Citrus Sinensis ID: 012450


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460---
MQHHGKLNQIIMAACNIFTKTPNPSLIQHLNKLVILNLSGCSKLKSLPEISSAGNIEKILLDGTAIEELPSSIGCLSRLLELNLGDCKNLKTLPSSLCKLKSLEEICLTGSAIEELPSPIECLSALCVLDLGDCKSLKSLKLPFDGLYSLTYLYLTDCAITELPESLGLLSSLEELYLERNNFERIPESIIRLSKLSSLLVSYCERLQSLPKLPCNLYWLDAQHCTTLESLSGLFSSYKCVFFYLNENFKLDRKLRGIVEDALQNIQLMATARWKEIREKISYPALQGHVVLPGNEIPMWFSSQGMGSSITLKMQPGCFSNNKVFGFVFCAIVAFRDHHVRDWSFKFYCEFKIKLKDCDPHVIQRYLGRVNYVEPDHLLLGYYFFNHQDLNGCWEYNCVPEAVQFYFKKVLGSETETLDCCGVKKCGIHLFHASDSMDSMEDPSKVFNRKEVEEPHPKRLKYL
ccccccccEEccccccccEEEcccccccccccccEEEccccccccccccccccccccEEEccccccEEccccccccccccEEEcccccccccccccccccccccEEEccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccccccccccccccccEEEccccccEEccHHccccccccEEccccccccccccccccccccccccccccccccccccccccccEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEccccccccccccccccEEEEEccccccccccEEEEEEEEEEEcccccccccccEEEEEEEEEEccccccEEEEEccccccccccEEEEEEEEcccccccccccccccccEEEEEEEEEccccccccccEEEEEEEEEEEEEcccccccccccccccccccccccccccccc
cccccccEEEEcccccccccccccHHHcccHcccEEEcccccccccccccccccccEEEEccccccccccHHHHccccccEEEcccccccccccHHHcccccccEEEccccccccccHHHHccccccEEEccccccHccccHHHcccccccEEEccccccccccHHHcccccccEEEccccccccccHHHHHHHcccEEEccccccccccccccccccEEcccccccccccccccccccHHEHEccccHcHHHcHHHHHHHHHHHHHHHcccccccccHHHccccccEEEEcccccccHHHHccccccEEEEEcccccccccccccEEEEEEEEEccccccccccEEEEEEEEEccccccEEccccccccccccccEEEEEEcccccccccccccccccccEEEEEEEEEcccccccccEEEEEEcEEEEEEEcccccccccccccccccccccccHHHcccc
MQHHGKLNQIIMAACNiftktpnpslIQHLNKLVILNlsgcsklkslpeissagnIEKILLdgtaieelpssiGCLSRLlelnlgdcknlktlpsslcklKSLEEICltgsaieelpspiECLSALcvldlgdckslkslklpfdglysltylyltdcaitelpeslglLSSLEELYLErnnferipeSIIRLSKLSSLLVSYCERlqslpklpcnlywldaqhcttleslsglfssYKCVFFYLNENFKLDRKLRGIVEDALQNIQLMATARWKEIREKisypalqghvvlpgneipmwfssqgmgssitlkmqpgcfsnnkvfGFVFCAIVAFrdhhvrdwSFKFYCEFkiklkdcdphVIQRYLgrvnyvepdhlllgyyffnhqdlngcweyncvpEAVQFYFKKVLgsetetldccgvkkcgihlfhasdsmdsmedpskvfnrkeveephpkrlkyl
MQHHGKLNQIIMAACNIFTKTPNPSLIQHLNKLVILNLSGCSKLKSLPEISSAGNIEKILLDGTAIEELPSSIGCLSRLLELNLGDCKNLKTLPSSLCKLKSLEEICLTGSAIEELPSPIECLSALCVLDLGDCKSLKSLKLPFDGLYSLTYLYLTDCAITELPESLGLLSSLEELYLERNNFERIPESIIRLSKLSSLLVSYCERLQSLPKLPCNLYWLDAQHCTTLESLSGLFSSYKCVFFYLNENFKLDRKLRGIVEDALQNIQLMATARWKEIREKISYPALQGHVVLPGNEIPMWFSSQGMGSSITLKMQPGCFSNNKVFGFVFCAIVAFRDHHVRDWSFKFYCEFKIKLKDCDPHVIQRYLGRVNYVEPDHLLLGYYFFNHQDLNGCWEYNCVPEAVQFYFKKVLGSETETLDCCGVKKCGIHLFhasdsmdsmedpskvfnrkeveephpkrlkyl
MQHHGKLNQIIMAACNIFTKTPNPSLIQHLNKLVILNLSGCSKLKSLPEISSAGNIEKILLDGTAIEELPSSIGCLSRLLELNLGDCKNLKTLPSSLCKLKSLEEICLTGSAIEELPSPIECLSALCVLDLGDCKSLKSLKLPFDGLYSLTYLYLTDCAITelpeslgllssleelyleRNNFERIPESIIRlsklssllvsYCERLQSLPKLPCNLYWLDAQHCTTLESLSGLFSSYKCVFFYLNENFKLDRKLRGIVEDALQNIQLMATARWKEIREKISYPALQGHVVLPGNEIPMWFSSQGMGSSITLKMQPGCFSNNKVFGFVFCAIVAFRDHHVRDWSFKFYCEFKIKLKDCDPHVIQRYLGRVNYVEPDHLLLGYYFFNHQDLNGCWEYNCVPEAVQFYFKKVLGSETETLDCCGVKKCGIHLFHASDSMDSMEDPSKVFNRKEVEEPHPKRLKYL
******LNQIIMAACNIFTKTPNPSLIQHLNKLVILNLSGCSKLKSLPEISSAGNIEKILLDGTAIEELPSSIGCLSRLLELNLGDCKNLKTLPSSLCKLKSLEEICLTGSAIEELPSPIECLSALCVLDLGDCKSLKSLKLPFDGLYSLTYLYLTDCAITELPESLGLLSSLEELYLERNNFERIPESIIRLSKLSSLLVSYCERLQSLPKLPCNLYWLDAQHCTTLESLSGLFSSYKCVFFYLNENFKLDRKLRGIVEDALQNIQLMATARWKEIREKISYPALQGHVVLPGNEIPMWFSSQGMGSSITLKMQPGCFSNNKVFGFVFCAIVAFRDHHVRDWSFKFYCEFKIKLKDCDPHVIQRYLGRVNYVEPDHLLLGYYFFNHQDLNGCWEYNCVPEAVQFYFKKVLGSETETLDCCGVKKCGIHLFHA******************************
MQHHGKLNQIIMAACNIFTKTPNPSLIQHLNKLVILNLSGCSKLKSLPEISSAGNIEKILLDGTAIEELPSSIGCLSRLLELNLGDCKNLKTLPSSLCKLKSLEEICLTGSAIEELPSPIECLSALCVLDLGDCKSLKSLKLPFDGLYSLTYLYLTDCAITELPESLGLLSSLEELYLERNNFERIPESIIRLSKLSSLLVSYCERLQSLPKLPCNLYWLDAQHCTTLESLSGLFSSYKCVFFYLNENFKLDRKLRGIVEDALQNIQLMATARWKEIREKISYPALQGHVVLPGNEIPMWFSSQGMGSSITLKMQPGCFSNNKVFGFVFCAIVAFRDHHVRDWSFKFYCEFKIKLKDCDPHVIQRYLGRVNYVEPDHLLLGYYFFNHQDLNGCWEYNCVPEAVQFYFKKVLGSETETLDCCGVKKCGIHLFHASD****************************
MQHHGKLNQIIMAACNIFTKTPNPSLIQHLNKLVILNLSGCSKLKSLPEISSAGNIEKILLDGTAIEELPSSIGCLSRLLELNLGDCKNLKTLPSSLCKLKSLEEICLTGSAIEELPSPIECLSALCVLDLGDCKSLKSLKLPFDGLYSLTYLYLTDCAITELPESLGLLSSLEELYLERNNFERIPESIIRLSKLSSLLVSYCERLQSLPKLPCNLYWLDAQHCTTLESLSGLFSSYKCVFFYLNENFKLDRKLRGIVEDALQNIQLMATARWKEIREKISYPALQGHVVLPGNEIPMWFSSQGMGSSITLKMQPGCFSNNKVFGFVFCAIVAFRDHHVRDWSFKFYCEFKIKLKDCDPHVIQRYLGRVNYVEPDHLLLGYYFFNHQDLNGCWEYNCVPEAVQFYFKKVLGSETETLDCCGVKKCGIHLFHASDSMDSMEDPSKVFNRK*************
MQHHGKLNQIIMAACNIFTKTPNPSLIQHLNKLVILNLSGCSKLKSLPEISSAGNIEKILLDGTAIEELPSSIGCLSRLLELNLGDCKNLKTLPSSLCKLKSLEEICLTGSAIEELPSPIECLSALCVLDLGDCKSLKSLKLPFDGLYSLTYLYLTDCAITELPESLGLLSSLEELYLERNNFERIPESIIRLSKLSSLLVSYCERLQSLPKLPCNLYWLDAQHCTTLESLSGLFSSYKCVFFYLNENFKLDRKLRGIVEDALQNIQLMATARWKEIREKISYPALQGHVVLPGNEIPMWFSSQGMGSSITLKMQPGCFSNNKVFGFVFCAIVAFRDHHVRDWSFKFYCEFKIKLKDCDPHVIQRYLGRVNYVEPDHLLLGYYFFNHQDLNGCWEYNCVPEAVQFYFKKVLGSETETLDCCGVKKCGIHLFHASD****************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQHHGKLNQIIMAACNIFTKTPNPSLIQHLNKLVILNLSGCSKLKSLPEISSAGNIEKILLDGTAIEELPSSIGCLSRLLELNLGDCKNLKTLPSSLCKLKSLEEICLTGSAIEELPSPIECLSALCVLDLGDCKSLKSLKLPFDGLYSLTYLYLTDCAITELPESLGLLSSLEELYLERNNFERIPESIIRLSKLSSLLVSYCERLQSLPKLPCNLYWLDAQHCTTLESLSGLFSSYKCVFFYLNENFKLDRKLRGIVEDALQNIQLMATARWKEIREKISYPALQGHVVLPGNEIPMWFSSQGMGSSITLKMQPGCFSNNKVFGFVFCAIVAFRDHHVRDWSFKFYCEFKIKLKDCDPHVIQRYLGRVNYVEPDHLLLGYYFFNHQDLNGCWEYNCVPEAVQFYFKKVLGSETETLDCCGVKKCGIHLFHASDSMDSMEDPSKVFNRKEVEEPHPKRLKYL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query463 2.2.26 [Sep-21-2011]
Q403921144 TMV resistance protein N N/A no 0.626 0.253 0.335 2e-28
O235301301 Protein SUPPRESSOR OF npr no no 0.377 0.134 0.356 4e-15
Q9RBS2 1024 Protein PopC OS=Ralstonia yes no 0.406 0.183 0.335 7e-15
Q9FL92 1372 Probable WRKY transcripti no no 0.866 0.292 0.261 2e-14
Q9SZ67 1895 Probable WRKY transcripti no no 0.274 0.067 0.372 5e-14
Q7KRY7 1851 Protein lap4 OS=Drosophil yes no 0.423 0.105 0.306 2e-13
O825001095 Putative disease resistan no no 0.524 0.221 0.261 8e-13
F1MCA7 1536 Leucine-rich repeat-conta yes no 0.442 0.133 0.268 2e-12
B0W6M9628 Leucine-rich repeat prote N/A no 0.373 0.275 0.325 7e-12
Q80TE7 1490 Leucine-rich repeat-conta yes no 0.431 0.134 0.274 7e-12
>sp|Q40392|TMVRN_NICGU TMV resistance protein N OS=Nicotiana glutinosa GN=N PE=1 SV=1 Back     alignment and function desciption
 Score =  127 bits (319), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 114/340 (33%), Positives = 159/340 (46%), Gaps = 50/340 (14%)

Query: 29   HLNKLVILNLSGCSKLKSLPEISSAGNIE-KILLDGTAIEELPSSI-GCLSRLLELNLGD 86
            ++  L  L L  C  L+ LPEI      E +I + G+ I ELPSSI    + + +L L +
Sbjct: 686  NVESLEYLGLRSCDSLEKLPEIYGRMKPEIQIHMQGSGIRELPSSIFQYKTHVTKLLLWN 745

Query: 87   CKNLKTLPSSLCKLKSLEEICLTG-SAIEELPSPIECLSALCVLDLGDCKSLK------- 138
             KNL  LPSS+C+LKSL  + ++G S +E LP  I  L  L V D  D   L+       
Sbjct: 746  MKNLVALPSSICRLKSLVSLSVSGCSKLESLPEEIGDLDNLRVFDASDTLILRPPSSIIR 805

Query: 139  ----------------SLKLP--FDGLYSLTYLYLTDCAITE--LPESLGLLSSLEELYL 178
                              + P   +GL+SL YL L+ C + +  LPE +G LSSL++L L
Sbjct: 806  LNKLIILMFRGFKDGVHFEFPPVAEGLHSLEYLNLSYCNLIDGGLPEEIGSLSSLKKLDL 865

Query: 179  ERNNFERIPESIIRLSKLSSLLVSYCERLQSLPKLPCNLYWLDAQHCTTLESLSGLFSSY 238
             RNNFE +P SI +L  L SL +  C+RL  LP+LP  L  L       L          
Sbjct: 866  SRNNFEHLPSSIAQLGALQSLDLKDCQRLTQLPELPPELNELHVDCHMAL---------- 915

Query: 239  KCVFFYLNENFKLDR-KLRGIVEDALQNIQLMATARWKEI---REKISYPALQGHVVLPG 294
            K + + + +  KL R KL     D + N  L A   ++ I   R  IS        V  G
Sbjct: 916  KFIHYLVTKRKKLHRVKLDDAHNDTMYN--LFAYTMFQNISSMRHDISASDSLSLTVFTG 973

Query: 295  N----EIPMWFSSQGMGSSITLKMQPGCFSNNKVFGFVFC 330
                 +IP WF  QG  SS+++ +    +  +K  GF  C
Sbjct: 974  QPYPEKIPSWFHHQGWDSSVSVNLPENWYIPDKFLGFAVC 1013




Disease resistance protein. Resistance proteins guard the plant against pathogens that contain an appropriate avirulence protein via a direct or indirect interaction with this avirulence protein. That triggers a defense system including the hypersensitive response, which restricts the pathogen growth.
Nicotiana glutinosa (taxid: 35889)
>sp|O23530|SNC1_ARATH Protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1 OS=Arabidopsis thaliana GN=SNC1 PE=1 SV=3 Back     alignment and function description
>sp|Q9RBS2|POPC_RALSO Protein PopC OS=Ralstonia solanacearum (strain GMI1000) GN=popC PE=4 SV=2 Back     alignment and function description
>sp|Q9FL92|WRK16_ARATH Probable WRKY transcription factor 16 OS=Arabidopsis thaliana GN=WRKY16 PE=2 SV=1 Back     alignment and function description
>sp|Q9SZ67|WRK19_ARATH Probable WRKY transcription factor 19 OS=Arabidopsis thaliana GN=WRKY19 PE=2 SV=1 Back     alignment and function description
>sp|Q7KRY7|LAP4_DROME Protein lap4 OS=Drosophila melanogaster GN=scrib PE=1 SV=1 Back     alignment and function description
>sp|O82500|Y4117_ARATH Putative disease resistance protein At4g11170 OS=Arabidopsis thaliana GN=At4g11170 PE=2 SV=1 Back     alignment and function description
>sp|F1MCA7|LRRC7_BOVIN Leucine-rich repeat-containing protein 7 OS=Bos taurus GN=LRRC7 PE=3 SV=3 Back     alignment and function description
>sp|B0W6M9|SUR8_CULQU Leucine-rich repeat protein soc-2 homolog OS=Culex quinquefasciatus GN=Sur-8 PE=3 SV=1 Back     alignment and function description
>sp|Q80TE7|LRRC7_MOUSE Leucine-rich repeat-containing protein 7 OS=Mus musculus GN=Lrrc7 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query463
297794743 1184 predicted protein [Arabidopsis lyrata su 0.909 0.355 0.339 3e-49
224127917 1470 tir-nbs-lrr resistance protein [Populus 0.898 0.282 0.333 1e-48
451798990 1335 TMV resistance protein N-like protein 7 0.874 0.303 0.341 2e-48
359493483 1274 PREDICTED: TMV resistance protein N-like 0.863 0.313 0.342 8e-48
451798988 1219 TMV resistance protein N-like protein 6 0.768 0.292 0.355 6e-46
224145021 1561 tir-nbs-lrr resistance protein [Populus 0.896 0.265 0.322 1e-45
359493487 1162 PREDICTED: TMV resistance protein N-like 0.758 0.302 0.357 3e-45
255563202 1158 leucine-rich repeat containing protein, 0.889 0.355 0.328 6e-45
227438275 1226 disease resistance protein [Brassica rap 0.861 0.325 0.323 2e-44
240256011 1210 TIR-NBS-LRR class disease resistance pro 0.909 0.347 0.350 2e-43
>gi|297794743|ref|XP_002865256.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297311091|gb|EFH41515.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
 Score =  202 bits (513), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 161/474 (33%), Positives = 227/474 (47%), Gaps = 53/474 (11%)

Query: 30   LNKLVILNLSGCSKLKSLPEISSAGNIEKILLDGTAIEELPSSIGCLSRLLELNLGDCKN 89
            L  L  L LSGCSKL++ P IS   NIE + LDGTAI+ +P SI  L  L  LNL  C  
Sbjct: 595  LKSLKSLILSGCSKLRTFPTISE--NIESLYLDGTAIKRVPESIDSLRYLAVLNLKKCCK 652

Query: 90   LKTLPSSLCKLKSLEEICLTG------------------------SAIEELPSPIECLSA 125
            L+ LPS+LCK+KSL+E+ L+G                        +AI+++P  + C+S 
Sbjct: 653  LRHLPSNLCKMKSLQELILSGCSKLKCFPEIDEDMEHLEILLMDDTAIKQIPIKM-CMSN 711

Query: 126  LCVLDLGDCKSLKSLK---LPFDGLYSLTYLYLTDCAITELPESLGLLSSLEELYLERNN 182
            L +   G  K   S     LPF G   L+ LYLTDC + +LP +   LSS+  L L RNN
Sbjct: 712  LKMFTFGGSKFQGSTGYELLPFSGCSHLSDLYLTDCNLHKLPNNFSCLSSVHSLCLSRNN 771

Query: 183  FERIPESIIRLSKLSSLLVSYCERLQSLPKLPCNLYWLDAQHCTTLESLSG-----LFSS 237
             E +PESI  L  L SL + +C +L SLP LP NL +LDA  C +LE+++      + + 
Sbjct: 772  LEYLPESIKILHHLKSLDLKHCRKLNSLPVLPSNLQYLDAHDCASLETVANPMTHLVLAE 831

Query: 238  YKCVFFYLNENFKLDRKLR-GIVEDALQNIQLMATARWKEIREKISYPALQGHVVLPGNE 296
                 F   + FKL+R+ +  IV  A    Q++A A  K   + +    L   V  PG++
Sbjct: 832  RVQSTFLFTDCFKLNREAQENIVAHAQLKSQILANACLKRNHKGLVLEPL-ASVSFPGSD 890

Query: 297  IPMWFSSQGMGSSITLKMQPGCFSNNKVFGFVFCAIVAFRDHHVRDWSFKFYCEFKIKLK 356
            +P+WF +Q MG+SI   + P  + ++K  G   C +V+F+D+  +   F   C+ K K +
Sbjct: 891  LPLWFRNQRMGTSIDTHLPPH-WCDSKFRGLSLCVVVSFKDYEDQTSRFSVICKCKFKSE 949

Query: 357  DCDPHVIQRYLGRVN-----------YVEPDHLLLGY---YFFNHQDLNGCWEYNCVPEA 402
              D       LG  N            +  DH+ L Y   +       +G     C   A
Sbjct: 950  SGDCIRFICTLGGWNKLCGSSGHQSRKLGSDHVFLSYNNCFHVKKFREDGNDNNRCCNTA 1009

Query: 403  VQFYFKKVLGSETETLDCCGVKKCGIHLFHASDSMDSMEDPSKVFNRKEVEEPH 456
              F F  V       L    V KCG+ L +A D  D     +   N KEV   H
Sbjct: 1010 ASFKF-FVTDDSKRKLGSFEVVKCGMGLLYAPDESDYRLQETLENNLKEVTSIH 1062




Source: Arabidopsis lyrata subsp. lyrata

Species: Arabidopsis lyrata

Genus: Arabidopsis

Family: Brassicaceae

Order: Brassicales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224127917|ref|XP_002329209.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222870990|gb|EEF08121.1| tir-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|451798990|gb|AGF69193.1| TMV resistance protein N-like protein 7 [Vitis labrusca] Back     alignment and taxonomy information
>gi|359493483|ref|XP_003634610.1| PREDICTED: TMV resistance protein N-like, partial [Vitis vinifera] Back     alignment and taxonomy information
>gi|451798988|gb|AGF69192.1| TMV resistance protein N-like protein 6 [Vitis labrusca] Back     alignment and taxonomy information
>gi|224145021|ref|XP_002325498.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222862373|gb|EEE99879.1| tir-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359493487|ref|XP_003634612.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|255563202|ref|XP_002522604.1| leucine-rich repeat containing protein, putative [Ricinus communis] gi|223538080|gb|EEF39691.1| leucine-rich repeat containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|227438275|gb|ACP30627.1| disease resistance protein [Brassica rapa subsp. pekinensis] Back     alignment and taxonomy information
>gi|240256011|ref|NP_193686.5| TIR-NBS-LRR class disease resistance protein [Arabidopsis thaliana] gi|332658792|gb|AEE84192.1| TIR-NBS-LRR class disease resistance protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query463
TAIR|locus:21533631261 AT5G45200 [Arabidopsis thalian 0.909 0.333 0.289 4.3e-34
TAIR|locus:21222091179 AT4G36150 [Arabidopsis thalian 0.835 0.328 0.295 1.4e-28
TAIR|locus:21229651210 AT4G19510 [Arabidopsis thalian 0.671 0.257 0.315 3e-28
TAIR|locus:21759911294 AT5G17680 [Arabidopsis thalian 0.585 0.209 0.298 4.7e-25
TAIR|locus:21181061219 AT4G12010 [Arabidopsis thalian 0.911 0.346 0.273 4.5e-24
TAIR|locus:21553221170 LAZ5 "LAZARUS 5" [Arabidopsis 0.237 0.094 0.406 1.7e-22
TAIR|locus:21584751217 RPS4 "RESISTANT TO P. SYRINGAE 0.883 0.336 0.268 9.6e-22
TAIR|locus:28276391195 AT2G17060 [Arabidopsis thalian 0.881 0.341 0.248 8.9e-20
TAIR|locus:21533281231 AT5G45230 [Arabidopsis thalian 0.889 0.334 0.244 1.6e-19
TAIR|locus:21462531210 AT5G18370 [Arabidopsis thalian 0.276 0.105 0.378 7.3e-19
TAIR|locus:2153363 AT5G45200 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 383 (139.9 bits), Expect = 4.3e-34, P = 4.3e-34
 Identities = 133/460 (28%), Positives = 217/460 (47%)

Query:     1 MQHHGKLNQIIMAACNIFTKTPNPSLIQHLNKLVILNLSGCSKLKSLPEISSAGNIEKIL 60
             +Q+   L  + +  C      P+ +L+  L  L+   LS CS+ K    I  A N+E++ 
Sbjct:   705 LQNMESLMFLNLRGCTSLESLPDITLVG-LRTLI---LSNCSRFKEFKLI--AKNLEELY 758

Query:    61 LDGTAIEELPSSIGCLSRLLELNLGDCKNLKTLPSSLCKLKSLEEICLTG-SAIEELPSP 119
             LDGTAI+ELPS+IG L +L+ L L DCKNL +LP S+  LK+++EI L+G S++E  P  
Sbjct:   759 LDGTAIKELPSTIGDLQKLISLKLKDCKNLLSLPDSIGNLKAIQEIILSGCSSLESFPEV 818

Query:   120 IECLSALCVLDLGDCKSLKSLKLPFDGLYSLTYLY-LT----DCAITXXXXXXXXXXXXX 174
              + L  L  L L D  ++K  K+P D L+ L+    LT    +C +              
Sbjct:   819 NQNLKHLKTLLL-DGTAIK--KIP-DILHHLSPDQGLTSSQSNCHLCEWPRGIYGLSSVR 874

Query:   175 XXXXXRNNFERIPESIIRXXXXXXXXXXYCERLQSLPKLPCNLYWLDAQHCTTLESLSGL 234
                   N F  +P SI            +C+ L S+P LP NL WLDA  C +LE++S L
Sbjct:   875 RLSLSSNEFRILPRSIGYLYHLNWLDLKHCKNLVSVPMLPPNLQWLDAHGCISLETISIL 934

Query:   235 FSSYKCVFFYLNENFKLDR--KLRGIVEDALQN-----IQLMATARWKEIREKISYPALQ 287
                      +L+  F      KL  + E+++++     IQLM+ A  +   + ++   L 
Sbjct:   935 SDPLLAETEHLHSTFIFTNCTKLYKVEENSIESYPRKKIQLMSNALAR-YEKGLALDVLI 993

Query:   288 GHVVLPGNEIPMWFSSQGMGSSITLKMQPGCFSNNKVFGFVFCAIVAFRDHHVRDWSFKF 347
             G +  PG ++P WF+ + +G  +   + P  ++   + G   CA+V+F+D+  ++     
Sbjct:   994 G-ICFPGWQVPGWFNHRTVGLELKQNL-PRHWNAGGLAGIALCAVVSFKDYISKNNRLLV 1051

Query:   348 YCEFKIKLKDCDPHVIQRYLG----RVNY----VEPDHLLLGYY-FFNHQDLNGCWEYNC 398
              C  + K +D         LG      +Y    ++ DH+ +GY  + N    +      C
Sbjct:  1052 TCSGEFKKEDKTLFQFSCILGGWTEHGSYEAREIKSDHVFIGYTSWLNFMKSDD--SIGC 1109

Query:   399 VPEAVQFYFKKVLGSETETLDCCGVKKCGIHLFHASDSMD 438
             V       F+   G  T  +  C V KCG  L ++  ++D
Sbjct:  1110 VATEASLRFQVTDG--TREVTNCTVVKCGFSLIYSHTNVD 1147


GO:0005622 "intracellular" evidence=IEA
GO:0005737 "cytoplasm" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0007165 "signal transduction" evidence=IEA
GO:0043531 "ADP binding" evidence=IEA
TAIR|locus:2122209 AT4G36150 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2122965 AT4G19510 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2175991 AT5G17680 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2118106 AT4G12010 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2155322 LAZ5 "LAZARUS 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2158475 RPS4 "RESISTANT TO P. SYRINGAE 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2827639 AT2G17060 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2153328 AT5G45230 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2146253 AT5G18370 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
Al_scaffold_0008_340
annotation not avaliable (1184 aa)
(Arabidopsis lyrata)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query463
PLN032101153 PLN03210, PLN03210, Resistant to P 2e-20
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 9e-12
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-10
PLN03210 1153 PLN03210, PLN03210, Resistant to P 2e-08
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 8e-08
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-04
PRK15387 788 PRK15387, PRK15387, E3 ubiquitin-protein ligase Ss 0.001
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 0.002
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 0.003
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
 Score = 94.6 bits (235), Expect = 2e-20
 Identities = 105/376 (27%), Positives = 169/376 (44%), Gaps = 48/376 (12%)

Query: 1    MQHHGKLNQIIMAACNIFTKTPNPSLIQHLNKLVILNLSGCSKLKSLPEISSAGNIEKIL 60
            +Q+  KL  + M+ C      P    ++ L +L   NLSGCS+LKS P+IS+  NI  + 
Sbjct: 677  IQYLNKLEDLDMSRCENLEILPTGINLKSLYRL---NLSGCSRLKSFPDIST--NISWLD 731

Query: 61   LDGTAIEELPSSIGCLSRLLELNLGDCKN-------------LKTLPSSLCKLKSLEEIC 107
            LD TAIEE PS++  L  L EL L + K+             +  L  SL +L  L +I 
Sbjct: 732  LDETAIEEFPSNLR-LENLDELILCEMKSEKLWERVQPLTPLMTMLSPSLTRL-FLSDI- 788

Query: 108  LTGSAIEELPSPIECLSALCVLDLGDCKSLKSLK--LPFDGLYSLTYLYLTDCAITELPE 165
                ++ ELPS I+ L  L  L++ +C +L++L   +  + L SL    L+ C  + L  
Sbjct: 789  ---PSLVELPSSIQNLHKLEHLEIENCINLETLPTGINLESLESLD---LSGC--SRLRT 840

Query: 166  SLGLLSSLEELYLERNNFERIPESIIRLSKLSSLLVSYCERLQ----SLPKLPCNLYWLD 221
               + +++ +L L R   E +P  I + S LS L ++ C  LQ    ++ KL  +L  +D
Sbjct: 841  FPDISTNISDLNLSRTGIEEVPWWIEKFSNLSFLDMNGCNNLQRVSLNISKLK-HLETVD 899

Query: 222  AQHCTTLESLSGLFSSYKCVFFYLNENFKLDRKLRGIVEDALQNIQLMATARWKEIREKI 281
               C  L   S   S  +      N + KL   +     +   N+   A  + + I +++
Sbjct: 900  FSDCGALTEASWNGSPSEVAMATDNIHSKLPSTVCINFINCF-NLDQEALLQQQSIFKQL 958

Query: 282  SYPALQGHVVLPGNEIPMWFSSQGMGSSITLKMQPGCFSNNKVFGFVFCAIVAFRDHHVR 341
                     +L G E+P +F+ +  G+S+T             F F  CA+V      + 
Sbjct: 959  ---------ILSGEEVPSYFTHRTTGASLTNIPLLHISPCQPFFRFRACAVVDSESFFII 1009

Query: 342  DWSFKFY--CEFKIKL 355
              SF     C F  +L
Sbjct: 1010 SVSFDIQVCCRFIDRL 1025


syringae 6; Provisional. Length = 1153

>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|185285 PRK15387, PRK15387, E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 463
PLN032101153 Resistant to P. syringae 6; Provisional 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.84
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.84
PLN032101153 Resistant to P. syringae 6; Provisional 99.81
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.8
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.74
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.7
KOG0617264 consensus Ras suppressor protein (contains leucine 99.69
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.66
KOG0617264 consensus Ras suppressor protein (contains leucine 99.65
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.64
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.63
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.62
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.62
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.59
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.57
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.56
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.44
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.4
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.36
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.29
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.28
KOG4237498 consensus Extracellular matrix protein slit, conta 99.27
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.24
KOG4237498 consensus Extracellular matrix protein slit, conta 99.13
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.13
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.13
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.13
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.05
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.96
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.95
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.92
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.89
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.88
PRK15386426 type III secretion protein GogB; Provisional 98.74
PRK15386426 type III secretion protein GogB; Provisional 98.69
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.61
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.58
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.57
PLN03150623 hypothetical protein; Provisional 98.53
KOG4341483 consensus F-box protein containing LRR [General fu 98.49
PLN03150623 hypothetical protein; Provisional 98.43
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.4
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.39
KOG4341483 consensus F-box protein containing LRR [General fu 98.33
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.29
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.27
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.25
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.14
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.13
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.89
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.88
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.81
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.77
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.72
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.71
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.66
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.42
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.41
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.39
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.34
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.07
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 96.92
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.85
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.82
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.78
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 96.67
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.61
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 95.15
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 95.14
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.71
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.42
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 93.23
KOG3864221 consensus Uncharacterized conserved protein [Funct 92.97
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 92.18
KOG4308478 consensus LRR-containing protein [Function unknown 89.7
KOG3864221 consensus Uncharacterized conserved protein [Funct 88.87
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 86.11
smart0037026 LRR Leucine-rich repeats, outliers. 86.11
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 85.95
smart0037026 LRR Leucine-rich repeats, outliers. 85.95
KOG0473326 consensus Leucine-rich repeat protein [Function un 84.9
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 83.78
KOG0473326 consensus Leucine-rich repeat protein [Function un 80.82
>PLN03210 Resistant to P Back     alignment and domain information
Probab=100.00  E-value=2.2e-39  Score=367.49  Aligned_cols=388  Identities=26%  Similarity=0.383  Sum_probs=232.1

Q ss_pred             CCCCcceeecccccCcCCCCCcccccCCcCccEEeeecCCCCCCCCC-CCCCCCccEEEeecc-CCCccCccccCCCCcc
Q 012450            3 HHGKLNQIIMAACNIFTKTPNPSLIQHLNKLVILNLSGCSKLKSLPE-ISSAGNIEKILLDGT-AIEELPSSIGCLSRLL   80 (463)
Q Consensus         3 ~~~~L~~L~L~~c~~l~~~~~~~~~~~l~~L~~L~L~~c~~l~~lp~-l~~l~~L~~L~L~~~-~i~~lp~~i~~l~~L~   80 (463)
                      .+++|+.|+|++|+.++.+  | .++.+++|+.|+|++|..+..+|. ++.+++|+.|++++| .++.+|..+ ++++|+
T Consensus       632 ~l~~Lk~L~Ls~~~~l~~i--p-~ls~l~~Le~L~L~~c~~L~~lp~si~~L~~L~~L~L~~c~~L~~Lp~~i-~l~sL~  707 (1153)
T PLN03210        632 SLTGLRNIDLRGSKNLKEI--P-DLSMATNLETLKLSDCSSLVELPSSIQYLNKLEDLDMSRCENLEILPTGI-NLKSLY  707 (1153)
T ss_pred             cCCCCCEEECCCCCCcCcC--C-ccccCCcccEEEecCCCCccccchhhhccCCCCEEeCCCCCCcCccCCcC-CCCCCC
Confidence            3445555555554444444  2 244455555555555555555554 455555555555543 344444433 445555


Q ss_pred             EEeeecCCCCCccchhcCCCCCCcEEEEECCCCcc---------------------------------------------
Q 012450           81 ELNLGDCKNLKTLPSSLCKLKSLEEICLTGSAIEE---------------------------------------------  115 (463)
Q Consensus        81 ~L~l~~c~~l~~lp~~l~~l~~L~~L~l~~~~i~~---------------------------------------------  115 (463)
                      .|++++|..+..+|..   ..+|+.|++++|.++.                                             
T Consensus       708 ~L~Lsgc~~L~~~p~~---~~nL~~L~L~~n~i~~lP~~~~l~~L~~L~l~~~~~~~l~~~~~~l~~~~~~~~~sL~~L~  784 (1153)
T PLN03210        708 RLNLSGCSRLKSFPDI---STNISWLDLDETAIEEFPSNLRLENLDELILCEMKSEKLWERVQPLTPLMTMLSPSLTRLF  784 (1153)
T ss_pred             EEeCCCCCCccccccc---cCCcCeeecCCCccccccccccccccccccccccchhhccccccccchhhhhccccchhee
Confidence            5555555444333321   1223333333333333                                             


Q ss_pred             ---------CCccCCCCCCccEEecCCCCCCCcCcccCCCCCCccEEEeeCCCCC-CcccccCCcccccccccccccccc
Q 012450          116 ---------LPSPIECLSALCVLDLGDCKSLKSLKLPFDGLYSLTYLYLTDCAIT-ELPESLGLLSSLEELYLERNNFER  185 (463)
Q Consensus       116 ---------lp~~i~~l~~L~~L~l~~c~~l~~l~~~l~~l~~L~~L~L~~~~l~-~~p~~l~~l~~L~~L~Ls~n~l~~  185 (463)
                               +|..++++++|+.|++++|..++.+|... ++++|+.|++++|... .+|.   ..++|+.|+|++|.++.
T Consensus       785 Ls~n~~l~~lP~si~~L~~L~~L~Ls~C~~L~~LP~~~-~L~sL~~L~Ls~c~~L~~~p~---~~~nL~~L~Ls~n~i~~  860 (1153)
T PLN03210        785 LSDIPSLVELPSSIQNLHKLEHLEIENCINLETLPTGI-NLESLESLDLSGCSRLRTFPD---ISTNISDLNLSRTGIEE  860 (1153)
T ss_pred             CCCCCCccccChhhhCCCCCCEEECCCCCCcCeeCCCC-CccccCEEECCCCCccccccc---cccccCEeECCCCCCcc
Confidence                     34444445555555555555555554432 4455555555555322 2332   23567788888888888


Q ss_pred             cchhhhCCCCccEeccccccccccCCCCC---CCccEeeccCcccccccccCCCCce---------------eEEEeecC
Q 012450          186 IPESIIRLSKLSSLLVSYCERLQSLPKLP---CNLYWLDAQHCTTLESLSGLFSSYK---------------CVFFYLNE  247 (463)
Q Consensus       186 lp~~l~~l~~L~~L~L~~c~~l~~l~~l~---~~L~~L~i~~c~~L~~l~~~~~~~~---------------~~~~~~~~  247 (463)
                      +|.++..+++|+.|++++|..++.+|...   ++|+.+++.+|.+|+.++.......               ....|.+ 
T Consensus       861 iP~si~~l~~L~~L~L~~C~~L~~l~~~~~~L~~L~~L~l~~C~~L~~~~l~~~~~~~~~~~~n~~~~~p~~~~l~f~n-  939 (1153)
T PLN03210        861 VPWWIEKFSNLSFLDMNGCNNLQRVSLNISKLKHLETVDFSDCGALTEASWNGSPSEVAMATDNIHSKLPSTVCINFIN-  939 (1153)
T ss_pred             ChHHHhcCCCCCEEECCCCCCcCccCcccccccCCCeeecCCCcccccccCCCCchhhhhhcccccccCCchhcccccc-
Confidence            99999999999999999999999988644   4677889999999987654221100               0113555 


Q ss_pred             ccchHHHHhHHHHHHHHHHHHHHHHHHHHHhhccccccccceEeecCCCCCccccccCCCceEE-EEcCCCCCCCCceee
Q 012450          248 NFKLDRKLRGIVEDALQNIQLMATARWKEIREKISYPALQGHVVLPGNEIPMWFSSQGMGSSIT-LKMQPGCFSNNKVFG  326 (463)
Q Consensus       248 c~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~pg~~iP~wf~~~~~g~si~-~~lp~~~~~~~~~~g  326 (463)
                      |++|++.+.         ++               ....+..+++||.++|+||.||+.|++++ |.+|+. |....|.|
T Consensus       940 C~~L~~~a~---------l~---------------~~~~~~~~~l~g~evp~~f~hr~~g~sl~~i~l~~~-~~~~~~~~  994 (1153)
T PLN03210        940 CFNLDQEAL---------LQ---------------QQSIFKQLILSGEEVPSYFTHRTTGASLTNIPLLHI-SPCQPFFR  994 (1153)
T ss_pred             ccCCCchhh---------hc---------------ccccceEEECCCccCchhccCCcccceeeeeccCCc-ccCCCccc
Confidence            888876442         00               01112338899999999999999999998 999999 99899999


Q ss_pred             eEeEEEEEecCCC--CCCceeEEEEEEEccCCCCCCce--eEEecCCccccCCCeEEEEEEeeec-CCcCCCcCCCCCCc
Q 012450          327 FVFCAIVAFRDHH--VRDWSFKFYCEFKIKLKDCDPHV--IQRYLGRVNYVEPDHLLLGYYFFNH-QDLNGCWEYNCVPE  401 (463)
Q Consensus       327 f~~c~v~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~sdh~~l~~~~~~~-~~~~~~~~~~~~~~  401 (463)
                      |++|+|+++....  ...+.++|.|+|.+..|+++...  .+.+.   ....++|+++|...... ......+  .+.++
T Consensus       995 f~~c~v~~~~~~~~~~~~~~~~~~c~~~~~~~~~~~~~~~~~~~~---~~~~~~~l~~~~~~~~~~~~~~~~~--~~~~~ 1069 (1153)
T PLN03210        995 FRACAVVDSESFFIISVSFDIQVCCRFIDRLGNHFDSPYQPHVFS---VTKKGSHLVIFDCCFPLNEDNAPLA--ELNYD 1069 (1153)
T ss_pred             eEEEEEEecCccccCCCceeEEEEEEEECCCCCccccCCCceeEe---eeccccceEEecccccccccccchh--ccCCc
Confidence            9999999876632  23567889999999888765410  01110   12346677666541000 0000011  24567


Q ss_pred             eEEEEEEEecCccccccCceeEEeeccEEEEecCCC
Q 012450          402 AVQFYFKKVLGSETETLDCCGVKKCGIHLFHASDSM  437 (463)
Q Consensus       402 ~~~~~f~~~~~~~~~~~~~~~vk~cGv~li~~~~~~  437 (463)
                      +++++|...+..     ..++||+|||+++|+.+..
T Consensus      1070 ~~~~~f~~~~~~-----~~~~~~~cg~~~~~~~~~~ 1100 (1153)
T PLN03210       1070 HVDIQFRLTNKN-----SQLKLKGCGIRLSEDDSSL 1100 (1153)
T ss_pred             eeeEEEEEecCC-----CCeEEEeeeEEEeccCCCc
Confidence            888888866543     1379999999999966544



syringae 6; Provisional

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query463
4fcg_A328 Structure Of The Leucine-Rich Repeat Domain Of The 1e-04
>pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328 Back     alignment and structure

Iteration: 1

Score = 44.3 bits (103), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 38/152 (25%), Positives = 61/152 (40%), Gaps = 33/152 (21%) Query: 41 CSKLKSLPEISSA-GNIEKILLDGTAIEELPSSIGCLSRLLELNLGDCKNL--------- 90 + L LP+ +E + L + LP+SI L+RL EL++ C L Sbjct: 113 AAGLXELPDTXQQFAGLETLTLARNPLRALPASIASLNRLRELSIRACPELTELPEPLAS 172 Query: 91 -----------------------KTLPSSLCKLKSLEEICLTGSAIEELPSPIECLSALC 127 ++LP+S+ L++L+ + + S + L I L L Sbjct: 173 TDASGEHQGLVNLQSLRLEWTGIRSLPASIANLQNLKSLKIRNSPLSALGPAIHHLPKLE 232 Query: 128 VLDLGDCKSLKSLKLPFDGLYSLTYLYLTDCA 159 LDL C +L++ F G L L L DC+ Sbjct: 233 ELDLRGCTALRNYPPIFGGRAPLKRLILKDCS 264

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query463
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-43
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-41
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-35
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-30
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-34
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-33
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-21
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-05
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-29
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-24
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-23
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-19
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-14
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-27
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-23
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 4e-16
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-14
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 8e-05
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 7e-24
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-23
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 6e-23
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 6e-23
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-17
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-14
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-13
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 8e-04
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-23
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-21
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-11
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-05
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-05
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-22
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 8e-19
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 4e-11
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 5e-10
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-22
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-21
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-15
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-10
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-21
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-20
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-16
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-21
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-19
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-14
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-13
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-20
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-15
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-15
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 5e-11
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-20
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-17
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-15
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-19
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-14
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-14
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-13
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-19
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-18
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 7e-18
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-17
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-13
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-08
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-19
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-17
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-16
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 8e-12
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 6e-19
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 8e-18
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-13
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 7e-12
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 7e-11
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 8e-11
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 7e-10
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-19
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-17
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-15
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-14
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-13
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-06
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-18
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-14
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 9e-09
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-18
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 8e-13
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-08
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-18
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-17
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 9e-11
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-18
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-17
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 7e-13
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 8e-18
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-17
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-15
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 4e-11
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-17
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-15
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-11
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-17
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 9e-15
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-08
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-17
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-11
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 5e-04
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-17
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 6e-13
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-06
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-17
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-14
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-14
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-12
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-12
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 5e-17
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-11
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-04
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-17
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-16
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-14
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-14
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-14
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-06
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-16
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-13
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-16
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-16
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-16
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-16
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-12
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-12
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-12
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-16
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-12
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 8e-16
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-08
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-14
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-12
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-10
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-10
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-07
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-06
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-14
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 9e-13
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 8e-05
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-14
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-12
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-05
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 7e-14
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 8e-11
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-10
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-09
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-08
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 9e-14
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-09
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 7e-09
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 8e-05
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-13
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-13
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 8e-12
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-13
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-12
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-13
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 7e-10
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-12
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-07
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-04
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 7e-04
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-12
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-09
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-08
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-05
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 9e-11
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 7e-08
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-05
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-04
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 6e-10
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 8e-09
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-05
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-09
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-06
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-09
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-08
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 2e-08
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 4e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-08
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-08
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-08
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-08
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-08
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 4e-08
3m19_A251 Variable lymphocyte receptor A diversity region; a 4e-08
3m19_A251 Variable lymphocyte receptor A diversity region; a 3e-05
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-07
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 8e-07
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 6e-06
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 3e-05
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 1e-04
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 1e-06
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-06
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-04
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 4e-04
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 4e-04
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-05
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-05
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 8e-04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-05
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 7e-05
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 1e-04
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 2e-04
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-04
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 4e-04
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
 Score =  155 bits (393), Expect = 2e-43
 Identities = 58/206 (28%), Positives = 86/206 (41%), Gaps = 14/206 (6%)

Query: 24  PSLIQHLNKLVILNLSGCSKLKSLP-EISSAGNIEKILLDGTAIEELPSSIGCLSRLLEL 82
           P     L+ L  + +     L  LP  +     +E + L    +  LP+SI  L+RL EL
Sbjct: 97  PDQAFRLSHLQHMTIDAA-GLMELPDTMQQFAGLETLTLARNPLRALPASIASLNRLREL 155

Query: 83  NLGDCKNLKTLPSSLCK---------LKSLEEICLTGSAIEELPSPIECLSALCVLDLGD 133
           ++  C  L  LP  L           L +L+ + L  + I  LP+ I  L  L  L + +
Sbjct: 156 SIRACPELTELPEPLASTDASGEHQGLVNLQSLRLEWTGIRSLPASIANLQNLKSLKIRN 215

Query: 134 CKSLKSLKLPFDGLYSLTYLYLTDC-AITELPESLGLLSSLEELYL-ERNNFERIPESII 191
              L +L      L  L  L L  C A+   P   G  + L+ L L + +N   +P  I 
Sbjct: 216 SP-LSALGPAIHHLPKLEELDLRGCTALRNYPPIFGGRAPLKRLILKDCSNLLTLPLDIH 274

Query: 192 RLSKLSSLLVSYCERLQSLPKLPCNL 217
           RL++L  L +  C  L  LP L   L
Sbjct: 275 RLTQLEKLDLRGCVNLSRLPSLIAQL 300


>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query463
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.93
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.9
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.89
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.89
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.89
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.89
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.88
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.88
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.88
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.87
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.87
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.87
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.86
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.86
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.86
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.86
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.86
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.86
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.86
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.86
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.86
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.86
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.85
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.85
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.85
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.85
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.85
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.85
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.85
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.85
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.84
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.84
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.84
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.84
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.84
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.84
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.84
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.84
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.84
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.84
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.83
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.83
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.83
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.83
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.83
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.83
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.83
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.83
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.82
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.82
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.82
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.82
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.82
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.82
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.82
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.82
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.81
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.81
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.81
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.81
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.81
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.8
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.8
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.8
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.8
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.79
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.79
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.79
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.79
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 99.79
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.79
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.79
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.78
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.78
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.77
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.77
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.77
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.76
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.76
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.75
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.75
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.75
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.75
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.74
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.74
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.74
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.73
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.73
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.73
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.72
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.72
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.71
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.7
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.69
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.69
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.68
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.67
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.66
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.65
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.65
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.65
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.64
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.62
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.62
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.61
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.6
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.59
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.59
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.58
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.58
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.58
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.57
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.56
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.56
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.55
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.54
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.54
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.51
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.5
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.45
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.45
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.44
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.44
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.43
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.42
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.41
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.41
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.4
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.39
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.36
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.36
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.31
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.29
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.25
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.24
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.12
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.12
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.11
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.11
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.09
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.93
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.83
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.83
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.82
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.81
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.8
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.68
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.61
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.19
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.12
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.06
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.02
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.97
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.93
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.92
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.84
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.39
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.37
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.36
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 96.63
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 95.87
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 95.37
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 95.06
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 93.07
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
Probab=99.93  E-value=1.7e-25  Score=220.66  Aligned_cols=206  Identities=27%  Similarity=0.408  Sum_probs=184.1

Q ss_pred             CCCcceeecccccCcCCCCCcccccCCcCccEEeeecCCCCCCCCC-CCCCCCccEEEeeccCCCccCccccCCCCccEE
Q 012450            4 HGKLNQIIMAACNIFTKTPNPSLIQHLNKLVILNLSGCSKLKSLPE-ISSAGNIEKILLDGTAIEELPSSIGCLSRLLEL   82 (463)
Q Consensus         4 ~~~L~~L~L~~c~~l~~~~~~~~~~~l~~L~~L~L~~c~~l~~lp~-l~~l~~L~~L~L~~~~i~~lp~~i~~l~~L~~L   82 (463)
                      .++++.|+|++ +.++.+  |..+.++++|++|+|++|. +..+|. ++.+++|++|++++|.++.+|..++.+++|++|
T Consensus        80 ~~~l~~L~L~~-n~l~~l--p~~l~~l~~L~~L~L~~n~-l~~lp~~~~~l~~L~~L~Ls~n~l~~lp~~l~~l~~L~~L  155 (328)
T 4fcg_A           80 QPGRVALELRS-VPLPQF--PDQAFRLSHLQHMTIDAAG-LMELPDTMQQFAGLETLTLARNPLRALPASIASLNRLREL  155 (328)
T ss_dssp             STTCCEEEEES-SCCSSC--CSCGGGGTTCSEEEEESSC-CCCCCSCGGGGTTCSEEEEESCCCCCCCGGGGGCTTCCEE
T ss_pred             ccceeEEEccC-CCchhc--ChhhhhCCCCCEEECCCCC-ccchhHHHhccCCCCEEECCCCccccCcHHHhcCcCCCEE
Confidence            47899999999 567788  7788899999999999964 558887 899999999999999999999999999999999


Q ss_pred             eeecCCCCCccchhcCC---------CCCCcEEEEECCCCccCCccCCCCCCccEEecCCCCCCCcCcccCCCCCCccEE
Q 012450           83 NLGDCKNLKTLPSSLCK---------LKSLEEICLTGSAIEELPSPIECLSALCVLDLGDCKSLKSLKLPFDGLYSLTYL  153 (463)
Q Consensus        83 ~l~~c~~l~~lp~~l~~---------l~~L~~L~l~~~~i~~lp~~i~~l~~L~~L~l~~c~~l~~l~~~l~~l~~L~~L  153 (463)
                      ++++|..++.+|..+..         +++|++|++++|.++.+|..++.+++|++|++++|. ++.+|..+..+++|+.|
T Consensus       156 ~L~~n~~~~~~p~~~~~~~~~~~~~~l~~L~~L~L~~n~l~~lp~~l~~l~~L~~L~L~~N~-l~~l~~~l~~l~~L~~L  234 (328)
T 4fcg_A          156 SIRACPELTELPEPLASTDASGEHQGLVNLQSLRLEWTGIRSLPASIANLQNLKSLKIRNSP-LSALGPAIHHLPKLEEL  234 (328)
T ss_dssp             EEEEETTCCCCCSCSEEEC-CCCEEESTTCCEEEEEEECCCCCCGGGGGCTTCCEEEEESSC-CCCCCGGGGGCTTCCEE
T ss_pred             ECCCCCCccccChhHhhccchhhhccCCCCCEEECcCCCcCcchHhhcCCCCCCEEEccCCC-CCcCchhhccCCCCCEE
Confidence            99999999999887654         999999999999999999999999999999999987 55677778999999999


Q ss_pred             EeeCCCCCC-cccccCCcccccccccccccc-cccchhhhCCCCccEeccccccccccCCCCC
Q 012450          154 YLTDCAITE-LPESLGLLSSLEELYLERNNF-ERIPESIIRLSKLSSLLVSYCERLQSLPKLP  214 (463)
Q Consensus       154 ~L~~~~l~~-~p~~l~~l~~L~~L~Ls~n~l-~~lp~~l~~l~~L~~L~L~~c~~l~~l~~l~  214 (463)
                      ++++|.+.+ +|..++.+++|+.|+|++|++ ..+|..+.++++|+.|+|++|..++.+|...
T Consensus       235 ~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~~~~~~p~~~~~l~~L~~L~L~~n~~~~~iP~~l  297 (328)
T 4fcg_A          235 DLRGCTALRNYPPIFGGRAPLKRLILKDCSNLLTLPLDIHRLTQLEKLDLRGCVNLSRLPSLI  297 (328)
T ss_dssp             ECTTCTTCCBCCCCTTCCCCCCEEECTTCTTCCBCCTTGGGCTTCCEEECTTCTTCCCCCGGG
T ss_pred             ECcCCcchhhhHHHhcCCCCCCEEECCCCCchhhcchhhhcCCCCCEEeCCCCCchhhccHHH
Confidence            999998776 888899999999999999876 5788889999999999999999988888643



>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 463
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-10
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 7e-09
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-08
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-04
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-09
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 9e-05
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 7e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 8e-06
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 2e-04
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 6e-04
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 0.002
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 0.002
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.003
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
 Score = 59.6 bits (143), Expect = 2e-10
 Identities = 39/176 (22%), Positives = 73/176 (41%), Gaps = 9/176 (5%)

Query: 28  QHLNKLVILNLSGCSKLKSLPEISSAGNIEKILLDGTAIEELPSSIGCLSRLLELNLGDC 87
             L  L  L+L+G  +LK +  ++S  N+  + L    I  L   +  L++L EL LG  
Sbjct: 216 GILTNLDELSLNGN-QLKDIGTLASLTNLTDLDLANNQISNLAP-LSGLTKLTELKLGAN 273

Query: 88  KNLKTLPSSLCKLKSLEEICLTGSAIEELPSPIECLSALCVLDLGDCKSLKSLKLPFDGL 147
           +     P +     +  E+        E  SPI  L  L  L L     +  +  P   L
Sbjct: 274 QISNISPLAGLTALTNLELNEN---QLEDISPISNLKNLTYLTLYFNN-ISDI-SPVSSL 328

Query: 148 YSLTYLYLTDCAITELPESLGLLSSLEELYLERNNFERIPESIIRLSKLSSLLVSY 203
             L  L+  +  ++++  SL  L+++  L    N    +   +  L++++ L ++ 
Sbjct: 329 TKLQRLFFANNKVSDVS-SLANLTNINWLSAGHNQISDLTP-LANLTRITQLGLND 382


>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query463
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.84
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.8
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.8
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.78
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.77
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.75
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.74
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.74
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.71
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.7
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.7
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.7
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.69
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.68
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.68
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.68
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.66
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.65
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.64
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.48
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.46
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.45
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.43
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.4
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.38
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.37
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.35
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.34
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.25
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.15
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.03
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.02
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.0
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.93
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.9
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.28
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.54
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.33
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.25
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.9
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.52
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.41
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=99.84  E-value=1.5e-21  Score=188.39  Aligned_cols=224  Identities=20%  Similarity=0.276  Sum_probs=178.4

Q ss_pred             CcceeecccccCcCCCCCcccccCCcCccEEeeecCCCC-CCCCC-CCCCCCccEEEeeccCCCcc-CccccCCCCccEE
Q 012450            6 KLNQIIMAACNIFTKTPNPSLIQHLNKLVILNLSGCSKL-KSLPE-ISSAGNIEKILLDGTAIEEL-PSSIGCLSRLLEL   82 (463)
Q Consensus         6 ~L~~L~L~~c~~l~~~~~~~~~~~l~~L~~L~L~~c~~l-~~lp~-l~~l~~L~~L~L~~~~i~~l-p~~i~~l~~L~~L   82 (463)
                      +++.|+|+++..-...+.|..++++++|++|+|++|+.+ +.+|. ++++++|++|+|++|++..+ +..+..+.+|+.+
T Consensus        51 ~v~~L~L~~~~l~g~~~lp~~l~~L~~L~~L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l  130 (313)
T d1ogqa_          51 RVNNLDLSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTL  130 (313)
T ss_dssp             CEEEEEEECCCCSSCEECCGGGGGCTTCSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEE
T ss_pred             EEEEEECCCCCCCCCCCCChHHhcCccccccccccccccccccccccccccccchhhhccccccccccccccchhhhccc
Confidence            689999999654443223789999999999999986555 48887 99999999999999999865 4457889999999


Q ss_pred             eeecCCCCCccchhcCCCCCCcEEEEECCCCc-cCCccCCCCCCc-cEEecCCCCC-----------------------C
Q 012450           83 NLGDCKNLKTLPSSLCKLKSLEEICLTGSAIE-ELPSPIECLSAL-CVLDLGDCKS-----------------------L  137 (463)
Q Consensus        83 ~l~~c~~l~~lp~~l~~l~~L~~L~l~~~~i~-~lp~~i~~l~~L-~~L~l~~c~~-----------------------l  137 (463)
                      ++++|.....+|..+.++++|+.+++++|.+. .+|..+..+..+ +.+++++|..                       .
T Consensus       131 ~l~~N~~~~~~p~~l~~l~~L~~l~l~~n~l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~~~~~l~~~~l~l~~~~~~  210 (313)
T d1ogqa_         131 DFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLNLAFVDLSRNMLE  210 (313)
T ss_dssp             ECCSSEEESCCCGGGGGCTTCCEEECCSSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGCCCSEEECCSSEEE
T ss_pred             ccccccccccCchhhccCcccceeeccccccccccccccccccccccccccccccccccccccccccccccccccccccc
Confidence            99998888888999999999999999999887 677777777665 6666665532                       1


Q ss_pred             CcCcccCCCCCCccEEEeeCCCCCCcccccCCccccccccccccccc-ccchhhhCCCCccEeccccccccccCCCCC--
Q 012450          138 KSLKLPFDGLYSLTYLYLTDCAITELPESLGLLSSLEELYLERNNFE-RIPESIIRLSKLSSLLVSYCERLQSLPKLP--  214 (463)
Q Consensus       138 ~~l~~~l~~l~~L~~L~L~~~~l~~~p~~l~~l~~L~~L~Ls~n~l~-~lp~~l~~l~~L~~L~L~~c~~l~~l~~l~--  214 (463)
                      ..+|..+..+++|+.|+++++.+...+..++.+++|+.|+|++|+++ .+|..+.++++|++|+|++|..-..+|...  
T Consensus       211 ~~~~~~~~~~~~l~~l~~~~~~l~~~~~~~~~~~~L~~L~Ls~N~l~g~iP~~l~~L~~L~~L~Ls~N~l~g~iP~~~~L  290 (313)
T d1ogqa_         211 GDASVLFGSDKNTQKIHLAKNSLAFDLGKVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQGGNL  290 (313)
T ss_dssp             ECCGGGCCTTSCCSEEECCSSEECCBGGGCCCCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEEEECCCSTTG
T ss_pred             ccccccccccccccccccccccccccccccccccccccccCccCeecccCChHHhCCCCCCEEECcCCcccccCCCcccC
Confidence            12344556778899999999988876667888999999999999998 799999999999999999997655777642  


Q ss_pred             CCccEeeccCccccc
Q 012450          215 CNLYWLDAQHCTTLE  229 (463)
Q Consensus       215 ~~L~~L~i~~c~~L~  229 (463)
                      .+|+.+++.+.+.|.
T Consensus       291 ~~L~~l~l~~N~~l~  305 (313)
T d1ogqa_         291 QRFDVSAYANNKCLC  305 (313)
T ss_dssp             GGSCGGGTCSSSEEE
T ss_pred             CCCCHHHhCCCcccc
Confidence            456666666655444



>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure