r8v_A* 3b8g_A* 2r98_A* 3d2p_A* Back     alignment and structure
>4ava_A Lysine acetyltransferase; allosteric regulation, domain coupling; HET: ACO; 1.70A {Mycobacterium tuberculosis} PDB: 4avb_A* 4avc_A* Back     alignment and structure
>4fd7_A Putative arylalkylamine N-acetyltransferase 7; GNAT, COA binding; 1.80A {Aedes aegypti} Back     alignment and structure
>3iwg_A Acetyltransferase, GNAT family; structural genomics, APC, PSI-2, protein structure initiativ midwest center for structural genomics; HET: MSE; 2.30A {Colwellia psychrerythraea} Back     alignment and structure
>2vzy_A RV0802C; transferase, GCN5-related N-acetyltransferase, succinyltransferase; HET: FLC; 2.00A {Mycobacterium tuberculosis} PDB: 2vzz_A* Back     alignment and structure
>1r57_A Conserved hypothetical protein; GCN5, N-acetyltransferase, structural genomics, PSI, protein structure initiative; NMR {Staphylococcus aureus} SCOP: d.108.1.1 PDB: 2h5m_A* Back     alignment and structure
>2pr1_A Uncharacterized N-acetyltransferase YLBP; YIBP protein, coenzyme A, structural GE PSI-2, protein structure initiative; HET: SUC COA; 3.20A {Bacillus subtilis} Back     alignment and structure
>2wpx_A ORF14; transferase, acetyl transferase, antibiotic biosynthesis; HET: ACO; 2.31A {Streptomyces clavuligerus} PDB: 2wpw_A* Back     alignment and structure
>3tt2_A GCN5-related N-acetyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta sandwich; HET: MES; 2.73A {Sphaerobacter thermophilus} Back     alignment and structure
>2ozg_A GCN5-related N-acetyltransferase; YP_325469.1, acetyltransfe (GNAT) family, structural genomics, joint center for struct genomics, JCSG; HET: COA; 2.00A {Anabaena variabilis} SCOP: d.106.1.4 d.108.1.10 Back     alignment and structure
>3c26_A Putative acetyltransferase TA0821; NP_394282.1, A putative acetyltransferase, acetyltransferase family, structural genomics; 2.00A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure
>3g3s_A GCN5-related N-acetyltransferase; ZP_00874857.1, acetyltransferase (GNAT) family, structural joint center for structural genomics, JCSG; HET: MSE; 1.80A {Streptococcus suis} Back     alignment and structure
>3r1k_A Enhanced intracellular surviVal protein; GNAT, acetyltransferase, transferase; HET: COA; 1.95A {Mycobacterium tuberculosis} PDB: 3sxo_A 3ryo_A 3uy5_A Back     alignment and structure
>2hv2_A Hypothetical protein; PSI, protein structure initiative, midwest center for struct genomics, MCSG, structural genomics, unknown function; HET: EPE PG4; 2.40A {Enterococcus faecalis} SCOP: d.106.1.4 d.108.1.10 Back     alignment and structure
>2i00_A Acetyltransferase, GNAT family; structural genomics, PSI-2, structure initiative, midwest center for structural genomic transferase; 2.30A {Enterococcus faecalis} SCOP: d.106.1.4 d.108.1.10 Back     alignment and structure
>3n7z_A Acetyltransferase, GNAT family; PSI2, MCSG, structural genomics, protein structure initiativ midwest center for structural genomics; 2.75A {Bacillus anthracis} Back     alignment and structure
>2zw5_A Bleomycin acetyltransferase; dimer, two domains; HET: COA; 2.40A {Streptomyces verticillus} PDB: 2zw4_A* 2zw6_A 2zw7_A* Back     alignment and structure
>1p0h_A Hypothetical protein RV0819; GNAT fold, acetyltransferase, coenzyme A complex, MSHD, TRAN; HET: COA ACO; 1.60A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1ozp_A* 2c27_A* Back     alignment and structure
>3sxn_A Enhanced intracellular surviVal protein; GNAT fold, acetyltransferase, acetyl COA binding, transferas; HET: COA; 2.03A {Mycobacterium smegmatis} Back     alignment and structure
>3tt2_A GCN5-related N-acetyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta sandwich; HET: MES; 2.73A {Sphaerobacter thermophilus} Back     alignment and structure
>1sqh_A Hypothetical protein CG14615-PA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Drosophila melanogaster} SCOP: d.108.1.5 Back     alignment and structure
>2d4p_A Hypothetical protein TTHA1254; structural genomics, NPPSFA, national project on protein STR and functional analyses; 1.70A {Thermus thermophilus} SCOP: d.108.1.1 PDB: 2d4o_A Back     alignment and structure
>2ft0_A TDP-fucosamine acetyltransferase; GNAT fold acetyltransferase, structural genomics, montreal-K bacterial structural genomics initiative, BSGI; HET: ACO; 1.66A {Escherichia coli} PDB: 2fs5_A* Back     alignment and structure
>1ro5_A Autoinducer synthesis protein LASI; alpha-beta-alpha sandwich, phosphopantetheine fold, signalin; 2.30A {Pseudomonas aeruginosa} SCOP: d.108.1.3 Back     alignment and structure
>1p0h_A Hypothetical protein RV0819; GNAT fold, acetyltransferase, coenzyme A complex, MSHD, TRAN; HET: COA ACO; 1.60A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1ozp_A* 2c27_A* Back     alignment and structure
>1xmt_A Putative acetyltransferase; structural genomics, protein structure initiative, CESG, AT1G77540, center for eukaryotic structural genomics; 1.15A {Arabidopsis thaliana} SCOP: d.108.1.1 PDB: 2q44_A 2evn_A 2il4_A* 2q4y_A* Back     alignment and structure
>3p2h_A AHL synthase; acyl-ACP binding, SAM binding, signaling protein-I MTA complex, signaling protein-inhibitor complex; HET: MTA NOO; 2.00A {Burkholderia glumae} PDB: 3p2f_A* Back     alignment and structure
>1kzf_A Acyl-homoserinelactone synthase ESAI; alpha-beta, autoinducer synthase, quorum sensing, bacterial pathogenesis, ligase; 1.80A {Pantoea stewartii subsp} SCOP: d.108.1.3 PDB: 1k4j_A Back     alignment and structure
>3shp_A Putative acetyltransferase STHE_0691; PSI-biology, midwest center for structural genomics, MCSG; HET: SRT; 2.21A {Sphaerobacter thermophilus} Back     alignment and structure
>3dns_A Ribosomal-protein-alanine acetyltransferase; N-terminal domain of ribosomal-protein-alanine acetyltransfe MCSG, PSI; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>1bob_A HAT1, histone acetyltransferase; histone modification, acetyl coenzyme A binding-protein; HET: ACO; 2.30A {Saccharomyces cerevisiae} SCOP: d.108.1.1 Back     alignment and structure
>1yle_A Arginine N-succinyltransferase, alpha chain; structural genomics, acyltransferase, arginine metabolism, protein structure initiative; 1.70A {Pseudomonas aeruginosa} SCOP: d.108.1.8 Back     alignment and structure
>3s6g_A N-acetylglutamate kinase / N-acetylglutamate SYNT; synthase, transferase; HET: COA; 2.67A {Maricaulis maris} PDB: 3s7y_A 3s6h_A* Back     alignment and structure
>4b14_A Glycylpeptide N-tetradecanoyltransferase; malaria, drug design; HET: NHW 4XB; 1.50A {Plasmodium vivax} PDB: 4b11_A* 4b12_A* 4b13_A* 4b10_A* 4a95_A* Back     alignment and structure
>3gkr_A FEMX; FEMX, peptidoglycan, hexapeptide, transferase, transferase- transferase product complex; HET: UMA; 1.60A {Lactobacillus viridescens} PDB: 1ne9_A 1p4n_A* 1xix_A 1xf8_A 1xe4_A Back     alignment and structure
>2p0w_A Histone acetyltransferase type B catalytic subuni; HAT1, structural genomics, structural genomics consortium, S transferase; HET: ACO; 1.90A {Homo sapiens} Back     alignment and structure
>3iu1_A Glycylpeptide N-tetradecanoyltransferase 1; N-myristoyltransferase, NMT1, acyltransferase, phosphoprotein, structural genomics; HET: MYA; 1.42A {Homo sapiens} PDB: 3iu2_A* 3iwe_A* 3jtk_A* Back     alignment and structure
>2wuu_A N-myristoyltransferase; acyltransferase; HET: NHM; 1.42A {Leishmania donovani} PDB: 3h5z_A* 4a2z_A* 4a30_A* 4a31_A* 4a32_A* 4a33_A* 2wsa_A* Back     alignment and structure
>3ddd_A Putative acetyltransferase; NP_142035.1, structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: COA; 2.25A {Pyrococcus horikoshii} Back     alignment and structure
>4b5o_A Alpha-tubulin N-acetyltransferase; microtubules, cilium, intraflagellar transport; HET: ACO; 1.05A {Homo sapiens} PDB: 4b5p_A* Back     alignment and structure
>1iic_A Peptide N-myristoyltransferase; HET: MYA; 2.20A {Saccharomyces cerevisiae} SCOP: d.108.1.2 d.108.1.2 PDB: 1iid_A* 2nmt_A* 2p6e_A* 2p6f_A* 2p6g_A* Back     alignment and structure
>1iyk_A Myristoyl-COA:protein N-myristoyltransferase; HET: MYA MIM; 2.30A {Candida albicans} SCOP: d.108.1.2 d.108.1.2 PDB: 1iyl_A* 1nmt_A Back     alignment and structure
>4hkf_A Alpha-tubulin N-acetyltransferase; tubulin acetyltransferase, MEC-17, GNAT, acetyl-COA, GNAT FO transferase; HET: ACO; 1.70A {Danio rerio} PDB: 4h6u_A* 4h6z_A* Back     alignment and structure
>1rxt_A Myristoyl-, glycylpeptide N-tetradecanoyltransferase 1; alpha-beta structure, unique N-myristoyltransferase fold; 3.00A {Homo sapiens} SCOP: d.108.1.2 d.108.1.2 Back     alignment and structure
>4h6u_A Alpha-tubulin N-acetyltransferase; tubulin acetyltransferase; HET: ACO; 2.45A {Danio rerio} PDB: 4h6z_A* Back     alignment and structure
>4gs4_A Alpha-tubulin N-acetyltransferase; acetyl coenzyme A binding, cytosolic; HET: ACO; 2.11A {Homo sapiens} Back     alignment and structure
>3s6k_A Acetylglutamate kinase; synthase, transferase; 2.80A {Xanthomonas campestris PV} Back     alignment and structure
>3iwg_A Acetyltransferase, GNAT family; structural genomics, APC, PSI-2, protein structure initiativ midwest center for structural genomics; HET: MSE; 2.30A {Colwellia psychrerythraea} Back     alignment and structure
>2ozu_A Histone acetyltransferase MYST3; structural genomics, structural G consortium, SGC; HET: ALY ACO; 2.30A {Homo sapiens} SCOP: d.108.1.1 PDB: 2rc4_A* 1m36_A Back     alignment and structure
>3to7_A Histone acetyltransferase ESA1; MYST family; HET: ALY COA; 1.90A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 3to6_A* 1fy7_A* 1mja_A* 1mjb_A* 3to9_A* 1mj9_A* Back     alignment and structure
>2ou2_A Histone acetyltransferase htatip; structural genomics, structural genomics consortium, SGC; HET: ALY ACO; 2.30A {Homo sapiens} Back     alignment and structure
>2pq8_A Probable histone acetyltransferase MYST1; MOF, structural genomics, structural genomics consortium, SGC; HET: COA; 1.45A {Homo sapiens} PDB: 2giv_A* 3qah_A* 2y0m_A* 3toa_A* 3tob_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 464
d1ygha_164 d.108.1.1 (A:) Catalytic domain of GCN5 histone ac 4e-60
d1z4ra1162 d.108.1.1 (A:497-658) Catalytic domain of GCN5 his 9e-58
d1qsra_162 d.108.1.1 (A:) Catalytic domain of GCN5 histone ac 2e-56
d1n71a_180 d.108.1.1 (A:) Aminoglycoside 6'-N-acetyltransfera 5e-06
d1vkca_149 d.108.1.1 (A:) Putative acetyltransferase PF0028 { 1e-05
d1cjwa_166 d.108.1.1 (A:) Serotonin N-acetyltranferase {Sheep 4e-05
d1y7ra1133 d.108.1.1 (A:1-133) Hypothetical protein SA2161 {S 6e-05
d2gana1182 d.108.1.1 (A:1-182) Hypothetical protein PH0736 {P 1e-04
d2atra1137 d.108.1.1 (A:1-137) Probable acetyltransferase SP0 2e-04
d1sqha_297 d.108.1.5 (A:) Hypothetical protein cg14615-pa {Fr 2e-04
d1y9wa1140 d.108.1.1 (A:1-140) Probable acetyltransferase BC2 5e-04
>d1ygha_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 164 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Acyl-CoA N-acyltransferases (Nat)
superfamily: Acyl-CoA N-acyltransferases (Nat)
family: N-acetyl transferase, NAT
domain: Catalytic domain of GCN5 histone acetyltransferase
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

 Score =  192 bits (488), Expect = 4e-60
 Identities = 96/163 (58%), Positives = 122/163 (74%), Gaps = 1/163 (0%)

Query: 209 LKFVCLSNDGIDEHMVWLIGLKNIFARQLPNMPKEYIVRLVMDRSHKSVMVI-RGNVVVG 267
           ++F  ++ND   E+M+ L GLKNIF +QLP MPKEYI RLV DRSH S+ VI +   VVG
Sbjct: 2   IEFRVVNNDNTKENMMVLTGLKNIFQKQLPKMPKEYIARLVYDRSHLSMAVIRKPLTVVG 61

Query: 268 GITYRPYVSQKFGEIAFCAITADEQVKGYGTRLMNHLKQHARDVDGLTHFLTYADNNAVG 327
           GITYRP+  ++F EI FCAI++ EQV+GYG  LMNHLK + R+   + +FLTYADN A+G
Sbjct: 62  GITYRPFDKREFAEIVFCAISSTEQVRGYGAHLMNHLKDYVRNTSNIKYFLTYADNYAIG 121

Query: 328 YFIKQGFTKEIYLEKDRWQGYIKDYDGGILMECKIDPKLPYTD 370
           YF KQGFTKEI L+K  W GYIKDY+GG LM+C + P++ Y D
Sbjct: 122 YFKKQGFTKEITLDKSIWMGYIKDYEGGTLMQCSMLPRIRYLD 164
>d1z4ra1 d.108.1.1 (A:497-658) Catalytic domain of GCN5 histone acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1qsra_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Tetrahymena thermophila [TaxId: 5911]} Length = 162 Back     information, alignment and structure
>d1n71a_ d.108.1.1 (A:) Aminoglycoside 6'-N-acetyltransferase {Enterococcus faecium [TaxId: 1352]} Length = 180 Back     information, alignment and structure
>d1vkca_ d.108.1.1 (A:) Putative acetyltransferase PF0028 {Pyrococcus furiosus [TaxId: 2261]} Length = 149 Back     information, alignment and structure
>d1cjwa_ d.108.1.1 (A:) Serotonin N-acetyltranferase {Sheep (Ovis aries) [TaxId: 9940]} Length = 166 Back     information, alignment and structure
>d1y7ra1 d.108.1.1 (A:1-133) Hypothetical protein SA2161 {Staphylococcus aureus [TaxId: 1280]} Length = 133 Back     information, alignment and structure
>d2gana1 d.108.1.1 (A:1-182) Hypothetical protein PH0736 {Pyrococcus horikoshii [TaxId: 53953]} Length = 182 Back     information, alignment and structure
>d2atra1 d.108.1.1 (A:1-137) Probable acetyltransferase SP0256 {Streptococcus pneumoniae [TaxId: 1313]} Length = 137 Back     information, alignment and structure
>d1sqha_ d.108.1.5 (A:) Hypothetical protein cg14615-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 297 Back     information, alignment and structure
>d1y9wa1 d.108.1.1 (A:1-140) Probable acetyltransferase BC2806 {Bacillus cereus [TaxId: 1396]} Length = 140 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query464
d1z4ra1162 Catalytic domain of GCN5 histone acetyltransferase 100.0
d1ygha_164 Catalytic domain of GCN5 histone acetyltransferase 100.0
d1qsra_162 Catalytic domain of GCN5 histone acetyltransferase 100.0
d1n71a_180 Aminoglycoside 6'-N-acetyltransferase {Enterococcu 99.74
d1y9ka1152 IAA acetyltransferase {Bacillus cereus [TaxId: 139 99.67
d1y9wa1140 Probable acetyltransferase BC2806 {Bacillus cereus 99.66
d2g3aa1137 Probable acetyltransferase Atu2258 {Agrobacterium 99.65
d1bo4a_137 Aminoglycoside 3-N-acetyltransferase {Serratia mar 99.65
d1tiqa_173 Protease synthase and sporulation negative regulat 99.65
d1yvka1152 Hypothetical protein YvbK (BSu33890) {Bacillus sub 99.61
d1yr0a1163 Phosphinothricin acetyltransferase {Agrobacterium 99.6
d1wwza1157 Hypothetical protein PH1933 {Pyrococcus horikoshii 99.6
d1cjwa_166 Serotonin N-acetyltranferase {Sheep (Ovis aries) [ 99.59
d2fe7a1156 Probable N-acetyltransferase PA0478 {Pseudomonas a 99.58
d1s3za_147 Aminoglycoside N-acetyltransferase AAC(6')-IY {Sal 99.57
d2fiwa1156 Probable N-acetyltransferase RPA1999 {Rhodopseudom 99.57
d1y7ra1133 Hypothetical protein SA2161 {Staphylococcus aureus 99.57
d2jdca1145 Probable acetyltransferase YitI {Bacillus lichenif 99.56
d2i6ca1160 Putative acetyltransferase PA4794 {Pseudomonas aer 99.56
d1mk4a_157 Hypothetical protein YqiY {Bacillus subtilis [TaxI 99.55
d1ghea_170 Tabtoxin resistance protein {Pseudomonas syringae 99.55
d2fiaa1157 Probable acetyltransferase EF1919 {Enterococcus fa 99.54
d2fl4a1146 Probable spermine/spermidine acetyltransferase EF1 99.54
d1q2ya_140 Probable acetyltransferase YjcF {Bacillus subtilis 99.53
d2gana1182 Hypothetical protein PH0736 {Pyrococcus horikoshii 99.53
d2ae6a1161 Putative acetyltransferase EF0244 {Enterococcus fa 99.53
d1qsma_150 Histone acetyltransferase HPA2 {Baker's yeast (Sac 99.52
d1z4ea1150 Transcriptional regulator BH1968 {Bacillus halodur 99.52
d1vkca_149 Putative acetyltransferase PF0028 {Pyrococcus furi 99.52
d2atra1137 Probable acetyltransferase SP0256 {Streptococcus p 99.5
d2euia1153 Probable acetyltransferase PA4026 {Pseudomonas aer 99.49
d1yvoa1169 Hypothetical protein PA4866 {Pseudomonas aeruginos 99.47
d1i12a_157 Glucosamine-phosphate N-acetyltransferase GNA1 {Ba 99.47
d1vhsa_165 Putative phosphinothricin acetyltransferase YwnH { 99.44
d1ufha_155 Putative acetyltransferase YycN {Bacillus subtilis 99.44
d1yx0a1151 Hypothetical protein YsnE {Bacillus subtilis [TaxI 99.42
d2ge3a1164 Probable acetyltransferase Atu2290 {Agrobacterium 99.4
d2cy2a1174 Probable acetyltransferase TTHA1209 {Thermus therm 99.38
d1u6ma_189 Putative acetyltransferase EF0945 {Enterococcus fa 99.37
d2beia1167 Diamine acetyltransferase 2 {Human (Homo sapiens) 99.37
d2b5ga1167 Diamine acetyltransferase 1 {Human (Homo sapiens) 99.36
d1xeba_149 Hypothetical protein PA0115 {Pseudomonas aeruginos 99.36
d2aj6a1118 Hypothetical protein MW0638 {Staphylococcus aureus 99.32
d1yrea1183 Hypothetical protein PA3270 {Pseudomonas aeruginos 99.18
d1s7ka1174 L7/L12-Ribosomal-protein-serine acetyltransferase 99.15
d1nsla_180 Probable acetyltransferase YdaF {Bacillus subtilis 99.13
d1m4ia_181 Aminoglycoside 2'-N-acetyltransferase {Mycobacteri 99.07
d2hv2a2285 Hypothetical protein EF1021 {Enterococcus faecalis 99.07
d2ozga2283 Putative acetyltransferase Ava4977 {Anabaena varia 99.07
d1p0ha_308 Mycothiol synthase MshD {Mycobacterium tuberculosi 98.98
d1yk3a1198 Hypothetical protein Rv1347c/MT1389 {Mycobacterium 98.97
d1r57a_102 Hypothetical protein SA2309 {Staphylococcus aureus 98.94
d2fcka1178 Putative ribosomal-protein-serine acetyltransferas 98.91
d2i00a2291 Putative acetyltransferase EF2353 {Enterococcus fa 98.9
d1sqha_297 Hypothetical protein cg14615-pa {Fruit fly (Drosop 98.89
d2fsra1164 Probable acetyltranferase Atu2435 {Agrobacterium t 98.41
d1ro5a_197 Autoinducer synthesis protein LasI {Pseudomonas ae 98.21
d1p0ha_308 Mycothiol synthase MshD {Mycobacterium tuberculosi 97.97
d1kzfa_210 Acyl-homoserinelactone synthase EsaI {Pantoea stew 97.46
d1xmta_95 Hypothetical protein AT1g77540 {Thale cress (Arabi 97.14
d1lrza3182 Methicillin resistance protein FemA {Staphylococcu 96.45
d1iica1185 N-myristoyl transferase, NMT {Baker's yeast (Sacch 96.45
d1iyka1165 N-myristoyl transferase, NMT {Yeast (Candida albic 96.41
d1ne9a2171 Peptidyltransferase FemX {Weissella viridescens [T 96.21
d1rxta1141 N-myristoyl transferase, NMT {Human (Homo sapiens) 95.83
d1boba_315 Histone acetyltransferase HAT1 {Baker's yeast (Sac 94.86
d2ozua1270 Histone acetyltransferase MYST3 {Human (Homo sapie 86.17
d2giva1271 Probable histone acetyltransferase MYST1 {Human (H 85.18
d1ylea1338 Arginine N-succinyltransferase, alpha chain, AstA 84.8
d1fy7a_273 Histone acetyltransferase ESA1 {Baker's yeast (Sac 83.31
>d1z4ra1 d.108.1.1 (A:497-658) Catalytic domain of GCN5 histone acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Acyl-CoA N-acyltransferases (Nat)
superfamily: Acyl-CoA N-acyltransferases (Nat)
family: N-acetyl transferase, NAT
domain: Catalytic domain of GCN5 histone acetyltransferase
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=8.7e-45  Score=326.16  Aligned_cols=158  Identities=52%  Similarity=0.976  Sum_probs=153.1

Q ss_pred             CcEEEEEecCCC----chhhHHHHHHHHHHHhhcCCCCcHHHHHHHhhcCCceEEEEEECCEEEEEEEEEEecCCceEEE
Q 012402          207 GNLKFVCLSNDG----IDEHMVWLIGLKNIFARQLPNMPKEYIVRLVMDRSHKSVMVIRGNVVVGGITYRPYVSQKFGEI  282 (464)
Q Consensus       207 G~I~f~vv~Nd~----~~~~liwL~~LkniFskQLPkMpkEYI~RLVfD~~h~s~VlikdGkVIGGI~~R~f~~~~faEI  282 (464)
                      |+|+|+++.|+.    .++.++||.+++++|++|||+||++||.|+++|++|.+++++++|+|||+||++++++.+++||
T Consensus         1 ~~i~~~~~~n~~~~~~~~~~~~~L~~~~~iF~~~lp~m~~~yi~r~~~d~~~~~~v~~~~~~iIG~i~~~~~~~~~~aeI   80 (162)
T d1z4ra1           1 GIIEFHVIGNSLTPKANRRVLLWLVGLQNVFSHQLPRMPKEYIARLVFDPKHKTLALIKDGRVIGGICFRMFPTQGFTEI   80 (162)
T ss_dssp             CSEEEEEECCSSCTTSCHHHHHHHHHHHHHHHHHCTTSCHHHHHHHHTCTTCEEEEEEETTEEEEEEEEEEETTTTEEEE
T ss_pred             CEEEEEEecCCCCCccCHHHHHHHHHHHHHHHHhCCCCcHHHHHHHhcCCCceEEEEEECCEEEEEEEEEEECCCCEEEE
Confidence            899999999974    5688999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEEEeCCCccccCHHHHHHHHHHHHHHhhCCCcEEEEccCccchhhhhhcCCeEeeecccccccccccCCCCceeeeeec
Q 012402          283 AFCAITADEQVKGYGTRLMNHLKQHARDVDGLTHFLTYADNNAVGYFIKQGFTKEIYLEKDRWQGYIKDYDGGILMECKI  362 (464)
Q Consensus       283 vfIAVsps~QGKGyGS~LMnhLke~Are~~Gi~~LLTyADn~AIgFYkKqGFtkeI~lpk~iw~GyIKDYEgatLMEC~L  362 (464)
                      .+|||+|++||||||++||+++++++++ .|+.++++++++.|++||+|+||++++++|+.+|.||||||+|+|||+|.|
T Consensus        81 ~~laV~~~~qgkGiG~~Lm~~l~~~~~~-~g~~~i~~~~~~~A~~fY~k~GF~~~~~~~~~~~~~~ikdy~~~~lm~~~~  159 (162)
T d1z4ra1          81 VFCAVTSNEQVKGYGTHLMNHLKEYHIK-HNILYFLTYADEYAIGYFKKQGFSKDIKVPKSRYLGYIKDYEGATLMECEL  159 (162)
T ss_dssp             EEEEECGGGCSSSHHHHHHHHHHHHHHH-TTCCEEEEEECGGGHHHHHHTTEESCCCSCHHHHTTTSCCCTTCEEEEEEC
T ss_pred             EEEEEChhhhhhhHHHHHHHHHHHHHHH-CCCcEEEEecCcchHHHHHhCCCeEeccCchhHhcCCccCCCCeEEEEEec
Confidence            9999999999999999999999999998 999999999999999999999999999999999999999999999999999


Q ss_pred             CCC
Q 012402          363 DPK  365 (464)
Q Consensus       363 ~Pk  365 (464)
                      +|+
T Consensus       160 ~p~  162 (162)
T d1z4ra1         160 NPR  162 (162)
T ss_dssp             CCC
T ss_pred             CCC
Confidence            996
>d1ygha_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qsra_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Tetrahymena thermophila [TaxId: 5911]} Back     information, alignment and structure
>d1n71a_ d.108.1.1 (A:) Aminoglycoside 6'-N-acetyltransferase {Enterococcus faecium [TaxId: 1352]} Back     information, alignment and structure
>d1y9ka1 d.108.1.1 (A:1-152) IAA acetyltransferase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1y9wa1 d.108.1.1 (A:1-140) Probable acetyltransferase BC2806 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2g3aa1 d.108.1.1 (A:1-137) Probable acetyltransferase Atu2258 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1bo4a_ d.108.1.1 (A:) Aminoglycoside 3-N-acetyltransferase {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1tiqa_ d.108.1.1 (A:) Protease synthase and sporulation negative regulatory protein PaiA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1yvka1 d.108.1.1 (A:5-156) Hypothetical protein YvbK (BSu33890) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1yr0a1 d.108.1.1 (A:4-166) Phosphinothricin acetyltransferase {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1wwza1 d.108.1.1 (A:1-157) Hypothetical protein PH1933 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1cjwa_ d.108.1.1 (A:) Serotonin N-acetyltranferase {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d2fe7a1 d.108.1.1 (A:3-158) Probable N-acetyltransferase PA0478 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1s3za_ d.108.1.1 (A:) Aminoglycoside N-acetyltransferase AAC(6')-IY {Salmonella enteritidis [TaxId: 149539]} Back     information, alignment and structure
>d2fiwa1 d.108.1.1 (A:2-157) Probable N-acetyltransferase RPA1999 {Rhodopseudomonas palustris [TaxId: 1076]} Back     information, alignment and structure
>d1y7ra1 d.108.1.1 (A:1-133) Hypothetical protein SA2161 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2jdca1 d.108.1.1 (A:2-146) Probable acetyltransferase YitI {Bacillus licheniformis [TaxId: 1402]} Back     information, alignment and structure
>d2i6ca1 d.108.1.1 (A:1001-1160) Putative acetyltransferase PA4794 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1mk4a_ d.108.1.1 (A:) Hypothetical protein YqiY {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ghea_ d.108.1.1 (A:) Tabtoxin resistance protein {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d2fiaa1 d.108.1.1 (A:1-157) Probable acetyltransferase EF1919 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2fl4a1 d.108.1.1 (A:1-146) Probable spermine/spermidine acetyltransferase EF1086 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1q2ya_ d.108.1.1 (A:) Probable acetyltransferase YjcF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2gana1 d.108.1.1 (A:1-182) Hypothetical protein PH0736 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2ae6a1 d.108.1.1 (A:1-161) Putative acetyltransferase EF0244 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1qsma_ d.108.1.1 (A:) Histone acetyltransferase HPA2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z4ea1 d.108.1.1 (A:4-153) Transcriptional regulator BH1968 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1vkca_ d.108.1.1 (A:) Putative acetyltransferase PF0028 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2atra1 d.108.1.1 (A:1-137) Probable acetyltransferase SP0256 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2euia1 d.108.1.1 (A:1-153) Probable acetyltransferase PA4026 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1yvoa1 d.108.1.1 (A:4-172) Hypothetical protein PA4866 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1i12a_ d.108.1.1 (A:) Glucosamine-phosphate N-acetyltransferase GNA1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vhsa_ d.108.1.1 (A:) Putative phosphinothricin acetyltransferase YwnH {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ufha_ d.108.1.1 (A:) Putative acetyltransferase YycN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1yx0a1 d.108.1.1 (A:1-151) Hypothetical protein YsnE {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2ge3a1 d.108.1.1 (A:6-169) Probable acetyltransferase Atu2290 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2cy2a1 d.108.1.1 (A:1-174) Probable acetyltransferase TTHA1209 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1u6ma_ d.108.1.1 (A:) Putative acetyltransferase EF0945 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2beia1 d.108.1.1 (A:3-169) Diamine acetyltransferase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b5ga1 d.108.1.1 (A:3-169) Diamine acetyltransferase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xeba_ d.108.1.1 (A:) Hypothetical protein PA0115 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2aj6a1 d.108.1.1 (A:1-118) Hypothetical protein MW0638 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1yrea1 d.108.1.1 (A:11-193) Hypothetical protein PA3270 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1s7ka1 d.108.1.1 (A:3-176) L7/L12-Ribosomal-protein-serine acetyltransferase RimL {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1nsla_ d.108.1.1 (A:) Probable acetyltransferase YdaF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1m4ia_ d.108.1.1 (A:) Aminoglycoside 2'-N-acetyltransferase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2hv2a2 d.108.1.10 (A:2-286) Hypothetical protein EF1021 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2ozga2 d.108.1.10 (A:8-290) Putative acetyltransferase Ava4977 {Anabaena variabilis [TaxId: 1172]} Back     information, alignment and structure
>d1p0ha_ d.108.1.1 (A:) Mycothiol synthase MshD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1yk3a1 d.108.1.1 (A:10-207) Hypothetical protein Rv1347c/MT1389 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1r57a_ d.108.1.1 (A:) Hypothetical protein SA2309 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2fcka1 d.108.1.1 (A:1-178) Putative ribosomal-protein-serine acetyltransferase VC1889 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2i00a2 d.108.1.10 (A:10-300) Putative acetyltransferase EF2353 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1sqha_ d.108.1.5 (A:) Hypothetical protein cg14615-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2fsra1 d.108.1.1 (A:4-167) Probable acetyltranferase Atu2435 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1ro5a_ d.108.1.3 (A:) Autoinducer synthesis protein LasI {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1p0ha_ d.108.1.1 (A:) Mycothiol synthase MshD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kzfa_ d.108.1.3 (A:) Acyl-homoserinelactone synthase EsaI {Pantoea stewartii subsp. stewartii [TaxId: 66271]} Back     information, alignment and structure
>d1xmta_ d.108.1.1 (A:) Hypothetical protein AT1g77540 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1lrza3 d.108.1.4 (A:166-244,A:310-412) Methicillin resistance protein FemA {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1iica1 d.108.1.2 (A:34-218) N-myristoyl transferase, NMT {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iyka1 d.108.1.2 (A:60-224) N-myristoyl transferase, NMT {Yeast (Candida albicans) [TaxId: 5476]} Back     information, alignment and structure
>d1ne9a2 d.108.1.4 (A:165-335) Peptidyltransferase FemX {Weissella viridescens [TaxId: 1629]} Back     information, alignment and structure
>d1rxta1 d.108.1.2 (A:78-218) N-myristoyl transferase, NMT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1boba_ d.108.1.1 (A:) Histone acetyltransferase HAT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ozua1 d.108.1.1 (A:507-776) Histone acetyltransferase MYST3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2giva1 d.108.1.1 (A:4-274) Probable histone acetyltransferase MYST1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ylea1 d.108.1.8 (A:1-338) Arginine N-succinyltransferase, alpha chain, AstA {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1fy7a_ d.108.1.1 (A:) Histone acetyltransferase ESA1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure