Citrus Sinensis ID: 012553

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-
MESTMKEMRDGASVLDFDSKSTVEGGVEDVYGEDRATEDQLVTPWTISVASGYCLLRDPRHNKGLAFTEKERDAHYLRGLLPPAVISQQLQEKKLMNSIRQYEVPLQKYVAMMELEERNERLFYKLLIDNVEELLPVVYTPTVGEACQKYGSIFRRPQGLYISLKEKGKILEVLKNWPERSIQVIVVTDGERILGLGDLGCQGMGIPVGKLALYTALGGIRPSACLPITVDVGTNNEQLLKDEFYIGLRQRRATGQEYAELLDEFMSAVKQNYGEKVLIQFEDFANHNAFELLAKYGTTHLVFNDDIQGTASVVLAGVVAALKLIGGTLAEHRFLFLGAGEAGTGIAELIALEISKQTKAPVEETRKKICLVDSKGLIVSSRKDSLQHFKKPWAHEHEPVNNLLDAVKVIKPTILIGSSGVGRTFTKEVIEAMASFNEVVFQALLWLIRKFNFCSLFKRMF
cHHHHHHHHccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccHHHHHHcccccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHcHHccccccccccHHHHHHHHccccccccEEEEEccccccHHHHHHccccccEEEEEEEcccEEEccccccccccccccHHHHHHHHcccccccccccEEEEcccccHHccccccccccccccccHHHHHHHHHHHHHHHHHHcccccEEEcccccccHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHcccccccEEEEccccHHHHHHHHHHHHHHHHHccccHHHHHccEEEEccccccccccccccccccccccccccccccHHHHHHHccccEEEEcccccccccHHHHHHHHHcccEEEEEEccccccEEEEEcccccc
cccHHHHHcccccHccccccccccccccccccccccccccccccEEEEcccccHHHHccccccHHHccHHHHHHcccccccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHcccHHHHHHHHHHcHHHHHHHHcccHHHHHHHcHHHHccccccEEEEHHHcccHHHHHcccccccccEEEEEccccEcccEccHHHHHHHHHHHHHHHHHHHcccHHHEEEEEEEcccccHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHccccEEEEccccHHHHHHHHHHHcccccEEEccccHHHHHHHHHHHHHHHHHccccccccEEEEcccHHHHHHHHHHHHHHHcccccHHHHHHcHEEEEccccEEEcccccccHHHHHHHHcccccHHHHHHHHHHHcccEEEEcccccccccHHHHHHHHHHccHHHHHHHHHHHHHcHHHHHHHHc
mestmkemrdgasvldfdskstveggvedvygedratedqlvtpwtisvasgycllrdprhnkglaftekeRDAHylrgllppaviSQQLQEKKLMNSIRQYEVPLQKYVAMMELEERNERLFYKLLIDNVEEllpvvytptvgeACQKYgsifrrpqglyisLKEKGKILEVLKNWPERSIQVIVVTdgerilglgdlgcqgmgipvGKLALYTAlggirpsaclpitvdvgtnneqllkDEFYIGLRQRRATGQEYAELLDEFMSAVKQNYGEKVLIQFEDFANHNAFELLAKYGtthlvfnddiqgTASVVLAGVVAALKLIGGTLAEHRFLFLGAGEAGTGIAELIALEISkqtkapveETRKKIclvdskglivsSRKDSlqhfkkpwahehepvnnlldavkvikptiligssgvgrtFTKEVIEAMASFNEVVFQALLWLIRKFNFCSLFKRMF
mestmkemrdgasvldfdskstveggvedvygedratedqlvtpwTISVASGYCLLRDPRHNKGLAFTEKERDAHYLRGLLPPAVISQQLQEKKLMNSIRQYEVPLQKYVAMMELEERNERLFYKLLIDNVEELLPVVYTPTVGEACQKYGSIFRRPQGLYISLKEKGKILEVlknwpersiQVIVVTDGERILGLGDLGCQGMGIPVGKLALYTALGGIRPSACLPITVDVGTNNEQLLKDEFYIGLRQRRATGQEYAELLDEFMSAVKQNYGEKVLIQFEDFANHNAFELLAKYGTTHLVFNDDIQGTASVVLAGVVAALKLIGGTLAEHRFLFLGAGEAGTGIAELIALEIskqtkapveetrkkiclvdskglivSSRKDSLQHFKKPWAHEHEPVNNLLDAVKVIKPtiligssgvgRTFTKEVIEAMASFNEVVFQALLWLIRKFNFCSLFKRMF
MESTMKEMRDGASVLDFDSKSTVEGGVEDVYGEDRATEDQLVTPWTISVASGYCLLRDPRHNKGLAFTEKERDAHYLRGLLPPAVISQQLQEKKLMNSIRQYEVPLQKYVAMMELEERNERLFYKLLIDNVEELLPVVYTPTVGEACQKYGSIFRRPQGLYISLKEKGKILEVLKNWPERSIQVIVVTDGERILGLGDLGCQGMGIPVGKLALYTALGGIRPSACLPITVDVGTNNEQLLKDEFYIGLRQRRATGQEYAELLDEFMSAVKQNYGEKVLIQFEDFANHNAFELLAKYGTTHLVFNDDIQgtasvvlagvvaalkliggTLAEHRFLFLGAGEAGTGIAELIALEISKQTKAPVEETRKKICLVDSKGLIVSSRKDSLQHFKKPWAHEHEPVNNLLDAVKVIKPTILIGSSGVGRTFTKEVIEAMASFNEVVFQALLWLIRKFNFCSLFKRMF
****************************DVYGEDRATEDQLVTPWTISVASGYCLLRDPRHNKGLAFTEKERDAHYLRGLLPPAVISQQLQEKKLMNSIRQYEVPLQKYVAMMELEERNERLFYKLLIDNVEELLPVVYTPTVGEACQKYGSIFRRPQGLYISLKEKGKILEVLKNWPERSIQVIVVTDGERILGLGDLGCQGMGIPVGKLALYTALGGIRPSACLPITVDVGTNNEQLLKDEFYIGLRQRRATGQEYAELLDEFMSAVKQNYGEKVLIQFEDFANHNAFELLAKYGTTHLVFNDDIQGTASVVLAGVVAALKLIGGTLAEHRFLFLGAGEAGTGIAELIALEISKQTKAPVEETRKKICLVDSKGLIVSSRKDSLQHFKKPWAHEHEPVNNLLDAVKVIKPTILIGSSGVGRTFTKEVIEAMASFNEVVFQALLWLIRKFNFCSLFK***
***************************************QLVTPWTISVASGYCLLRDPRHNKGLAFTEKERDAHYLRGLLPPAVISQQLQEKKLMNSIRQYEVPLQKYVAMMELEERNERLFYKLLIDNVEELLPVVYTPTVGEACQKYGSIFRRPQGLYISLKEKGKILEVLKNWPERSIQVIVVTDGERILGLGDLGCQGMGIPVGKLALYTALGGIRPSACLPITVDVGTNNEQLLKDEFYIGLRQRRATGQEYAELLDEFMSAVKQNYGEKVLIQFEDFANHNAFELLAKYGTTHLVFNDDIQGTASVVLAGVVAALKLIGGTLAEHRFLFLGAGEAGTGIAELIALEISKQTKAPVEETRKKICLVDSKGLIVSSRKDSLQHFKKPWAHEHEPVNNLLDAVKVIKPTILIGSSGVGRTFTKEVIEAMASFNEVVFQALLWLIRKFNFCSLFKRMF
***********ASVLDFDSKSTVEGGVEDVYGEDRATEDQLVTPWTISVASGYCLLRDPRHNKGLAFTEKERDAHYLRGLLPPAVISQQLQEKKLMNSIRQYEVPLQKYVAMMELEERNERLFYKLLIDNVEELLPVVYTPTVGEACQKYGSIFRRPQGLYISLKEKGKILEVLKNWPERSIQVIVVTDGERILGLGDLGCQGMGIPVGKLALYTALGGIRPSACLPITVDVGTNNEQLLKDEFYIGLRQRRATGQEYAELLDEFMSAVKQNYGEKVLIQFEDFANHNAFELLAKYGTTHLVFNDDIQGTASVVLAGVVAALKLIGGTLAEHRFLFLGAGEAGTGIAELIALEISKQTKAPVEETRKKICLVDSKGLIVSSRKDSLQHFKKPWAHEHEPVNNLLDAVKVIKPTILIGSSGVGRTFTKEVIEAMASFNEVVFQALLWLIRKFNFCSLFKRMF
*************************G*****GEDRATEDQLVTPWTISVASGYCLLRDPRHNKGLAFTEKERDAHYLRGLLPPAVISQQLQEKKLMNSIRQYEVPLQKYVAMMELEERNERLFYKLLIDNVEELLPVVYTPTVGEACQKYGSIFRRPQGLYISLKEKGKILEVLKNWPERSIQVIVVTDGERILGLGDLGCQGMGIPVGKLALYTALGGIRPSACLPITVDVGTNNEQLLKDEFYIGLRQRRATGQEYAELLDEFMSAVKQNYGEKVLIQFEDFANHNAFELLAKYGTTHLVFNDDIQGTASVVLAGVVAALKLIGGTLAEHRFLFLGAGEAGTGIAELIALEISKQTKAPVEETRKKICLVDSKGLIVSSRKDSLQHFKKPWAHEHEPVNNLLDAVKVIKPTILIGSSGVGRTFTKEVIEAMASFNEVVFQALLWLIRKFNFCSLFKRMF
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MESTMKEMRDGASVLDFDSKSTVEGGVEDVYGEDRATEDQLVTPWTISVASGYCLLRDPRHNKGLAFTEKERDAHYLRGLLPPAVISQQLQEKKLMNSIRQYEVPLQKYVAMMELEERNERLFYKLLIDNVEELLPVVYTPTVGEACQKYGSIFRRPQGLYISLKEKGKILEVLKNWPERSIQVIVVTDGERILGLGDLGCQGMGIPVGKLALYTALGGIRPSACLPITVDVGTNNEQLLKDEFYIGLRQRRATGQEYAELLDEFMSAVKQNYGEKVLIQFEDFANHNAFELLAKYGTTHLVFNDDIQGTASVVLAGVVAALKLIGGTLAEHRFLFLGAGEAGTGIAELIALEISKQTKAPVEETRKKICLVDSKGLIVSSRKDSLQHFKKPWAHEHEPVNNLLDAVKVIKPTILIGSSGVGRTFTKEVIEAMASFNEVVFQALLWLIRKFNFCSLFKRMF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query461 2.2.26 [Sep-21-2011]
P34105 591 NADP-dependent malic enzy yes no 0.950 0.741 0.881 0.0
P51615 591 NADP-dependent malic enzy yes no 0.950 0.741 0.872 0.0
P36444 647 NADP-dependent malic enzy N/A no 0.921 0.656 0.824 0.0
P12628 589 NADP-dependent malic enzy N/A no 0.898 0.702 0.845 0.0
Q9CA83 646 NADP-dependent malic enzy yes no 0.924 0.659 0.802 0.0
O82191 581 NADP-dependent malic enzy no no 0.921 0.731 0.823 0.0
P43279 639 NADP-dependent malic enzy no no 0.893 0.644 0.828 0.0
Q9LYG3 588 NADP-dependent malic enzy no no 0.913 0.715 0.812 0.0
P37222 573 NADP-dependent malic enzy N/A no 0.906 0.729 0.809 0.0
P22178 648 NADP-dependent malic enzy N/A no 0.906 0.645 0.797 0.0
>sp|P34105|MAOX_POPTR NADP-dependent malic enzyme OS=Populus trichocarpa PE=2 SV=3 Back     alignment and function desciption
 Score =  817 bits (2110), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/438 (88%), Positives = 420/438 (95%)

Query: 1   MESTMKEMRDGASVLDFDSKSTVEGGVEDVYGEDRATEDQLVTPWTISVASGYCLLRDPR 60
           MEST+KEMRDGASVLD D KSTV GGVEDVYGEDRATEDQLVTPWTISVASGY LLRDP 
Sbjct: 1   MESTLKEMRDGASVLDMDPKSTVGGGVEDVYGEDRATEDQLVTPWTISVASGYTLLRDPH 60

Query: 61  HNKGLAFTEKERDAHYLRGLLPPAVISQQLQEKKLMNSIRQYEVPLQKYVAMMELEERNE 120
           HNKGLAFTEKERDAHYLRGLLPP  ISQQLQEKKLMN+IRQY++PLQKY AMMELEERNE
Sbjct: 61  HNKGLAFTEKERDAHYLRGLLPPTTISQQLQEKKLMNTIRQYQLPLQKYTAMMELEERNE 120

Query: 121 RLFYKLLIDNVEELLPVVYTPTVGEACQKYGSIFRRPQGLYISLKEKGKILEVLKNWPER 180
           RLFYKLLIDNVEELLPVVYTPTVGEACQKYGSIF+RPQGLYISLKEKGK+L+VLKNWP++
Sbjct: 121 RLFYKLLIDNVEELLPVVYTPTVGEACQKYGSIFKRPQGLYISLKEKGKVLDVLKNWPQK 180

Query: 181 SIQVIVVTDGERILGLGDLGCQGMGIPVGKLALYTALGGIRPSACLPITVDVGTNNEQLL 240
           SIQVIVVTDGERILGLGDLGCQG+GIPVGKL+LYTALGG+RPSACLP+T+DVGTNNEQLL
Sbjct: 181 SIQVIVVTDGERILGLGDLGCQGIGIPVGKLSLYTALGGVRPSACLPVTIDVGTNNEQLL 240

Query: 241 KDEFYIGLRQRRATGQEYAELLDEFMSAVKQNYGEKVLIQFEDFANHNAFELLAKYGTTH 300
           KDEFYIGLRQRRATGQEY+ELL EFM+AVKQNYGEKVLIQFEDFANHNAF+LLAKYGTTH
Sbjct: 241 KDEFYIGLRQRRATGQEYSELLHEFMTAVKQNYGEKVLIQFEDFANHNAFDLLAKYGTTH 300

Query: 301 LVFNDDIQGTASVVLAGVVAALKLIGGTLAEHRFLFLGAGEAGTGIAELIALEISKQTKA 360
           LVFNDDIQGTA+VVLAG+++ALKL+GG+LA+H FLFLGAGEAGTGIAELIALE+S+++K 
Sbjct: 301 LVFNDDIQGTAAVVLAGLISALKLLGGSLADHTFLFLGAGEAGTGIAELIALEMSRRSKT 360

Query: 361 PVEETRKKICLVDSKGLIVSSRKDSLQHFKKPWAHEHEPVNNLLDAVKVIKPTILIGSSG 420
           P+EETRKKI L DSKGLIVSSRK+SLQHFKKPWAHEHEPV  LL+ VK IKP +LIG+SG
Sbjct: 361 PLEETRKKIWLTDSKGLIVSSRKESLQHFKKPWAHEHEPVKGLLEVVKAIKPIVLIGTSG 420

Query: 421 VGRTFTKEVIEAMASFNE 438
           VG+TFTKEVIEAMASFNE
Sbjct: 421 VGKTFTKEVIEAMASFNE 438

Populus trichocarpa (taxid: 3694)
EC: 1EC: .EC: 1EC: .EC: 1EC: .EC: 4EC: 0
>sp|P51615|MAOX_VITVI NADP-dependent malic enzyme OS=Vitis vinifera PE=2 SV=1 Back     alignment and function description
>sp|P36444|MAOC_FLAPR NADP-dependent malic enzyme, chloroplastic OS=Flaveria pringlei GN=MODA PE=2 SV=1 Back     alignment and function description
>sp|P12628|MAOX_PHAVU NADP-dependent malic enzyme OS=Phaseolus vulgaris GN=ME1 PE=2 SV=1 Back     alignment and function description
>sp|Q9CA83|MAOP4_ARATH NADP-dependent malic enzyme 4, chloroplastic OS=Arabidopsis thaliana GN=NADP-ME4 PE=1 SV=1 Back     alignment and function description
>sp|O82191|MAOP1_ARATH NADP-dependent malic enzyme 1 OS=Arabidopsis thaliana GN=NADP-ME1 PE=1 SV=1 Back     alignment and function description
>sp|P43279|MAOC_ORYSJ NADP-dependent malic enzyme, chloroplastic OS=Oryza sativa subsp. japonica GN=ME6 PE=2 SV=2 Back     alignment and function description
>sp|Q9LYG3|MAOP2_ARATH NADP-dependent malic enzyme 2 OS=Arabidopsis thaliana GN=NADP-ME2 PE=1 SV=1 Back     alignment and function description
>sp|P37222|MAOC_SOLLC NADP-dependent malic enzyme, chloroplastic (Fragment) OS=Solanum lycopersicum PE=2 SV=1 Back     alignment and function description
>sp|P22178|MAOC_FLATR NADP-dependent malic enzyme, chloroplastic OS=Flaveria trinervia GN=MOD1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query461
255546341 591 malic enzyme, putative [Ricinus communis 0.950 0.741 0.904 0.0
356513167 633 PREDICTED: NADP-dependent malic enzyme-l 0.950 0.691 0.894 0.0
224142207 591 predicted protein [Populus trichocarpa] 0.950 0.741 0.883 0.0
228412 589 malic enzyme 0.950 0.743 0.883 0.0
1346485 591 RecName: Full=NADP-dependent malic enzym 0.950 0.741 0.881 0.0
449435772 591 PREDICTED: NADP-dependent malic enzyme-l 0.950 0.741 0.878 0.0
225445108 591 PREDICTED: NADP-dependent malic enzyme [ 0.950 0.741 0.876 0.0
1708924 591 RecName: Full=NADP-dependent malic enzym 0.950 0.741 0.872 0.0
356495891 591 PREDICTED: NADP-dependent malic enzyme-l 0.950 0.741 0.872 0.0
8118507 641 NADP-dependent malic protein [Ricinus co 0.950 0.683 0.853 0.0
>gi|255546341|ref|XP_002514230.1| malic enzyme, putative [Ricinus communis] gi|223546686|gb|EEF48184.1| malic enzyme, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  828 bits (2139), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/438 (90%), Positives = 421/438 (96%)

Query: 1   MESTMKEMRDGASVLDFDSKSTVEGGVEDVYGEDRATEDQLVTPWTISVASGYCLLRDPR 60
           MESTMKEMR GASVLD D KSTV GGVEDVYGED ATEDQLVTPWT SVASGY LLRDPR
Sbjct: 1   MESTMKEMRGGASVLDMDPKSTVGGGVEDVYGEDCATEDQLVTPWTTSVASGYSLLRDPR 60

Query: 61  HNKGLAFTEKERDAHYLRGLLPPAVISQQLQEKKLMNSIRQYEVPLQKYVAMMELEERNE 120
           HNKGLAF+EKERDAHYLRGLLPP V +QQLQEKKLM++IRQY++PLQKY+AMMELEERNE
Sbjct: 61  HNKGLAFSEKERDAHYLRGLLPPVVATQQLQEKKLMHTIRQYQLPLQKYMAMMELEERNE 120

Query: 121 RLFYKLLIDNVEELLPVVYTPTVGEACQKYGSIFRRPQGLYISLKEKGKILEVLKNWPER 180
           RLFYKLLIDNVEELLP+VYTPTVGEACQKYGSIF+RPQGLYISLKEKGKIL+VLKNWPER
Sbjct: 121 RLFYKLLIDNVEELLPIVYTPTVGEACQKYGSIFKRPQGLYISLKEKGKILDVLKNWPER 180

Query: 181 SIQVIVVTDGERILGLGDLGCQGMGIPVGKLALYTALGGIRPSACLPITVDVGTNNEQLL 240
           SIQVIVVTDGERILGLGDLGCQGMGIPVGKLALYTALGG+RPSACLPIT+DVGTNNE+LL
Sbjct: 181 SIQVIVVTDGERILGLGDLGCQGMGIPVGKLALYTALGGVRPSACLPITIDVGTNNEKLL 240

Query: 241 KDEFYIGLRQRRATGQEYAELLDEFMSAVKQNYGEKVLIQFEDFANHNAFELLAKYGTTH 300
            DEFYIGLRQRRATGQEY+ELL EFM+AVKQNYGEKVLIQFEDFANHNAFELLAKYGTTH
Sbjct: 241 NDEFYIGLRQRRATGQEYSELLQEFMTAVKQNYGEKVLIQFEDFANHNAFELLAKYGTTH 300

Query: 301 LVFNDDIQGTASVVLAGVVAALKLIGGTLAEHRFLFLGAGEAGTGIAELIALEISKQTKA 360
           LVFNDDIQGTASVVLAGV+AALKL+GG+L++H FLFLGAGEAGTGIAELIALE+SK+T A
Sbjct: 301 LVFNDDIQGTASVVLAGVIAALKLLGGSLSDHTFLFLGAGEAGTGIAELIALEMSKRTNA 360

Query: 361 PVEETRKKICLVDSKGLIVSSRKDSLQHFKKPWAHEHEPVNNLLDAVKVIKPTILIGSSG 420
           P+EETRKKI LVDSKGLIVSSRKDSLQHFK+PWAHEHEPV NLLDAVK IKPT+LIGSSG
Sbjct: 361 PLEETRKKIWLVDSKGLIVSSRKDSLQHFKQPWAHEHEPVKNLLDAVKAIKPTVLIGSSG 420

Query: 421 VGRTFTKEVIEAMASFNE 438
           VGRTFTKEVIEAMAS NE
Sbjct: 421 VGRTFTKEVIEAMASLNE 438

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356513167|ref|XP_003525285.1| PREDICTED: NADP-dependent malic enzyme-like [Glycine max] Back     alignment and taxonomy information
>gi|224142207|ref|XP_002324450.1| predicted protein [Populus trichocarpa] gi|222865884|gb|EEF03015.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|228412|prf||1803524A malic enzyme Back     alignment and taxonomy information
>gi|1346485|sp|P34105.3|MAOX_POPTR RecName: Full=NADP-dependent malic enzyme; Short=NADP-ME gi|20469|emb|CAA39690.1| malic enzyme [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449435772|ref|XP_004135668.1| PREDICTED: NADP-dependent malic enzyme-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|225445108|ref|XP_002283751.1| PREDICTED: NADP-dependent malic enzyme [Vitis vinifera] gi|297738764|emb|CBI28009.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|1708924|sp|P51615.1|MAOX_VITVI RecName: Full=NADP-dependent malic enzyme; Short=NADP-ME gi|515759|gb|AAA67087.1| malate dehydrogenase (NADP+) [Vitis vinifera] Back     alignment and taxonomy information
>gi|356495891|ref|XP_003516804.1| PREDICTED: NADP-dependent malic enzyme-like [Glycine max] Back     alignment and taxonomy information
>gi|8118507|gb|AAF73006.1|AF262997_1 NADP-dependent malic protein [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query461
TAIR|locus:2052045 581 NADP-ME1 "NADP-malic enzyme 1" 0.921 0.731 0.792 5.4e-182
TAIR|locus:2017854 646 NADP-ME4 "NADP-malic enzyme 4" 0.924 0.659 0.769 7.8e-181
TAIR|locus:2181980 588 NADP-ME2 "NADP-malic enzyme 2" 0.913 0.715 0.781 1.9e-179
TAIR|locus:2180547 588 NADP-ME3 "NADP-malic enzyme 3" 0.911 0.714 0.769 8.3e-177
UNIPROTKB|F1P0Y6 576 ME1 "Malic enzyme" [Gallus gal 0.859 0.687 0.517 1.5e-106
MGI|MGI:97043 572 Me1 "malic enzyme 1, NADP(+)-d 0.841 0.678 0.528 1.4e-105
RGD|3074 572 Me1 "malic enzyme 1, NADP(+)-d 0.841 0.678 0.522 7.5e-105
UNIPROTKB|P13697 572 Me1 "NADP-dependent malic enzy 0.841 0.678 0.522 7.5e-105
ZFIN|ZDB-GENE-040801-147 581 me2 "malic enzyme 2, NAD(+)-de 0.856 0.679 0.501 2e-104
UNIPROTKB|P48163 572 ME1 "NADP-dependent malic enzy 0.841 0.678 0.515 2.3e-103
TAIR|locus:2052045 NADP-ME1 "NADP-malic enzyme 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1766 (626.7 bits), Expect = 5.4e-182, P = 5.4e-182
 Identities = 337/425 (79%), Positives = 377/425 (88%)

Query:    14 VLDFDSKSTVEGGVEDVYGEDRATEDQLVTPWTISVASGYCLLRDPRHNKGLAFTEKERD 73
             V + D KS+V+GGV DVYGED AT +  +TPW++SV+SGY LLRDPR+NKGLAFTEKERD
Sbjct:     4 VTNSDLKSSVDGGVVDVYGEDSATIEHNITPWSLSVSSGYSLLRDPRYNKGLAFTEKERD 63

Query:    74 AHYLRGLLPPAVISQQLQEKKLMNSIRQYEVPLQKYVAMMELEERNERLFYKLLIDNVEE 133
              HYLRGLLPP V+ Q+LQEK+L+N+IRQY+ PLQKY+A+ EL+ERNERLFYKLLIDNVEE
Sbjct:    64 THYLRGLLPPVVLDQKLQEKRLLNNIRQYQFPLQKYMALTELQERNERLFYKLLIDNVEE 123

Query:   134 LLPVVYTPTVGEACQKYGSIFRRPQGLYISLKEKGKILEVLKNWPERSIQVIVVTDGERI 193
             LLP+VYTPTVGEACQK+GSIFRRPQGL+ISLK+KGKIL+VLKNWPER+IQVIVVTDGERI
Sbjct:   124 LLPIVYTPTVGEACQKFGSIFRRPQGLFISLKDKGKILDVLKNWPERNIQVIVVTDGERI 183

Query:   194 LGLGDLGCQGMGIPVGKLALYTALGGIRPSACLPITVDVGTNNEQLLKDEFYIGLRQRRA 253
             LGLGDLGCQGMGIPVGKLALY+ALGG+RPSACLP+T+DVGTNNE+LL DEFYIGLRQ+RA
Sbjct:   184 LGLGDLGCQGMGIPVGKLALYSALGGVRPSACLPVTIDVGTNNEKLLNDEFYIGLRQKRA 243

Query:   254 TGQEYAELLDEFMSAVKQNYGEKVLIQFEDFANHNAFELLAKYGTTHLVFNDDIQXXXXX 313
             TGQEY+ELL+EFMSAVKQNYGEKVLIQFEDFANHNAFELLAKY  THLVFNDDIQ     
Sbjct:   244 TGQEYSELLNEFMSAVKQNYGEKVLIQFEDFANHNAFELLAKYSDTHLVFNDDIQGTASV 303

Query:   314 XXXXXXXXXXXXXXTLAEHRFLFLGAGEAGTGIAELIALEISKQTKAPVEETRKKICLVD 373
                            LAEH FLFLGAGEAGTGIAELIAL +SKQ  A VEE+RKKI LVD
Sbjct:   304 VLAGLVSAQKLTNSPLAEHTFLFLGAGEAGTGIAELIALYMSKQMNASVEESRKKIWLVD 363

Query:   374 SKGLIVSSRKDSLQHFKKPWAHEHEPVNNLLDAVKVIKPTILIGSSGVGRTFTKEVIEAM 433
             SKGLIV+SRKDSLQ FKKPWAHEHEPV +LL A+K IKPT+LIGSSGVGR+FTKEVIEAM
Sbjct:   364 SKGLIVNSRKDSLQDFKKPWAHEHEPVKDLLGAIKAIKPTVLIGSSGVGRSFTKEVIEAM 423

Query:   434 ASFNE 438
             +S NE
Sbjct:   424 SSINE 428
GO:0000166 "nucleotide binding" evidence=IEA
GO:0004470 "malic enzyme activity" evidence=IEA;ISS
GO:0005737 "cytoplasm" evidence=ISM
GO:0006108 "malate metabolic process" evidence=IEA;ISS;IDA
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0016616 "oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor" evidence=IEA
GO:0016619 "malate dehydrogenase (oxaloacetate-decarboxylating) activity" evidence=IEA
GO:0016652 "oxidoreductase activity, acting on NAD(P)H, NAD(P) as acceptor" evidence=ISS
GO:0046872 "metal ion binding" evidence=IEA
GO:0051287 "NAD binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0004473 "malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+) activity" evidence=IDA
GO:0005829 "cytosol" evidence=NAS
GO:0051260 "protein homooligomerization" evidence=IDA
GO:0006094 "gluconeogenesis" evidence=RCA
GO:0007010 "cytoskeleton organization" evidence=RCA
GO:0010498 "proteasomal protein catabolic process" evidence=RCA
TAIR|locus:2017854 NADP-ME4 "NADP-malic enzyme 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2181980 NADP-ME2 "NADP-malic enzyme 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2180547 NADP-ME3 "NADP-malic enzyme 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|F1P0Y6 ME1 "Malic enzyme" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:97043 Me1 "malic enzyme 1, NADP(+)-dependent, cytosolic" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|3074 Me1 "malic enzyme 1, NADP(+)-dependent, cytosolic" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P13697 Me1 "NADP-dependent malic enzyme" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040801-147 me2 "malic enzyme 2, NAD(+)-dependent, mitochondrial" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|P48163 ME1 "NADP-dependent malic enzyme" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P06801MAOX_MOUSE1, ., 1, ., 1, ., 4, 00.55810.83510.6730yesno
P13697MAOX_RAT1, ., 1, ., 1, ., 4, 00.55290.83510.6730yesno
Q29558MAOX_PIG1, ., 1, ., 1, ., 4, 00.54520.83510.6912yesno
P34105MAOX_POPTR1, ., 1, ., 1, ., 4, 00.88120.95010.7411yesno
P22178MAOC_FLATR1, ., 1, ., 1, ., 4, 00.79710.90670.6450N/Ano
P37222MAOC_SOLLC1, ., 1, ., 1, ., 4, 00.80900.90670.7294N/Ano
P37223MAOX_MESCR1, ., 1, ., 1, ., 4, 00.76550.92620.7299N/Ano
P51615MAOX_VITVI1, ., 1, ., 1, ., 4, 00.87210.95010.7411yesno
Q9CA83MAOP4_ARATH1, ., 1, ., 1, ., 4, 00.80280.92400.6594yesno
P48163MAOX_HUMAN1, ., 1, ., 1, ., 4, 00.54520.83510.6730yesno
P12628MAOX_PHAVU1, ., 1, ., 1, ., 4, 00.84540.89800.7028N/Ano
P16243MAOC_MAIZE1, ., 1, ., 1, ., 4, 00.81610.86110.6242N/Ano
P36444MAOC_FLAPR1, ., 1, ., 1, ., 4, 00.82470.92190.6568N/Ano

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.1.10.976
4th Layer1.1.1.400.991

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query461
PLN03129 581 PLN03129, PLN03129, NADP-dependent malic enzyme; P 0.0
PRK13529 563 PRK13529, PRK13529, malate dehydrogenase; Provisio 0.0
PTZ00317 559 PTZ00317, PTZ00317, NADP-dependent malic enzyme; P 1e-171
pfam00390182 pfam00390, malic, Malic enzyme, N-terminal domain 1e-106
COG0281 432 COG0281, SfcA, Malic enzyme [Energy production and 2e-74
cd05312 279 cd05312, NAD_bind_1_malic_enz, NAD(P) binding doma 7e-58
pfam03949255 pfam03949, Malic_M, Malic enzyme, NAD binding doma 1e-50
smart00919231 smart00919, Malic_M, Malic enzyme, NAD binding dom 1e-43
cd00762254 cd00762, NAD_bind_malic_enz, NAD(P) binding domain 2e-33
cd05311226 cd05311, NAD_bind_2_malic_enz, NAD(P) binding doma 4e-15
cd0519186 cd05191, NAD_bind_amino_acid_DH, NAD(P) binding do 2e-08
PRK07232 752 PRK07232, PRK07232, bifunctional malic enzyme oxid 1e-07
PRK12862 763 PRK12862, PRK12862, malic enzyme; Reviewed 5e-06
PRK12861 764 PRK12861, PRK12861, malic enzyme; Reviewed 8e-05
>gnl|CDD|215594 PLN03129, PLN03129, NADP-dependent malic enzyme; Provisional Back     alignment and domain information 
 Score =  829 bits (2144), Expect = 0.0
 Identities = 311/429 (72%), Positives = 359/429 (83%), Gaps = 1/429 (0%)

Query: 10  DGASVLDFDSKSTVEGGVEDVYGEDRATEDQLVTPWTISVASGYCLLRDPRHNKGLAFTE 69
             +S+ D   + +  GGVEDVYGED ATE+Q VTPW   VASGY LLRDPR+NKGLAFTE
Sbjct: 1   ASSSLADARRRRSAAGGVEDVYGEDAATEEQPVTPWV-RVASGYDLLRDPRYNKGLAFTE 59

Query: 70  KERDAHYLRGLLPPAVISQQLQEKKLMNSIRQYEVPLQKYVAMMELEERNERLFYKLLID 129
            ERD   LRGLLPPAV+SQ+LQ K+ M ++R  E PL KY A+M+L+ERNERLFY++LID
Sbjct: 60  TERDRLGLRGLLPPAVLSQELQVKRFMENLRALESPLAKYRALMDLQERNERLFYRVLID 119

Query: 130 NVEELLPVVYTPTVGEACQKYGSIFRRPQGLYISLKEKGKILEVLKNWPERSIQVIVVTD 189
           N+EELLP+VYTPTVGEACQKYGS+FRRP+GLYISLK+KG++L +LKNWPER +QVIVVTD
Sbjct: 120 NIEELLPIVYTPTVGEACQKYGSLFRRPRGLYISLKDKGRVLSMLKNWPERDVQVIVVTD 179

Query: 190 GERILGLGDLGCQGMGIPVGKLALYTALGGIRPSACLPITVDVGTNNEQLLKDEFYIGLR 249
           GERILGLGDLG QGMGIPVGKL LYTA GGIRPSA LP+ +DVGTNNE+LL D FYIGLR
Sbjct: 180 GERILGLGDLGVQGMGIPVGKLDLYTAAGGIRPSAVLPVCIDVGTNNEKLLNDPFYIGLR 239

Query: 250 QRRATGQEYAELLDEFMSAVKQNYGEKVLIQFEDFANHNAFELLAKYGTTHLVFNDDIQG 309
           Q R TG+EY EL+DEFM AVKQ +G KVL+QFEDFAN NAF LL +Y TTHL FNDDIQG
Sbjct: 240 QPRLTGEEYDELVDEFMEAVKQRWGPKVLVQFEDFANKNAFRLLQRYRTTHLCFNDDIQG 299

Query: 310 TASVVLAGVVAALKLIGGTLAEHRFLFLGAGEAGTGIAELIALEISKQTKAPVEETRKKI 369
           TA+V LAG++AAL+  GG LA+ R LF GAGEAGTGIAELIAL +S+QT    EE RK+I
Sbjct: 300 TAAVALAGLLAALRATGGDLADQRILFAGAGEAGTGIAELIALAMSRQTGISEEEARKRI 359

Query: 370 CLVDSKGLIVSSRKDSLQHFKKPWAHEHEPVNNLLDAVKVIKPTILIGSSGVGRTFTKEV 429
            LVDSKGL+  SRKDSLQ FKKP+AH+HEP  +LL+AVK IKPT+LIG SGVG TFTKEV
Sbjct: 360 WLVDSKGLVTKSRKDSLQPFKKPFAHDHEPGASLLEAVKAIKPTVLIGLSGVGGTFTKEV 419

Query: 430 IEAMASFNE 438
           +EAMAS NE
Sbjct: 420 LEAMASLNE 428

Length = 581
>gnl|CDD|237414 PRK13529, PRK13529, malate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|240357 PTZ00317, PTZ00317, NADP-dependent malic enzyme; Provisional Back     alignment and domain information
>gnl|CDD|215894 pfam00390, malic, Malic enzyme, N-terminal domain Back     alignment and domain information
>gnl|CDD|223358 COG0281, SfcA, Malic enzyme [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|133454 cd05312, NAD_bind_1_malic_enz, NAD(P) binding domain of malic enzyme (ME), subgroup 1 Back     alignment and domain information
>gnl|CDD|217809 pfam03949, Malic_M, Malic enzyme, NAD binding domain Back     alignment and domain information
>gnl|CDD|214912 smart00919, Malic_M, Malic enzyme, NAD binding domain Back     alignment and domain information
>gnl|CDD|133442 cd00762, NAD_bind_malic_enz, NAD(P) binding domain of malic enzyme Back     alignment and domain information
>gnl|CDD|133453 cd05311, NAD_bind_2_malic_enz, NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>gnl|CDD|133449 cd05191, NAD_bind_amino_acid_DH, NAD(P) binding domain of amino acid dehydrogenase-like proteins Back     alignment and domain information
>gnl|CDD|235976 PRK07232, PRK07232, bifunctional malic enzyme oxidoreductase/phosphotransacetylase; Reviewed Back     alignment and domain information
>gnl|CDD|183799 PRK12862, PRK12862, malic enzyme; Reviewed Back     alignment and domain information
>gnl|CDD|183798 PRK12861, PRK12861, malic enzyme; Reviewed Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 461
KOG1257 582 consensus NADP+-dependent malic enzyme [Energy pro 100.0
PLN03129 581 NADP-dependent malic enzyme; Provisional 100.0
PRK13529 563 malate dehydrogenase; Provisional 100.0
PTZ00317 559 NADP-dependent malic enzyme; Provisional 100.0
COG0281 432 SfcA Malic enzyme [Energy production and conversio 100.0
PRK12861 764 malic enzyme; Reviewed 100.0
PF00390182 malic: Malic enzyme, N-terminal domain; InterPro: 100.0
PRK12862 763 malic enzyme; Reviewed 100.0
PRK07232 752 bifunctional malic enzyme oxidoreductase/phosphotr 100.0
PF03949255 Malic_M: Malic enzyme, NAD binding domain; InterPr 100.0
cd00762254 NAD_bind_malic_enz NAD(P) binding domain of malic 100.0
cd05312 279 NAD_bind_1_malic_enz NAD(P) binding domain of mali 100.0
cd05311226 NAD_bind_2_malic_enz NAD(P) binding domain of mali 99.95
cd0519186 NAD_bind_amino_acid_DH NAD(P) binding domain of am 98.92
TIGR01035 417 hemA glutamyl-tRNA reductase. This enzyme, togethe 97.65
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain 97.58
PRK00045 423 hemA glutamyl-tRNA reductase; Reviewed 97.5
PRK05476 425 S-adenosyl-L-homocysteine hydrolase; Provisional 97.48
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 97.22
PLN00203 519 glutamyl-tRNA reductase 97.13
PRK14982340 acyl-ACP reductase; Provisional 97.13
cd00401 413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 97.12
COG0373 414 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] 97.1
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 97.09
PRK13940 414 glutamyl-tRNA reductase; Provisional 96.87
TIGR00936 406 ahcY adenosylhomocysteinase. This enzyme hydrolyze 96.79
PRK09414445 glutamate dehydrogenase; Provisional 96.76
cd05211217 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of 96.66
PLN02477410 glutamate dehydrogenase 96.62
PTZ00079454 NADP-specific glutamate dehydrogenase; Provisional 96.55
PRK14031444 glutamate dehydrogenase; Provisional 96.46
PRK14175286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.38
PRK14192283 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.28
PRK08306296 dipicolinate synthase subunit A; Reviewed 96.18
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 96.15
cd01076227 NAD_bind_1_Glu_DH NAD(P) binding domain of glutama 96.14
PRK00676338 hemA glutamyl-tRNA reductase; Validated 96.12
PRK14030445 glutamate dehydrogenase; Provisional 96.08
PLN02494 477 adenosylhomocysteinase 96.06
PLN00106 323 malate dehydrogenase 95.97
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 95.96
PTZ00075 476 Adenosylhomocysteinase; Provisional 95.93
PRK12549284 shikimate 5-dehydrogenase; Reviewed 95.92
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 95.91
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 95.81
cd05313254 NAD_bind_2_Glu_DH NAD(P) binding domain of glutama 95.48
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 95.47
TIGR01809282 Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO 95.37
cd05212140 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding dom 95.32
PF00056141 Ldh_1_N: lactate/malate dehydrogenase, NAD binding 95.26
PF00670162 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase 95.25
PF0380796 F420_oxidored: NADP oxidoreductase coenzyme F420-d 95.11
PRK05086 312 malate dehydrogenase; Provisional 94.93
PRK14191285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.92
cd00650 263 LDH_MDH_like NAD-dependent, lactate dehydrogenase- 94.84
cd05197 425 GH4_glycoside_hydrolases Glycoside Hydrases Family 94.81
cd05291 306 HicDH_like L-2-hydroxyisocapronate dehydrogenases 94.68
PRK10792285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.58
PRK09424 509 pntA NAD(P) transhydrogenase subunit alpha; Provis 94.48
PF00208244 ELFV_dehydrog: Glutamate/Leucine/Phenylalanine/Val 94.46
cd01079197 NAD_bind_m-THF_DH NAD binding domain of methylene- 94.43
PTZ00117 319 malate dehydrogenase; Provisional 94.41
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 94.32
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 94.29
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 94.22
TIGR00561 511 pntA NAD(P) transhydrogenase, alpha subunit. In so 94.05
PTZ00325 321 malate dehydrogenase; Provisional 94.0
PRK14189285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.77
PRK00257 381 erythronate-4-phosphate dehydrogenase; Validated 93.76
PTZ00082 321 L-lactate dehydrogenase; Provisional 93.64
PLN02928347 oxidoreductase family protein 93.56
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily o 93.52
PRK14194301 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.44
PRK06223 307 malate dehydrogenase; Reviewed 93.43
PRK14178279 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.34
PRK00066 315 ldh L-lactate dehydrogenase; Reviewed 93.23
PRK14176287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.17
PRK08605332 D-lactate dehydrogenase; Validated 93.17
cd05296 419 GH4_P_beta_glucosidase Glycoside Hydrolases Family 93.0
PRK08223 287 hypothetical protein; Validated 92.95
PRK12749288 quinate/shikimate dehydrogenase; Reviewed 92.89
PRK08293 287 3-hydroxybutyryl-CoA dehydrogenase; Validated 92.85
PRK12475 338 thiamine/molybdopterin biosynthesis MoeB-like prot 92.82
PRK08328231 hypothetical protein; Provisional 92.76
PRK15438 378 erythronate-4-phosphate dehydrogenase PdxB; Provis 92.42
PRK08762 376 molybdopterin biosynthesis protein MoeB; Validated 92.36
cd00757228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 92.27
cd05298 437 GH4_GlvA_pagL_like Glycoside Hydrolases Family 4; 92.24
PRK14027283 quinate/shikimate dehydrogenase; Provisional 92.17
TIGR02355240 moeB molybdopterin synthase sulfurylase MoeB. This 92.14
PRK14190284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 92.1
PRK14184286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 92.03
PF01262168 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal 91.77
PRK14183281 bifunctional 5,10-methylene-tetrahydrofolate dehyd 91.77
PRK09260 288 3-hydroxybutyryl-CoA dehydrogenase; Validated 91.67
cd00704 323 MDH Malate dehydrogenase. Malate dehydrogenase (MD 91.65
cd01337 310 MDH_glyoxysomal_mitochondrial Glyoxysomal and mito 91.63
PRK12548289 shikimate 5-dehydrogenase; Provisional 91.43
PRK14179284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 91.36
PRK07688 339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 91.26
PRK00258278 aroE shikimate 5-dehydrogenase; Reviewed 91.17
PRK14177284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 91.03
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 90.83
COG0111324 SerA Phosphoglycerate dehydrogenase and related de 90.57
PRK05690245 molybdopterin biosynthesis protein MoeB; Provision 90.54
PRK14188296 bifunctional 5,10-methylene-tetrahydrofolate dehyd 90.52
PRK14172278 bifunctional 5,10-methylene-tetrahydrofolate dehyd 90.51
PF02882160 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cycl 90.49
COG0169283 AroE Shikimate 5-dehydrogenase [Amino acid transpo 90.39
TIGR02992326 ectoine_eutC ectoine utilization protein EutC. Mem 90.38
cd01336 325 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosoli 90.33
PRK14174295 bifunctional 5,10-methylene-tetrahydrofolate dehyd 90.31
PLN02516299 methylenetetrahydrofolate dehydrogenase (NADP+) 90.2
PRK14193284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 90.03
PRK07574385 formate dehydrogenase; Provisional 90.01
PRK14171288 bifunctional 5,10-methylene-tetrahydrofolate dehyd 90.01
PRK14168297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 90.0
PRK15076 431 alpha-galactosidase; Provisional 89.82
PRK14187294 bifunctional 5,10-methylene-tetrahydrofolate dehyd 89.82
PLN02306386 hydroxypyruvate reductase 89.65
PRK14619 308 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 89.63
PRK14170284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 89.58
TIGR01772 312 MDH_euk_gproteo malate dehydrogenase, NAD-dependen 89.54
PRK07634 245 pyrroline-5-carboxylate reductase; Reviewed 89.53
PRK14166282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 89.47
cd05297 423 GH4_alpha_glucosidase_galactosidase Glycoside Hydr 89.44
cd01339 300 LDH-like_MDH L-lactate dehydrogenase-like malate d 89.39
PRK05600 370 thiamine biosynthesis protein ThiF; Validated 89.32
COG0334411 GdhA Glutamate dehydrogenase/leucine dehydrogenase 88.81
PRK05597 355 molybdopterin biosynthesis protein MoeB; Validated 88.76
PRK07066 321 3-hydroxybutyryl-CoA dehydrogenase; Validated 88.7
PTZ00345 365 glycerol-3-phosphate dehydrogenase; Provisional 88.59
PF01113124 DapB_N: Dihydrodipicolinate reductase, N-terminus; 88.57
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 88.53
PRK06129 308 3-hydroxyacyl-CoA dehydrogenase; Validated 88.39
TIGR01915 219 npdG NADPH-dependent F420 reductase. This model re 88.35
cd05293 312 LDH_1 A subgroup of L-lactate dehydrogenases. L-la 88.34
TIGR01763 305 MalateDH_bact malate dehydrogenase, NAD-dependent. 88.29
PRK14185293 bifunctional 5,10-methylene-tetrahydrofolate dehyd 88.18
PRK08374 336 homoserine dehydrogenase; Provisional 88.07
PRK06522 304 2-dehydropantoate 2-reductase; Reviewed 88.06
PRK15317 517 alkyl hydroperoxide reductase subunit F; Provision 88.05
PRK00094 325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr 88.01
TIGR03140 515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 87.99
PRK12921 305 2-dehydropantoate 2-reductase; Provisional 87.96
PRK12550272 shikimate 5-dehydrogenase; Reviewed 87.79
COG0686371 Ald Alanine dehydrogenase [Amino acid transport an 87.73
TIGR00872 298 gnd_rel 6-phosphogluconate dehydrogenase (decarbox 87.68
PRK07411 390 hypothetical protein; Validated 87.61
cd05290 307 LDH_3 A subgroup of L-lactate dehydrogenases. L-la 87.58
PRK06436303 glycerate dehydrogenase; Provisional 87.55
PRK14169282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 87.38
PRK13243333 glyoxylate reductase; Reviewed 87.3
PRK08410311 2-hydroxyacid dehydrogenase; Provisional 87.12
cd01338 322 MDH_choloroplast_like Chloroplast-like malate dehy 87.08
PRK08644212 thiamine biosynthesis protein ThiF; Provisional 86.92
PRK08291330 ectoine utilization protein EutC; Validated 86.88
TIGR01759 323 MalateDH-SF1 malate dehydrogenase. This model repr 86.84
PRK14180282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 86.76
PRK14173287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 86.75
PRK06130 311 3-hydroxybutyryl-CoA dehydrogenase; Validated 86.68
PF07992201 Pyr_redox_2: Pyridine nucleotide-disulphide oxidor 86.5
PRK14182282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 86.31
PRK14181287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 86.27
PRK12480330 D-lactate dehydrogenase; Provisional 86.18
KOG0029 501 consensus Amine oxidase [Secondary metabolites bio 86.16
PRK06487317 glycerate dehydrogenase; Provisional 86.1
cd01485198 E1-1_like Ubiquitin activating enzyme (E1), repeat 86.05
PLN02616364 tetrahydrofolate dehydrogenase/cyclohydrolase, put 86.01
PRK14167297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 85.86
PRK11880 267 pyrroline-5-carboxylate reductase; Reviewed 85.86
PRK05442 326 malate dehydrogenase; Provisional 85.48
PRK07680 273 late competence protein ComER; Validated 85.44
cd00300 300 LDH_like L-lactate dehydrogenase-like enzymes. Mem 85.44
COG0345 266 ProC Pyrroline-5-carboxylate reductase [Amino acid 85.12
PRK15469312 ghrA bifunctional glyoxylate/hydroxypyruvate reduc 85.12
PRK12439 341 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 85.05
cd05292 308 LDH_2 A subgroup of L-lactate dehydrogenases. L-la 84.99
PRK13581 526 D-3-phosphoglycerate dehydrogenase; Provisional 84.95
TIGR01408 1008 Ube1 ubiquitin-activating enzyme E1. This model re 84.78
PRK14851 679 hypothetical protein; Provisional 84.76
cd05294 309 LDH-like_MDH_nadp A lactate dehydrogenases-like st 84.63
cd01492197 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit 84.61
PRK09310477 aroDE bifunctional 3-dehydroquinate dehydratase/sh 84.51
TIGR00507270 aroE shikimate 5-dehydrogenase. This model finds p 84.49
COG1486 442 CelF Alpha-galactosidases/6-phospho-beta-glucosida 84.29
KOG0685 498 consensus Flavin-containing amine oxidase [Coenzym 84.27
PRK11790 409 D-3-phosphoglycerate dehydrogenase; Provisional 84.26
TIGR01758 324 MDH_euk_cyt malate dehydrogenase, NAD-dependent. T 84.18
PRK09599 301 6-phosphogluconate dehydrogenase-like protein; Rev 83.74
PRK14618 328 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 83.65
PRK14620 326 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 83.5
PRK14186297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 83.48
PF02056183 Glyco_hydro_4: Family 4 glycosyl hydrolase; InterP 83.47
PLN03139386 formate dehydrogenase; Provisional 83.19
TIGR01327 525 PGDH D-3-phosphoglycerate dehydrogenase. This mode 83.19
PRK15409323 bifunctional glyoxylate/hydroxypyruvate reductase 83.03
PLN02602 350 lactate dehydrogenase 83.02
PLN02897345 tetrahydrofolate dehydrogenase/cyclohydrolase, put 82.99
cd01483143 E1_enzyme_family Superfamily of activating enzymes 82.79
PRK06932314 glycerate dehydrogenase; Provisional 82.48
cd00755231 YgdL_like Family of activating enzymes (E1) of ubi 82.48
PLN02819 1042 lysine-ketoglutarate reductase/saccharopine dehydr 81.77
PF01494 356 FAD_binding_3: FAD binding domain; InterPro: IPR00 81.59
TIGR01381 664 E1_like_apg7 E1-like protein-activating enzyme Gsa 80.92
PRK07530 292 3-hydroxybutyryl-CoA dehydrogenase; Validated 80.75
TIGR01771 299 L-LDH-NAD L-lactate dehydrogenase. This model repr 80.72
PRK06035 291 3-hydroxyacyl-CoA dehydrogenase; Validated 80.71
COG5322351 Predicted dehydrogenase [General function predicti 80.65
PRK06141314 ornithine cyclodeaminase; Validated 80.59
KOG0069336 consensus Glyoxylate/hydroxypyruvate reductase (D- 80.38
PRK15116268 sulfur acceptor protein CsdL; Provisional 80.18
>KOG1257 consensus NADP+-dependent malic enzyme [Energy production and conversion] Back     alignment and domain information 
Probab=100.00  E-value=3.2e-169  Score=1310.04  Aligned_cols=414  Identities=63%  Similarity=0.988  Sum_probs=407.6

Q ss_pred             cccc-ccccccccccccCCCCCcCCCCCHHHHhhhccCCCCCCccccHHHHHHHHHHHhhcCCCchhHHHHHhhhhhhhh
Q 012553           42 VTPW-TISVASGYCLLRDPRHNKGLAFTEKERDAHYLRGLLPPAVISQQLQEKKLMNSIRQYEVPLQKYVAMMELEERNE  120 (461)
Q Consensus        42 ~~~~-~~~~~~G~~~l~~p~~NKG~aFt~~ER~~l~l~GLLPp~v~t~e~Q~~R~~~~~~~~~~~l~Ky~~L~~L~~~Ne  120 (461)
                      ..+| ..+..+|+++|+||++|||+|||.+||++|||||||||+|+|+|+|++||+.+++++++||+||+||++||+|||
T Consensus        20 ~~~~~~~~~~~g~~ll~~p~~NKglAFTl~ERq~l~i~GLLPp~v~t~d~Q~~r~~~~l~~~~~~l~ky~~L~~L~~rNe   99 (582)
T KOG1257|consen   20 ITPRPVESKKRGYDLLRDPRYNKGLAFTLEERQRLGIHGLLPPVVRTQDEQALRCMNNLRSLTSPLAKYIYLMDLQDRNE   99 (582)
T ss_pred             ccccccccccCChhhccCCCcccccccCHHHHHhhCccccCCccccCHHHHHHHHHHHHHhccchHHHHHHHHHHHHhhh
Confidence            3444 566789999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhhHHHhhhcccccCCcccccchHHHHHHHhhhhcCCCcccccccCcchHHHHHhcCCCCCeeEEEEecCceeeccCCCC
Q 012553          121 RLFYKLLIDNVEELLPVVYTPTVGEACQKYGSIFRRPQGLYISLKEKGKILEVLKNWPERSIQVIVVTDGERILGLGDLG  200 (461)
Q Consensus       121 ~LFY~ll~~~~ee~lpivYTPtVg~ac~~~s~i~r~p~glyis~~d~g~i~~~l~nwp~~~v~viVVTDG~rILGLGDlG  200 (461)
                      +|||+++++|+||+||||||||||+|||+||+|||+|+|||||++|+|||.++|+|||.++|++||||||+|||||||||
T Consensus       100 rLfY~~l~~nie~~~PIvYTPTvG~acq~y~~i~r~p~Glfisi~D~Ghi~~~l~nWp~~~V~~IvVTDGerILGLGDlG  179 (582)
T KOG1257|consen  100 RLFYRLLIDNIEELLPIVYTPTVGLACQQYGLIFRRPQGLFISIKDKGHIKQVLKNWPERNVKAIVVTDGERILGLGDLG  179 (582)
T ss_pred             HHHHHHHHhhHHHhCCeeecCcHHHHHHHhhhhhccCceeEEEecccchHHHHHHhCCccceeEEEEeCCCceecccccc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCccccchhhhhHHHhhCCCCCCceeeEEeecCCCchhcccCcccccccccCCChhhhHHHHHHHHHHHHHhcCCCeeee
Q 012553          201 CQGMGIPVGKLALYTALGGIRPSACLPITVDVGTNNEQLLKDEFYIGLRQRRATGQEYAELLDEFMSAVKQNYGEKVLIQ  280 (461)
Q Consensus       201 ~~GmgI~~GKl~Ly~a~gGI~P~~~lPI~LDvGTnne~LL~Dp~YlG~r~~R~~g~~Y~~~idefv~av~~~fGp~~lIq  280 (461)
                      ++|||||+||++||||||||+|++|||||||||||||+||+||+|+|+|++|++|++||+|+||||+||+++|||+++||
T Consensus       180 ~~GmgIpvgKL~Lyta~~GI~P~~cLPV~LDVGTNNe~Ll~DplYiGLr~~R~~g~eYd~~~dEFm~Av~~~yG~~~lIq  259 (582)
T KOG1257|consen  180 VNGMGIPVGKLALYTALGGIRPSRCLPVCLDVGTNNEKLLNDPLYIGLRQRRVRGKEYDEFLDEFMEAVVQRYGPNTLIQ  259 (582)
T ss_pred             cCcccceecHHHHHHHhcCCChhhceeEEEeccCChHHHhcCccccccccccccccHHHHHHHHHHHHHHHHhCcceEEE
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eecCCcccHHHHHHHHcCCCceeccCCCchhHHHHHHHHHHHHHhCCCcccceEEEeCcchHHHHHHHHHHHHHHHhcCC
Q 012553          281 FEDFANHNAFELLAKYGTTHLVFNDDIQGTASVVLAGVVAALKLIGGTLAEHRFLFLGAGEAGTGIAELIALEISKQTKA  360 (461)
Q Consensus       281 ~EDf~~~~af~iL~ryr~~~~~FnDDiQGTaaV~LAgll~Alk~~g~~l~d~riv~~GAGsAgiGiA~ll~~~m~~~~Gl  360 (461)
                      ||||+++|||++|+|||.++|||||||||||+|+|||||+|+|++|++|+|++|||+|||+||+|||+||+.+|+++ |+
T Consensus       260 FEDF~~~nAfrlL~kYr~~~c~FNDDIQGTaaValAgllaa~rit~~~lsd~~ilf~GAG~A~~GIA~l~v~~m~~~-Gl  338 (582)
T KOG1257|consen  260 FEDFANHNAFRLLEKYRNKYCMFNDDIQGTAAVALAGLLAALRITGKPLSDHVILFLGAGEAALGIANLIVMAMVKE-GL  338 (582)
T ss_pred             ehhccchhHHHHHHHhccccceecccccchhHHHHHHHHHHHHHhCCccccceEEEecCchHHhhHHHHHHHHHHHc-CC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999996 99


Q ss_pred             ChhhccceEEEEcCCCccccCCcCCCChhhhhhccccCCCCCHHHhhcccCCcEEEeccCCCCCCCHHHHHHHhcCCCCc
Q 012553          361 PVEETRKKICLVDSKGLIVSSRKDSLQHFKKPWAHEHEPVNNLLDAVKVIKPTILIGSSGVGRTFTKEVIEAMASFNEVV  440 (461)
Q Consensus       361 s~eeA~~~i~lvDs~GLi~~~R~~~L~~~k~~fA~~~~~~~~L~eaV~~vkptvLIG~S~~~g~Ft~evv~~Ma~~~erP  440 (461)
                      |++||++||||+|++|||+++|+.+++++|++||+++++.++|+|||+.||||||||+|++||+|||||||+|+++||||
T Consensus       339 ~~eeA~kkIwlvD~~GLi~~~r~~~l~~~~~~fAk~~~~~~~L~e~V~~vKPtvLiG~S~~~g~Fteevl~~Ma~~~erP  418 (582)
T KOG1257|consen  339 SEEEARKKIWLVDSKGLITKGRKASLTEEKKPFAKDHEEIKDLEEAVKEVKPTVLIGASGVGGAFTEEVLRAMAKSNERP  418 (582)
T ss_pred             CHHHHhccEEEEecCceeeccccCCCChhhccccccChHHHHHHHHHHhcCCcEEEecccCCccCCHHHHHHHHhcCCCc
Confidence            99999999999999999999998789999999999999999999999999999999999999999999999999999999


Q ss_pred             EEEEcCCCCchhhhhh
Q 012553          441 FQALLWLIRKFNFCSL  456 (461)
Q Consensus       441 IIF~Lsnp~~~~~~~~  456 (461)
                      ||||||||+...||+-
T Consensus       419 iIFalSNPT~~aECta  434 (582)
T KOG1257|consen  419 IIFALSNPTSKAECTA  434 (582)
T ss_pred             eEEecCCCccccccCH
Confidence            9999999999999974

>PLN03129 NADP-dependent malic enzyme; Provisional Back     alignment and domain information
>PRK13529 malate dehydrogenase; Provisional Back     alignment and domain information
>PTZ00317 NADP-dependent malic enzyme; Provisional Back     alignment and domain information
>COG0281 SfcA Malic enzyme [Energy production and conversion] Back     alignment and domain information
>PRK12861 malic enzyme; Reviewed Back     alignment and domain information
>PF00390 malic: Malic enzyme, N-terminal domain; InterPro: IPR012301 Malic enzymes (malate oxidoreductases) catalyse the oxidative decarboxylation of malate to form pyruvate [], a reaction important in a number of metabolic pathways - e Back     alignment and domain information
>PRK12862 malic enzyme; Reviewed Back     alignment and domain information
>PRK07232 bifunctional malic enzyme oxidoreductase/phosphotransacetylase; Reviewed Back     alignment and domain information
>PF03949 Malic_M: Malic enzyme, NAD binding domain; InterPro: IPR012302 Malic enzymes (malate oxidoreductases) catalyse the oxidative decarboxylation of malate to form pyruvate [], a reaction important in a number of metabolic pathways - e Back     alignment and domain information
>cd00762 NAD_bind_malic_enz NAD(P) binding domain of malic enzyme Back     alignment and domain information
>cd05312 NAD_bind_1_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 1 Back     alignment and domain information
>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins Back     alignment and domain information
>TIGR01035 hemA glutamyl-tRNA reductase Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>PLN00203 glutamyl-tRNA reductase Back     alignment and domain information
>PRK14982 acyl-ACP reductase; Provisional Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PRK13940 glutamyl-tRNA reductase; Provisional Back     alignment and domain information
>TIGR00936 ahcY adenosylhomocysteinase Back     alignment and domain information
>PRK09414 glutamate dehydrogenase; Provisional Back     alignment and domain information
>cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PLN02477 glutamate dehydrogenase Back     alignment and domain information
>PTZ00079 NADP-specific glutamate dehydrogenase; Provisional Back     alignment and domain information
>PRK14031 glutamate dehydrogenase; Provisional Back     alignment and domain information
>PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>cd01076 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 1 Back     alignment and domain information
>PRK00676 hemA glutamyl-tRNA reductase; Validated Back     alignment and domain information
>PRK14030 glutamate dehydrogenase; Provisional Back     alignment and domain information
>PLN02494 adenosylhomocysteinase Back     alignment and domain information
>PLN00106 malate dehydrogenase Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>PTZ00075 Adenosylhomocysteinase; Provisional Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>cd05313 NAD_bind_2_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 2 Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type Back     alignment and domain information
>cd05212 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] Back     alignment and domain information
>PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 Back     alignment and domain information
>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain Back     alignment and domain information
>PRK05086 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK14191 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd00650 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family Back     alignment and domain information
>cd05197 GH4_glycoside_hydrolases Glycoside Hydrases Family 4 Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>PRK10792 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>PF00208 ELFV_dehydrog: Glutamate/Leucine/Phenylalanine/Valine dehydrogenase; InterPro: IPR006096 Glutamate, leucine, phenylalanine and valine dehydrogenases are structurally and functionally related Back     alignment and domain information
>cd01079 NAD_bind_m-THF_DH NAD binding domain of methylene-tetrahydrofolate dehydrogenase Back     alignment and domain information
>PTZ00117 malate dehydrogenase; Provisional Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit Back     alignment and domain information
>PTZ00325 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK14189 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK00257 erythronate-4-phosphate dehydrogenase; Validated Back     alignment and domain information
>PTZ00082 L-lactate dehydrogenase; Provisional Back     alignment and domain information
>PLN02928 oxidoreductase family protein Back     alignment and domain information
>cd01487 E1_ThiF_like E1_ThiF_like Back     alignment and domain information
>PRK14194 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK06223 malate dehydrogenase; Reviewed Back     alignment and domain information
>PRK14178 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK00066 ldh L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>PRK14176 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK08605 D-lactate dehydrogenase; Validated Back     alignment and domain information
>cd05296 GH4_P_beta_glucosidase Glycoside Hydrolases Family 4; Phospho-beta-glucosidase Back     alignment and domain information
>PRK08223 hypothetical protein; Validated Back     alignment and domain information
>PRK12749 quinate/shikimate dehydrogenase; Reviewed Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>PRK08328 hypothetical protein; Provisional Back     alignment and domain information
>PRK15438 erythronate-4-phosphate dehydrogenase PdxB; Provisional Back     alignment and domain information
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA Back     alignment and domain information
>cd05298 GH4_GlvA_pagL_like Glycoside Hydrolases Family 4; GlvA- and pagL-like glycosidases Back     alignment and domain information
>PRK14027 quinate/shikimate dehydrogenase; Provisional Back     alignment and domain information
>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>PRK14190 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14184 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 Back     alignment and domain information
>PRK14183 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>cd00704 MDH Malate dehydrogenase Back     alignment and domain information
>cd01337 MDH_glyoxysomal_mitochondrial Glyoxysomal and mitochondrial malate dehydrogenases Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK14179 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK14177 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>PRK14188 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14172 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF02882 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain; InterPro: IPR020631 Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF) Back     alignment and domain information
>COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02992 ectoine_eutC ectoine utilization protein EutC Back     alignment and domain information
>cd01336 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosolic Malate dehydrogenases Back     alignment and domain information
>PRK14174 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PLN02516 methylenetetrahydrofolate dehydrogenase (NADP+) Back     alignment and domain information
>PRK14193 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK07574 formate dehydrogenase; Provisional Back     alignment and domain information
>PRK14171 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14168 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK15076 alpha-galactosidase; Provisional Back     alignment and domain information
>PRK14187 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PLN02306 hydroxypyruvate reductase Back     alignment and domain information
>PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK14170 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR01772 MDH_euk_gproteo malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PRK07634 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK14166 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd05297 GH4_alpha_glucosidase_galactosidase Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases Back     alignment and domain information
>cd01339 LDH-like_MDH L-lactate dehydrogenase-like malate dehydrogenase proteins Back     alignment and domain information
>PRK05600 thiamine biosynthesis protein ThiF; Validated Back     alignment and domain information
>COG0334 GdhA Glutamate dehydrogenase/leucine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PTZ00345 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR01915 npdG NADPH-dependent F420 reductase Back     alignment and domain information
>cd05293 LDH_1 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PRK14185 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK08374 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>PRK12921 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK12550 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK07411 hypothetical protein; Validated Back     alignment and domain information
>cd05290 LDH_3 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PRK06436 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK14169 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>PRK08410 2-hydroxyacid dehydrogenase; Provisional Back     alignment and domain information
>cd01338 MDH_choloroplast_like Chloroplast-like malate dehydrogenases Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>PRK08291 ectoine utilization protein EutC; Validated Back     alignment and domain information
>TIGR01759 MalateDH-SF1 malate dehydrogenase Back     alignment and domain information
>PRK14180 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14173 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PRK14182 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14181 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK12480 D-lactate dehydrogenase; Provisional Back     alignment and domain information
>KOG0029 consensus Amine oxidase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK06487 glycerate dehydrogenase; Provisional Back     alignment and domain information
>cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like Back     alignment and domain information
>PLN02616 tetrahydrofolate dehydrogenase/cyclohydrolase, putative Back     alignment and domain information
>PRK14167 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK11880 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK05442 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK07680 late competence protein ComER; Validated Back     alignment and domain information
>cd00300 LDH_like L-lactate dehydrogenase-like enzymes Back     alignment and domain information
>COG0345 ProC Pyrroline-5-carboxylate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional Back     alignment and domain information
>PRK12439 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01408 Ube1 ubiquitin-activating enzyme E1 Back     alignment and domain information
>PRK14851 hypothetical protein; Provisional Back     alignment and domain information
>cd05294 LDH-like_MDH_nadp A lactate dehydrogenases-like structure with malate dehydrogenase enzymatic activity Back     alignment and domain information
>cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 Back     alignment and domain information
>PRK09310 aroDE bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase protein; Reviewed Back     alignment and domain information
>TIGR00507 aroE shikimate 5-dehydrogenase Back     alignment and domain information
>COG1486 CelF Alpha-galactosidases/6-phospho-beta-glucosidases, family 4 of glycosyl hydrolases [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0685 consensus Flavin-containing amine oxidase [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01758 MDH_euk_cyt malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK14186 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF02056 Glyco_hydro_4: Family 4 glycosyl hydrolase; InterPro: IPR001088 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PLN03139 formate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01327 PGDH D-3-phosphoglycerate dehydrogenase Back     alignment and domain information
>PRK15409 bifunctional glyoxylate/hydroxypyruvate reductase B; Provisional Back     alignment and domain information
>PLN02602 lactate dehydrogenase Back     alignment and domain information
>PLN02897 tetrahydrofolate dehydrogenase/cyclohydrolase, putative Back     alignment and domain information
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>PRK06932 glycerate dehydrogenase; Provisional Back     alignment and domain information
>cd00755 YgdL_like Family of activating enzymes (E1) of ubiquitin-like proteins related to the E Back     alignment and domain information
>PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase Back     alignment and domain information
>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways Back     alignment and domain information
>TIGR01381 E1_like_apg7 E1-like protein-activating enzyme Gsa7p/Apg7p Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR01771 L-LDH-NAD L-lactate dehydrogenase Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>COG5322 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PRK06141 ornithine cyclodeaminase; Validated Back     alignment and domain information
>KOG0069 consensus Glyoxylate/hydroxypyruvate reductase (D-isomer-specific 2-hydroxy acid dehydrogenase superfamily) [Energy production and conversion] Back     alignment and domain information
>PRK15116 sulfur acceptor protein CsdL; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query461
2aw5_A 575 Crystal Structure Of A Human Malic Enzyme Length = 1e-113
1gz3_A 554 Molecular Mechanism For The Regulation Of Human Mit 1e-112
1gq2_A 555 Malic Enzyme From Pigeon Liver Length = 555 1e-110
1qr6_A 584 Human Mitochondrial Nad(P)-Dependent Malic Enzyme L 1e-106
1efk_A 584 Structure Of Human Malic Enzyme In Complex With Ket 1e-106
1gz4_A 551 Molecular Mechanism Of The Regulation Of Human Mito 1e-106
1do8_A 564 Crystal Structure Of A Closed Form Of Human Mitocho 1e-106
1llq_A 605 Crystal Structure Of Malic Enzyme From Ascaris Suum 1e-100
3nv9_A 487 Crystal Structure Of Entamoeba Histolytica Malic En 3e-07
1ww8_A 439 Crystal Structure Of Malic Enzyme From Pyrococcus H 1e-06
2dvm_A 439 Nad Complex Structure Of Ph1275 Protein From Pyroco 1e-06
>pdb|2AW5|A Chain A, Crystal Structure Of A Human Malic Enzyme Length = 575 Back     alignment and structure 
Iteration: 1

 Score =  406 bits (1044), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 202/391 (51%), Positives = 262/391 (67%), Gaps = 2/391 (0%)
Query: 48  SVASGYCLLRDPRHNKGLAFTEKERDAHYLRGLLPPAVISQQLQEKKLMNSIRQYEVPLQ 107
           S+  GY L R+P  NK LAFT +ER    + GLLPP+  SQ++Q  +++ +         
Sbjct: 22  SMQRGYLLTRNPHLNKDLAFTLEERQQLNIHGLLPPSFNSQEIQVLRVVKNFEHLNSDFD 81
Query: 108 KYVAMMELEERNERLFYKLLIDNVEELLPVVYTPTVGEACQKYGSIFRRPQGLYISLKEK 167
           +Y+ +M+L++RNE+LFY++L  ++E+ +P+VYTPTVG ACQ+Y  +FR+P+GL+I++ ++
Sbjct: 82  RYLLLMDLQDRNEKLFYRVLTSDIEKFMPIVYTPTVGLACQQYSLVFRKPRGLFITIHDR 141
Query: 168 GKILEVLKNWPERSIQVIVVTDGERILGLGDLGCQGMGIPVGKLALYTALGGIRPSACLP 227
           G I  VL  WPE  I+ IVVTDGERILGLGDLGC GMGIPVGKLALYTA GG+ P  CLP
Sbjct: 142 GHIASVLNAWPEDVIKAIVVTDGERILGLGDLGCNGMGIPVGKLALYTACGGMNPQECLP 201
Query: 228 ITVDVGTNNEQLLKDEFYIGLRQRRATGQEYAELLDEFMSAVKQNYGEKVLIQFEDFANH 287
           + +DVGT NE+LLKD  YIGLRQRR  G EY + LDEFM AV   YG   LIQFEDFAN 
Sbjct: 202 VILDVGTENEELLKDPLYIGLRQRRVRGSEYDDFLDEFMEAVSSKYGMNCLIQFEDFANV 261
Query: 288 NAFELLAKYGTTHLVFNDDIQXXXXXXXXXXXXXXXXXXXTLAEHRFLFLGAGEAGTGIA 347
           NAF LL KY   +  FNDDIQ                    L++   LF GAGEA  GIA
Sbjct: 262 NAFRLLNKYRNQYCTFNDDIQGTASVAVAGLLAALRITKNKLSDQTILFQGAGEAALGIA 321
Query: 348 ELIALEISKQTKAPVEETRKKICLVDSKGLIVSSRKDSLQHFKKPWAHEHEPVNNLLDAV 407
            LI + + K+   P E+  KKI LVDSKGLIV  R  SL   K+ +AHEHE + NL   V
Sbjct: 322 HLIVMALEKE-GLPKEKAIKKIWLVDSKGLIVKGRA-SLTQEKEKFAHEHEEMKNLEAIV 379
Query: 408 KVIKPTILIGSSGVGRTFTKEVIEAMASFNE 438
           + IKPT LIG + +G  F++++++ MA+FNE
Sbjct: 380 QEIKPTALIGVAAIGGAFSEQILKDMAAFNE 410
>pdb|1GZ3|A Chain A, Molecular Mechanism For The Regulation Of Human Mitochondrial Nad(P)+-Dependent Malic Enzyme By Atp And Fumarate Length = 554 Back     alignment and structure
>pdb|1GQ2|A Chain A, Malic Enzyme From Pigeon Liver Length = 555 Back     alignment and structure
>pdb|1QR6|A Chain A, Human Mitochondrial Nad(P)-Dependent Malic Enzyme Length = 584 Back     alignment and structure
>pdb|1EFK|A Chain A, Structure Of Human Malic Enzyme In Complex With Ketomalonate Length = 584 Back     alignment and structure
>pdb|1GZ4|A Chain A, Molecular Mechanism Of The Regulation Of Human Mitochondrial Nad(P)+-Dependent Malic Enzyme By Atp And Fumarate Length = 551 Back     alignment and structure
>pdb|1DO8|A Chain A, Crystal Structure Of A Closed Form Of Human Mitochondrial Nad(P)+-Dependent Malic Enzyme Length = 564 Back     alignment and structure
>pdb|1LLQ|A Chain A, Crystal Structure Of Malic Enzyme From Ascaris Suum Complexed With Nicotinamide Adenine Dinucleotide Length = 605 Back     alignment and structure
>pdb|3NV9|A Chain A, Crystal Structure Of Entamoeba Histolytica Malic Enzyme Length = 487 Back     alignment and structure
>pdb|1WW8|A Chain A, Crystal Structure Of Malic Enzyme From Pyrococcus Horikoshii Ot3 Length = 439 Back     alignment and structure
>pdb|2DVM|A Chain A, Nad Complex Structure Of Ph1275 Protein From Pyrococcus Horikoshii Length = 439 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query461
1gq2_A 555 Malic enzyme; oxidoreductase, pigeon liver, NADP-d 0.0
1pj3_A 564 NAD-dependent malic enzyme, mitochondrial; oxidati 0.0
1o0s_A 605 NAD-ME, NAD-dependent malic enzyme; oxidoreductase 0.0
3nv9_A 487 Malic enzyme; rossmann fold, oxidoreductase; 2.25A 4e-24
2a9f_A398 Putative malic enzyme ((S)-malate:NAD+ oxidoreduct 5e-23
1vl6_A388 Malate oxidoreductase; TM0542, NAD-dependent malic 7e-21
2dvm_A 439 Malic enzyme, 439AA long hypothetical malate oxido 2e-17
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-07
>1gq2_A Malic enzyme; oxidoreductase, pigeon liver, NADP-dependent, NAD-NADP selectivity, decarboxylase, malate, Mn2+; HET: NAP; 2.5A {Columba livia} SCOP: c.2.1.7 c.58.1.3 PDB: 2aw5_A Length = 555 Back     alignment and structure
 Score =  620 bits (1601), Expect = 0.0
 Identities = 213/392 (54%), Positives = 278/392 (70%), Gaps = 4/392 (1%)

Query: 52  GYCLLRDPRHNKGLAFTEKERDAHYLRGLLPPAVISQQLQEKKLMNSIRQYEVPLQKYVA 111
           GY +LRDP  NKG+AFT +ER    + GLLPP  + Q  Q   ++ +  +    L +Y+ 
Sbjct: 3   GYEVLRDPHLNKGMAFTLEERQQLNIHGLLPPCFLGQDAQVYSILKNFERLTSDLDRYIL 62

Query: 112 MMELEERNERLFYKLLIDNVEELLPVVYTPTVGEACQKYGSIFRRPQGLYISLKEKGKIL 171
           +M L++RNE+LFYK+L  ++E  +P+VYTPTVG ACQ YG  FRRP+GL+I++ ++G I 
Sbjct: 63  LMSLQDRNEKLFYKVLTSDIERFMPIVYTPTVGLACQHYGLAFRRPRGLFITIHDRGHIA 122

Query: 172 EVLKNWPERSIQVIVVTDGERILGLGDLGCQGMGIPVGKLALYTALGGIRPSACLPITVD 231
            +L++WPE  I+ IVVTDGERILGLGDLGC GMGIPVGKLALYTA GG++P  CLP+ +D
Sbjct: 123 TMLQSWPESVIKAIVVTDGERILGLGDLGCYGMGIPVGKLALYTACGGVKPHQCLPVMLD 182

Query: 232 VGTNNEQLLKDEFYIGLRQRRATGQEYAELLDEFMSAVKQNYGEKVLIQFEDFANHNAFE 291
           VGT+NE LLKD  YIGLR +R  GQ Y +LLDEFM AV   YG   LIQFEDFAN NAF 
Sbjct: 183 VGTDNETLLKDPLYIGLRHKRIRGQAYDDLLDEFMEAVTSRYGMNCLIQFEDFANANAFR 242

Query: 292 LLAKYGTTHLVFNDDIQGTASVVLAGVVAALKLIGGTLAEHRFLFLGAGEAGTGIAELIA 351
           LL KY   +  FNDDIQGTASV +AG++AAL++    L++H  LF GAGEA  GIA LI 
Sbjct: 243 LLHKYRNKYCTFNDDIQGTASVAVAGLLAALRITKNRLSDHTVLFQGAGEAALGIANLIV 302

Query: 352 LEISKQTKAPVEETRKKICLVDSKGLIVSSRKDSLQHFKKPWAHEHEPVNNLLDAVKVIK 411
           + + K+     EE  K+I +VDSKGLIV  R   L   K+ +AHEH  + NL D VK IK
Sbjct: 303 MAMQKE-GVSKEEAIKRIWMVDSKGLIVKGRAS-LTPEKEHFAHEHCEMKNLEDIVKDIK 360

Query: 412 PTILIGSSGVGRTFTKEVIEAMASFNE--VVF 441
           PT+LIG + +G  FT+++++ MA+FN+  ++F
Sbjct: 361 PTVLIGVAAIGGAFTQQILQDMAAFNKRPIIF 392
>1pj3_A NAD-dependent malic enzyme, mitochondrial; oxidative decarboxylase, oxidoreductase; HET: NAD; 2.10A {Homo sapiens} SCOP: c.2.1.7 c.58.1.3 PDB: 1pj2_A* 1do8_A* 1pj4_A* 1qr6_A* 1efl_A* 1pjl_A* 1efk_A* 1gz4_A* 1gz3_A* Length = 564 Back     alignment and structure
>1o0s_A NAD-ME, NAD-dependent malic enzyme; oxidoreductase, oxidative decarboxylase, rossmann fold, MAla dehydrogenase; HET: NAI; 2.00A {Ascaris suum} SCOP: c.2.1.7 c.58.1.3 PDB: 1llq_A* Length = 605 Back     alignment and structure
>3nv9_A Malic enzyme; rossmann fold, oxidoreductase; 2.25A {Entamoeba histolytica} Length = 487 Back     alignment and structure
>2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} Length = 398 Back     alignment and structure
>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Length = 388 Back     alignment and structure
>2dvm_A Malic enzyme, 439AA long hypothetical malate oxidoreductase; NAD, structural genomics, NPPSFA; HET: NAD MES; 1.60A {Pyrococcus horikoshii} PDB: 1ww8_A* Length = 439 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query461
1gq2_A 555 Malic enzyme; oxidoreductase, pigeon liver, NADP-d 100.0
1pj3_A 564 NAD-dependent malic enzyme, mitochondrial; oxidati 100.0
1o0s_A 605 NAD-ME, NAD-dependent malic enzyme; oxidoreductase 100.0
3nv9_A 487 Malic enzyme; rossmann fold, oxidoreductase; 2.25A 100.0
2a9f_A398 Putative malic enzyme ((S)-malate:NAD+ oxidoreduct 100.0
1vl6_A388 Malate oxidoreductase; TM0542, NAD-dependent malic 100.0
2dvm_A 439 Malic enzyme, 439AA long hypothetical malate oxido 100.0
3gvp_A 435 Adenosylhomocysteinase 3; protein CO-factor comple 98.83
3h9u_A 436 Adenosylhomocysteinase; NAD CO-factor complex, str 98.67
1x13_A401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 98.6
3ond_A 488 Adenosylhomocysteinase; plant protein, enzyme-subs 97.95
1l7d_A384 Nicotinamide nucleotide transhydrogenase, subunit 97.72
3n58_A 464 Adenosylhomocysteinase; ssgcid, hydrolase, structu 97.48
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 97.46
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 97.14
1a4i_A301 Methylenetetrahydrofolate dehydrogenase / methenyl 96.65
3l07_A285 Bifunctional protein fold; structural genomics, ID 96.59
3k92_A424 NAD-GDH, NAD-specific glutamate dehydrogenase; ROC 96.49
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 96.44
4fcc_A450 Glutamate dehydrogenase; protein complex, rossmann 96.42
3p2o_A285 Bifunctional protein fold; structural genomics, ce 96.4
3ngx_A276 Bifunctional protein fold; methylenetetrahydrofola 96.31
1b0a_A288 Protein (fold bifunctional protein); folate, dehyd 96.22
3pwz_A272 Shikimate dehydrogenase 3; alpha-beta, oxidoreduct 96.21
4a5o_A286 Bifunctional protein fold; oxidoreductase, hydrola 96.18
3aoe_E419 Glutamate dehydrogenase; rossmann fold, NADH, oxid 96.13
4a26_A300 Putative C-1-tetrahydrofolate synthase, cytoplasm; 96.05
3jyo_A283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 96.03
1edz_A320 5,10-methylenetetrahydrofolate dehydrogenase; nucl 95.98
2yfq_A421 Padgh, NAD-GDH, NAD-specific glutamate dehydrogena 95.93
3aog_A440 Glutamate dehydrogenase; NAD(H), oxidoreducta; HET 95.83
3r3j_A456 Glutamate dehydrogenase; rossman fold, oxidoreduct 95.75
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 95.74
3don_A277 Shikimate dehydrogenase; alpha-beta structure, ros 95.7
1gpj_A 404 Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro 95.59
2c2x_A281 Methylenetetrahydrofolate dehydrogenase- methenylt 95.52
1pzg_A 331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 95.35
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 95.16
1nvt_A287 Shikimate 5'-dehydrogenase; structural genomics, P 95.15
2tmg_A415 Protein (glutamate dehydrogenase); metabolic role, 95.15
3t4e_A312 Quinate/shikimate dehydrogenase; structural genomi 95.07
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 95.07
2v6b_A 304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 95.03
2bma_A470 Glutamate dehydrogenase (NADP+); malaria, drug des 94.91
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 94.86
1t2d_A 322 LDH-P, L-lactate dehydrogenase; ternary complex, o 94.78
2ewd_A 317 Lactate dehydrogenase,; protein-substrate_cofactor 94.76
1v8b_A 479 Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2 94.69
2hk9_A275 Shikimate dehydrogenase; shikimate pathway, drug d 94.65
2hjr_A 328 Malate dehydrogenase; malaria, structural genomics 94.62
1hyh_A 309 L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 94.32
3d64_A 494 Adenosylhomocysteinase; structural genomics, ssgci 94.23
2o4c_A 380 Erythronate-4-phosphate dehydrogenase; erythronate 94.05
1mld_A 314 Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D 94.03
1v9l_A421 Glutamate dehydrogenase; protein-NAD complex, oxid 94.0
1a5z_A 319 L-lactate dehydrogenase; oxidoreductase, glycolysi 93.93
2d5c_A263 AROE, shikimate 5-dehydrogenase; substrate, dimer, 93.63
3u62_A253 Shikimate dehydrogenase; shikimate pathway, oxidor 93.6
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 93.55
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 93.49
3ce6_A 494 Adenosylhomocysteinase; protein-substrate complex, 93.43
2i6t_A 303 Ubiquitin-conjugating enzyme E2-like isoform A; L- 93.43
2ekl_A313 D-3-phosphoglycerate dehydrogenase; structural gen 93.43
3fbt_A282 Chorismate mutase and shikimate 5-dehydrogenase fu 93.38
3u95_A 477 Glycoside hydrolase, family 4; hydrolysis, cytosol 93.38
3oet_A 381 Erythronate-4-phosphate dehydrogenase; structural 93.33
1o6z_A 303 MDH, malate dehydrogenase; halophilic, ION-binding 93.32
2rir_A300 Dipicolinate synthase, A chain; structural genomic 93.26
1b8p_A 329 Protein (malate dehydrogenase); oxidoreductase; 1. 93.25
3o8q_A281 Shikimate 5-dehydrogenase I alpha; structural geno 93.24
3dtt_A 245 NADP oxidoreductase; structural genomics, joint ce 93.21
1bgv_A449 Glutamate dehydrogenase; oxidoreductase; HET: GLU; 93.2
3tri_A 280 Pyrroline-5-carboxylate reductase; amino acid bios 93.13
1ldn_A 316 L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA 92.6
3tum_A269 Shikimate dehydrogenase family protein; rossmann-f 92.46
1gtm_A419 Glutamate dehydrogenase; oxidoreductase, NAD, NADP 92.41
1ur5_A 309 Malate dehydrogenase; oxidoreductase, tricarboxyli 92.39
2gcg_A330 Glyoxylate reductase/hydroxypyruvate reductase; NA 92.34
1zud_1251 Adenylyltransferase THIF; thiamin, thiazole, prote 92.32
2dbq_A334 Glyoxylate reductase; D-3-phosphoglycerate dehydro 92.29
2zqz_A 326 L-LDH, L-lactate dehydrogenase; oxidoreductase, ro 92.28
1ez4_A 318 Lactate dehydrogenase; rossmann fold, oxidoreducta 92.14
1leh_A364 Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi 92.12
3kkj_A 336 Amine oxidase, flavin-containing; oxidoreductase, 92.09
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 91.91
2rcy_A 262 Pyrroline carboxylate reductase; malaria, structur 91.85
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 91.79
3vku_A 326 L-LDH, L-lactate dehydrogenase; rossmann fold, NAD 91.79
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 91.75
3d0o_A 317 L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly 91.74
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 91.6
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 91.55
3h5n_A353 MCCB protein; ubiquitin-activating enzyme, microci 91.49
3d1l_A 266 Putative NADP oxidoreductase BF3122; structural ge 91.26
1c1d_A355 L-phenylalanine dehydrogenase; amino acid dehydrog 91.26
1oju_A 294 MDH, malate dehydrogenase; hyperthermophilic, oxid 91.12
3fef_A 450 Putative glucosidase LPLD; gulosidase, structural 91.08
1y6j_A 318 L-lactate dehydrogenase; southeast collaboratory f 90.91
1wwk_A307 Phosphoglycerate dehydrogenase; riken structural g 90.9
3i83_A 320 2-dehydropantoate 2-reductase; structural genomics 90.81
3pqe_A 326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 90.78
1guz_A 310 Malate dehydrogenase; oxidoreductase, tricarboxyli 90.72
4g2n_A345 D-isomer specific 2-hydroxyacid dehydrogenase, Na; 90.7
1xdw_A331 NAD+-dependent (R)-2-hydroxyglutarate dehydrogenas 90.63
1lld_A 319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 90.56
1obb_A 480 Maltase, alpha-glucosidase; glycosidase, sulfinic 90.49
3ba1_A333 HPPR, hydroxyphenylpyruvate reductase; two domain 90.31
1hye_A 313 L-lactate/malate dehydrogenase; nucleotide binding 90.23
3p7m_A 321 Malate dehydrogenase; putative dehydrogenase, enzy 90.23
2xxj_A 310 L-LDH, L-lactate dehydrogenase; oxidoreductase, hy 90.2
1sc6_A 404 PGDH, D-3-phosphoglycerate dehydrogenase; alloster 90.12
3jtm_A351 Formate dehydrogenase, mitochondrial; mitochondrio 90.09
3nep_X 314 Malate dehydrogenase; halophIle, molecular adpatat 90.08
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 90.02
3gvi_A 324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 89.99
1smk_A 326 Malate dehydrogenase, glyoxysomal; tricarboxylic c 89.99
3mw9_A 501 GDH 1, glutamate dehydrogenase 1; allostery, inhib 89.86
1hyu_A 521 AHPF, alkyl hydroperoxide reductase subunit F; thi 89.63
1s6y_A 450 6-phospho-beta-glucosidase; hydrolase, structural 89.56
1x0v_A 354 GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase 89.53
4huj_A220 Uncharacterized protein; PSI-biology, nysgrc, stru 89.52
2cuk_A311 Glycerate dehydrogenase/glyoxylate reductase; stru 89.48
1up7_A 417 6-phospho-beta-glucosidase; hydrolase, family4 hyd 89.46
1txg_A 335 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid 89.46
3k5p_A 416 D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, 89.46
2zyd_A 480 6-phosphogluconate dehydrogenase, decarboxylating; 89.42
1qp8_A303 Formate dehydrogenase; oxidoreductase; HET: NDP; 2 89.31
1z82_A 335 Glycerol-3-phosphate dehydrogenase; TM0378, struct 89.29
3h8v_A 292 Ubiquitin-like modifier-activating enzyme 5; rossm 89.15
4e12_A 283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 89.12
2j6i_A364 Formate dehydrogenase; oxidoreductase, D-specific- 89.07
4hy3_A365 Phosphoglycerate oxidoreductase; PSI-biology, stru 88.98
2d0i_A333 Dehydrogenase; structural genomics, NPPSFA, nation 88.97
1j4a_A333 D-LDH, D-lactate dehydrogenase; NAD-dependent dehy 88.9
2yq5_A343 D-isomer specific 2-hydroxyacid dehydrogenase; oxi 88.86
3rui_A 340 Ubiquitin-like modifier-activating enzyme ATG7; au 88.55
4dgs_A340 Dehydrogenase; structural genomics, PSI-biology, N 88.49
3k96_A 356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 88.37
1dxy_A333 D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxyc 88.36
4e21_A 358 6-phosphogluconate dehydrogenase (decarboxylating; 88.34
1u8x_X 472 Maltose-6'-phosphate glucosidase; structural genom 88.25
1yj8_A 375 Glycerol-3-phosphate dehydrogenase; SGPP, structur 88.22
4aj2_A 331 L-lactate dehydrogenase A chain; oxidoreductase-in 87.95
2d4a_B 308 Malate dehydrogenase; archaea, hyperthermophIle, o 87.68
4gsl_A 615 Ubiquitin-like modifier-activating enzyme ATG7; ub 87.5
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 87.5
2p4q_A 497 6-phosphogluconate dehydrogenase, decarboxylating; 87.29
3hg7_A324 D-isomer specific 2-hydroxyacid dehydrogenase FAM 87.28
3evt_A324 Phosphoglycerate dehydrogenase; structural genomic 87.16
3b1f_A 290 Putative prephenate dehydrogenase; enzyme, 4-hydro 87.07
1lss_A140 TRK system potassium uptake protein TRKA homolog; 87.07
2pi1_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 87.04
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 87.01
2w2k_A348 D-mandelate dehydrogenase; 2-hydroxyacid dehydroge 86.99
4fgw_A 391 Glycerol-3-phosphate dehydrogenase [NAD(+)] 1; oxi 86.98
2ew2_A 316 2-dehydropantoate 2-reductase, putative; alpha-str 86.97
3vrd_B 401 FCCB subunit, flavocytochrome C flavin subunit; su 86.95
1f0y_A 302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 86.93
2qrj_A394 Saccharopine dehydrogenase, NAD+, L-lysine- formin 86.91
3tl2_A 315 Malate dehydrogenase; center for structural genomi 86.85
3gt0_A 247 Pyrroline-5-carboxylate reductase; structural geno 86.49
1npy_A271 Hypothetical shikimate 5-dehydrogenase-like protei 86.4
3gvx_A290 Glycerate dehydrogenase related protein; NYSGXRC, 86.34
1y7t_A 327 Malate dehydrogenase; NAD-dependent-MDH-NADPH comp 86.3
2izz_A 322 Pyrroline-5-carboxylate reductase 1; amino-acid bi 86.0
1ks9_A 291 KPA reductase;, 2-dehydropantoate 2-reductase; PAN 85.98
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 85.89
2i99_A312 MU-crystallin homolog; thyroid hormine binding pro 85.89
3ado_A 319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 85.81
2nac_A393 NAD-dependent formate dehydrogenase; oxidoreductas 85.8
2x0j_A 294 Malate dehydrogenase; oxidoreductase, hyperthermop 85.73
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 85.54
1gdh_A320 D-glycerate dehydrogenase; oxidoreductase(CHOH (D) 85.41
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 85.39
1x7d_A 350 Ornithine cyclodeaminase; binds NAD+, binds L-orni 85.18
3fi9_A 343 Malate dehydrogenase; structural genomics, oxidore 85.17
4egb_A 346 DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce 85.14
3c85_A183 Putative glutathione-regulated potassium-efflux S 85.06
2g76_A335 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor 84.98
2dpo_A 319 L-gulonate 3-dehydrogenase; structural genomics, N 84.82
3qsg_A 312 NAD-binding phosphogluconate dehydrogenase-like P; 84.42
3ldh_A 330 Lactate dehydrogenase; oxidoreductase, CHOH donor, 84.33
2h78_A 302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 84.26
3c24_A 286 Putative oxidoreductase; YP_511008.1, structural g 84.23
3pp8_A315 Glyoxylate/hydroxypyruvate reductase A; structural 84.22
1y8q_A 346 Ubiquitin-like 1 activating enzyme E1A; SUMO, hete 84.2
4dll_A 320 2-hydroxy-3-oxopropionate reductase; structural ge 83.78
3pef_A 287 6-phosphogluconate dehydrogenase, NAD-binding; gam 83.71
4hb9_A 412 Similarities with probable monooxygenase; flavin, 83.68
3gpi_A 286 NAD-dependent epimerase/dehydratase; structural ge 83.66
3k6j_A 460 Protein F01G10.3, confirmed by transcript evidenc; 83.64
3vh1_A 598 Ubiquitin-like modifier-activating enzyme ATG7; au 83.56
3gg9_A352 D-3-phosphoglycerate dehydrogenase oxidoreductase; 83.49
2g5c_A 281 Prephenate dehydrogenase; TYRA, oxidoreductase; HE 83.44
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 83.35
2uyy_A 316 N-PAC protein; long-chain dehydrogenase, cytokine; 83.29
1yb4_A 295 Tartronic semialdehyde reductase; structural genom 83.17
1mx3_A347 CTBP1, C-terminal binding protein 1; nuclear prote 83.12
1pgj_A 478 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; o 83.09
5mdh_A 333 Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH 83.07
3kb6_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 82.61
3l6d_A 306 Putative oxidoreductase; structural genomics, prot 82.6
4ezb_A 317 Uncharacterized conserved protein; structural geno 82.34
4gwg_A 484 6-phosphogluconate dehydrogenase, decarboxylating; 82.31
3ggo_A 314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 82.23
3pdu_A 287 3-hydroxyisobutyrate dehydrogenase family protein; 82.15
2iz1_A 474 6-phosphogluconate dehydrogenase, decarboxylating; 81.84
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 81.68
2pv7_A 298 T-protein [includes: chorismate mutase (EC 5.4.99 81.47
4e5n_A330 Thermostable phosphite dehydrogenase; D-2-hydroxya 81.26
4a9w_A 357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 81.0
3fbs_A 297 Oxidoreductase; structural genomics, PSI2, MCSG, p 80.94
1omo_A322 Alanine dehydrogenase; two-domain, beta-sandwich-d 80.84
3doj_A 310 AT3G25530, dehydrogenase-like protein; gamma-hydro 80.83
3oz2_A 397 Digeranylgeranylglycerophospholipid reductase; str 80.79
2pzm_A 330 Putative nucleotide sugar epimerase/ dehydratase; 80.58
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 80.47
3d1c_A 369 Flavin-containing putative monooxygenase; NP_37310 80.45
3abi_A 365 Putative uncharacterized protein PH1688; L-lysine 80.44
2f1k_A 279 Prephenate dehydrogenase; tyrosine synthesis, X-RA 80.42
2pgd_A 482 6-phosphogluconate dehydrogenase; oxidoreductase ( 80.26
3lzw_A 332 Ferredoxin--NADP reductase 2; ferredoxin reductase 80.21
3f8d_A 323 Thioredoxin reductase (TRXB-3); redox protein, nuc 80.14
3cky_A 301 2-hydroxymethyl glutarate dehydrogenase; rossmann 80.01
>1gq2_A Malic enzyme; oxidoreductase, pigeon liver, NADP-dependent, NAD-NADP selectivity, decarboxylase, malate, Mn2+; HET: NAP; 2.5A {Columba livia} SCOP: c.2.1.7 c.58.1.3 PDB: 2aw5_A Back     alignment and structure
Probab=100.00  E-value=1.2e-160  Score=1264.79  Aligned_cols=405  Identities=53%  Similarity=0.903  Sum_probs=398.9

Q ss_pred             ccccccccCCCCCcCCCCCHHHHhhhccCCCCCCccccHHHHHHHHHHHhhcCCCchhHHHHHhhhhhhhhhhhHHHhhh
Q 012553           50 ASGYCLLRDPRHNKGLAFTEKERDAHYLRGLLPPAVISQQLQEKKLMNSIRQYEVPLQKYVAMMELEERNERLFYKLLID  129 (461)
Q Consensus        50 ~~G~~~l~~p~~NKG~aFt~~ER~~l~l~GLLPp~v~t~e~Q~~R~~~~~~~~~~~l~Ky~~L~~L~~~Ne~LFY~ll~~  129 (461)
                      .+|+++|+||++|||||||.+||++|||+|||||+|+|+|+|++|+|+|+++++++|+||+||++||++||+||||++++
T Consensus         1 ~~G~~lL~~p~~NKGtAFt~~ER~~l~l~GLLPp~v~t~e~Q~~r~~~~~~~~~~~l~k~~~L~~L~~~Ne~Lfy~ll~~   80 (555)
T 1gq2_A            1 KKGYEVLRDPHLNKGMAFTLEERQQLNIHGLLPPCFLGQDAQVYSILKNFERLTSDLDRYILLMSLQDRNEKLFYKVLTS   80 (555)
T ss_dssp             CCTTHHHHCTTTCCGGGSCHHHHHHTTCTTSSCSCBCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCHHHHHHHHHH
T ss_pred             CChhhhccCCcccCCCCCCHHHHHHCCCccCCCCCcCCHHHHHHHHHHHHhcCCCcHHHHHHHHHhcCcceeeehhhHhh
Confidence            37999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cccccCCcccccchHHHHHHHhhhhcCCCcccccccCcchHHHHHhcCCCCCeeEEEEecCceeeccCCCCCCccccchh
Q 012553          130 NVEELLPVVYTPTVGEACQKYGSIFRRPQGLYISLKEKGKILEVLKNWPERSIQVIVVTDGERILGLGDLGCQGMGIPVG  209 (461)
Q Consensus       130 ~~ee~lpivYTPtVg~ac~~~s~i~r~p~glyis~~d~g~i~~~l~nwp~~~v~viVVTDG~rILGLGDlG~~GmgI~~G  209 (461)
                      |++|+|||+||||||++|++||+|||+|+|+|+|++|+|+++++++|||.++|+|||||||||||||||||++|||||||
T Consensus        81 ~~~e~lpivYTP~V~~ac~~~s~i~~~p~g~yis~~d~~~i~~~l~n~~~~~~~v~VVTDG~~ILGLGD~G~~g~~ipvG  160 (555)
T 1gq2_A           81 DIERFMPIVYTPTVGLACQHYGLAFRRPRGLFITIHDRGHIATMLQSWPESVIKAIVVTDGERILGLGDLGCYGMGIPVG  160 (555)
T ss_dssp             THHHHHHHHSTTHHHHHHHTHHHHCSSCCSEEEEGGGTTCHHHHHHTSSCSCCCEEEEECSSSCGGGCCCGGGGGHHHHH
T ss_pred             hHHHhcCcccCchHHHHHHHHHHHhcChhhhhcccCCHHHHHHHHhcCCCCCcEEEEEEccccccccCCCCCCccccchh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhhHHHhhCCCCCCceeeEEeecCCCchhcccCcccccccccCCChhhhHHHHHHHHHHHHHhcCCCeeeeeecCCcccH
Q 012553          210 KLALYTALGGIRPSACLPITVDVGTNNEQLLKDEFYIGLRQRRATGQEYAELLDEFMSAVKQNYGEKVLIQFEDFANHNA  289 (461)
Q Consensus       210 Kl~Ly~a~gGI~P~~~lPI~LDvGTnne~LL~Dp~YlG~r~~R~~g~~Y~~~idefv~av~~~fGp~~lIq~EDf~~~~a  289 (461)
                      |++|||+||||||++|||||||+|||||+||+||+||||||+|++|++|++|+||||++|+++|||+++||||||++|||
T Consensus       161 Kl~Ly~~~aGIdP~~~lPI~LD~GTnn~~LL~DplYlG~r~~Rv~g~eyd~fvdefv~av~~~fGp~~~I~~EDf~~~~a  240 (555)
T 1gq2_A          161 KLALYTACGGVKPHQCLPVMLDVGTDNETLLKDPLYIGLRHKRIRGQAYDDLLDEFMEAVTSRYGMNCLIQFEDFANANA  240 (555)
T ss_dssp             HHHHHHHTTCCCGGGEEEEEEESCCCCHHHHHCTTCCSCSSCCCCTHHHHHHHHHHHHHHHHHHCTTCEEEECSCCHHHH
T ss_pred             HHHHhHhccCCChhheeeeEeecCCCchhhcCCCccCCcCCCCCchHHHHHHHHHHHHHHHHhhCCCcEEeecccCCccH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHcCCCceeccCCCchhHHHHHHHHHHHHHhCCCcccceEEEeCcchHHHHHHHHHHHHHHHhcCCChhhccceE
Q 012553          290 FELLAKYGTTHLVFNDDIQGTASVVLAGVVAALKLIGGTLAEHRFLFLGAGEAGTGIAELIALEISKQTKAPVEETRKKI  369 (461)
Q Consensus       290 f~iL~ryr~~~~~FnDDiQGTaaV~LAgll~Alk~~g~~l~d~riv~~GAGsAgiGiA~ll~~~m~~~~Gls~eeA~~~i  369 (461)
                      |+||+|||++||||||||||||+|+||||+||+|++|++|+||||||+|||+||+|||+||+.+|+++ |+|+|||++||
T Consensus       241 f~il~ryr~~ipvFnDDiqGTa~V~lAgllnAlki~gk~l~d~riv~~GAGaAg~gia~ll~~~~~~~-G~~~eeA~~~i  319 (555)
T 1gq2_A          241 FRLLHKYRNKYCTFNDDIQGTASVAVAGLLAALRITKNRLSDHTVLFQGAGEAALGIANLIVMAMQKE-GVSKEEAIKRI  319 (555)
T ss_dssp             HHHHHHHTTTSEEEETTTHHHHHHHHHHHHHHHHHHTSCGGGCCEEEECCSHHHHHHHHHHHHHHHHH-TCCHHHHHTTE
T ss_pred             HHHHHHHhccCCEecCccchHHHHHHHHHHHHHHHhCCChhhcEEEEECCCHHHHHHHHHHHHHHHHc-CCChHHHhCcE
Confidence            99999999999999999999999999999999999999999999999999999999999999999885 99999999999


Q ss_pred             EEEcCCCccccCCcCCCChhhhhhccccCCCCCHHHhhcccCCcEEEeccCCCCCCCHHHHHHHhcCCCCcEEEEcCCCC
Q 012553          370 CLVDSKGLIVSSRKDSLQHFKKPWAHEHEPVNNLLDAVKVIKPTILIGSSGVGRTFTKEVIEAMASFNEVVFQALLWLIR  449 (461)
Q Consensus       370 ~lvDs~GLi~~~R~~~L~~~k~~fA~~~~~~~~L~eaV~~vkptvLIG~S~~~g~Ft~evv~~Ma~~~erPIIF~Lsnp~  449 (461)
                      ||||++|||+++|.+ |+++|++||++.++.++|+|||+++|||||||+|+++|+||||||++|+++|+||||||||||+
T Consensus       320 ~~~D~~Gli~~~r~~-l~~~k~~~A~~~~~~~~L~eav~~vkp~vlIG~S~~~g~ft~evv~~Ma~~~~~PIIFaLSNPt  398 (555)
T 1gq2_A          320 WMVDSKGLIVKGRAS-LTPEKEHFAHEHCEMKNLEDIVKDIKPTVLIGVAAIGGAFTQQILQDMAAFNKRPIIFALSNPT  398 (555)
T ss_dssp             EEEETTEECBTTCSS-CCTTGGGGCBSCCCCCCHHHHHHHHCCSEEEECSCCTTCSCHHHHHHHHHHCSSCEEEECCSSG
T ss_pred             EEEECCCeeeCCCCC-chHHHHHHHhhcCCCCCHHHHHhhcCCCEEEEecCCCCCCCHHHHHHHHhcCCCCEEEECCCCC
Confidence            999999999999965 9999999999877778999999999999999999999999999999999999999999999999


Q ss_pred             chhhhhh
Q 012553          450 KFNFCSL  456 (461)
Q Consensus       450 ~~~~~~~  456 (461)
                      .+.||.-
T Consensus       399 ~~aE~~p  405 (555)
T 1gq2_A          399 SKAECTA  405 (555)
T ss_dssp             GGCSSCH
T ss_pred             CccCcCH
Confidence            9999963
>1pj3_A NAD-dependent malic enzyme, mitochondrial; oxidative decarboxylase, oxidoreductase; HET: NAD; 2.10A {Homo sapiens} SCOP: c.2.1.7 c.58.1.3 PDB: 1pj2_A* 1do8_A* 1pj4_A* 1qr6_A* 1efl_A* 1pjl_A* 1efk_A* 1gz4_A* 1gz3_A* Back     alignment and structure
>1o0s_A NAD-ME, NAD-dependent malic enzyme; oxidoreductase, oxidative decarboxylase, rossmann fold, MAla dehydrogenase; HET: NAI; 2.00A {Ascaris suum} SCOP: c.2.1.7 c.58.1.3 PDB: 1llq_A* Back     alignment and structure
>3nv9_A Malic enzyme; rossmann fold, oxidoreductase; 2.25A {Entamoeba histolytica} Back     alignment and structure
>2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} Back     alignment and structure
>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Back     alignment and structure
>2dvm_A Malic enzyme, 439AA long hypothetical malate oxidoreductase; NAD, structural genomics, NPPSFA; HET: NAD MES; 1.60A {Pyrococcus horikoshii} PDB: 1ww8_A* Back     alignment and structure
>3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* Back     alignment and structure
>3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>1a4i_A Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase...; THF, bifunctional, oxidoreductase; HET: NDP; 1.50A {Homo sapiens} SCOP: c.2.1.7 c.58.1.2 PDB: 1dia_A* 1dib_A* 1dig_A* Back     alignment and structure
>3l07_A Bifunctional protein fold; structural genomics, IDP01849, methylenetetrahydrofolate dehydrogenase; 1.88A {Francisella tularensis} Back     alignment and structure
>3k92_A NAD-GDH, NAD-specific glutamate dehydrogenase; ROCG, oxidoreductase; 2.30A {Bacillus subtilis} PDB: 3k8z_A Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>4fcc_A Glutamate dehydrogenase; protein complex, rossmann fold, metabolic role, NAD, NADP, oxidoreductase; 2.00A {Escherichia coli O157} PDB: 4fhn_X 2yfg_A 3sbo_A 2yfg_E Back     alignment and structure
>3p2o_A Bifunctional protein fold; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta-alpha sandwich; HET: NAD; 2.23A {Campylobacter jejuni subsp} Back     alignment and structure
>3ngx_A Bifunctional protein fold; methylenetetrahydrofolate dehydrogenase/cyclohydrolase; 2.30A {Thermoplasma acidophilum} PDB: 3ngl_A Back     alignment and structure
>1b0a_A Protein (fold bifunctional protein); folate, dehydrogenase, cyclcohydrolase, channeling, oxidoreductase,hydrolase; 2.56A {Escherichia coli K12} SCOP: c.2.1.7 c.58.1.2 Back     alignment and structure
>3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} Back     alignment and structure
>4a5o_A Bifunctional protein fold; oxidoreductase, hydrolase; 2.20A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>3aoe_E Glutamate dehydrogenase; rossmann fold, NADH, oxidoreductase; 2.60A {Thermus thermophilus} Back     alignment and structure
>4a26_A Putative C-1-tetrahydrofolate synthase, cytoplasm; oxidoreductase, hydrolase, leishmaniasis; 2.70A {Leishmania major} Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>1edz_A 5,10-methylenetetrahydrofolate dehydrogenase; nucleotide-binding domain, monofunctional, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: c.2.1.7 c.58.1.2 PDB: 1ee9_A* Back     alignment and structure
>2yfq_A Padgh, NAD-GDH, NAD-specific glutamate dehydrogenase; oxidoreductase; 2.94A {Peptoniphilus asaccharolyticus} Back     alignment and structure
>3aog_A Glutamate dehydrogenase; NAD(H), oxidoreducta; HET: GLU; 2.10A {Thermus thermophilus HB27} PDB: 3aoe_A Back     alignment and structure
>3r3j_A Glutamate dehydrogenase; rossman fold, oxidoreductase, apicoplast; 3.10A {Plasmodium falciparum} Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 Back     alignment and structure
>2c2x_A Methylenetetrahydrofolate dehydrogenase- methenyltetrahydrofolate cyclohydrolase; NADP; 2.0A {Mycobacterium tuberculosis} PDB: 2c2y_A Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>2tmg_A Protein (glutamate dehydrogenase); metabolic role, mutant, oxidoreductase; 2.90A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.1 PDB: 1b26_A 1b3b_A Back     alignment and structure
>3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>2bma_A Glutamate dehydrogenase (NADP+); malaria, drug design, analysis, oligomer organization, oxidoreductase; 2.7A {Plasmodium falciparum} Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>1v8b_A Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2.40A {Plasmodium falciparum} SCOP: c.2.1.4 c.23.12.3 Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A* Back     alignment and structure
>2o4c_A Erythronate-4-phosphate dehydrogenase; erythronate-4-phsphate, NAD, tartrate, phosph oxidoreductase; HET: NAD TLA; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>1mld_A Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D)); HET: CIT; 1.83A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 2dfd_A* Back     alignment and structure
>1v9l_A Glutamate dehydrogenase; protein-NAD complex, oxidoreductase; HET: NAD; 2.80A {Pyrobaculum islandicum} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* Back     alignment and structure
>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Back     alignment and structure
>2i6t_A Ubiquitin-conjugating enzyme E2-like isoform A; L-lactate dehydrogenase, oxidoreductase, ubiquitin-protein L unknown function; 2.10A {Homo sapiens} PDB: 3dl2_A Back     alignment and structure
>2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} Back     alignment and structure
>3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>3u95_A Glycoside hydrolase, family 4; hydrolysis, cytosol; 2.00A {Thermotoga neapolitana} PDB: 1vjt_A* Back     alignment and structure
>3oet_A Erythronate-4-phosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.36A {Salmonella enterica subsp} Back     alignment and structure
>1o6z_A MDH, malate dehydrogenase; halophilic, ION-binding, protein-solvent interaction, oxidoreductase; HET: NAD; 1.95A {Haloarcula marismortui} SCOP: c.2.1.5 d.162.1.1 PDB: 1gt2_A* 2x0r_A* 2j5k_A 2j5q_A 2j5r_A 1d3a_A 1hlp_A* 2hlp_A Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>1b8p_A Protein (malate dehydrogenase); oxidoreductase; 1.90A {Aquaspirillum arcticum} SCOP: c.2.1.5 d.162.1.1 PDB: 1b8u_A* 1b8v_A* 3d5t_A Back     alignment and structure
>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>1bgv_A Glutamate dehydrogenase; oxidoreductase; HET: GLU; 1.90A {Clostridium symbiosum} SCOP: c.2.1.7 c.58.1.1 PDB: 1hrd_A 1k89_A 1aup_A 2yfh_A Back     alignment and structure
>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} Back     alignment and structure
>1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* Back     alignment and structure
>1gtm_A Glutamate dehydrogenase; oxidoreductase, NAD, NADP; 2.20A {Pyrococcus furiosus} SCOP: c.2.1.7 c.58.1.1 PDB: 1bvu_A 1euz_A Back     alignment and structure
>1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* Back     alignment and structure
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Back     alignment and structure
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Back     alignment and structure
>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Back     alignment and structure
>2zqz_A L-LDH, L-lactate dehydrogenase; oxidoreductase, rossmann fold, cytoplasm, glycolysis, NAD, phosphoprotein; 2.50A {Lactobacillus casei} PDB: 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>1ez4_A Lactate dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.30A {Lactobacillus pentosus} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>3h5n_A MCCB protein; ubiquitin-activating enzyme, microcin, protein structure, MCCC7, peptide antibiotics, N-P bond formation, transferase; HET: ATP; 1.90A {Escherichia coli} PDB: 3h5r_A 3h9g_A 3h9j_A* 3h9q_A 3h5a_A Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Back     alignment and structure
>1c1d_A L-phenylalanine dehydrogenase; amino acid dehydrogenase, oxidative deamination mechanism, oxidoreductase; HET: PHE NAD; 1.25A {Rhodococcus SP} SCOP: c.2.1.7 c.58.1.1 PDB: 1bw9_A* 1c1x_A* 1bw9_B* 1c1d_B* 1c1x_B* 1bxg_B* 1bxg_A* Back     alignment and structure
>1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A* Back     alignment and structure
>3fef_A Putative glucosidase LPLD; gulosidase, structural genomics, unknown function, glycosidase, hydrolase, manganese, metal-binding, NAD, PSI- 2; 2.20A {Bacillus subtilis} Back     alignment and structure
>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Back     alignment and structure
>1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* Back     alignment and structure
>4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP} Back     alignment and structure
>1xdw_A NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans} Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>1obb_A Maltase, alpha-glucosidase; glycosidase, sulfinic acid, NAD+, maltose, hydrolase; HET: MAL NAD; 1.90A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* Back     alignment and structure
>1hye_A L-lactate/malate dehydrogenase; nucleotide binding domain, oxidoreductase; HET: NAP; 1.90A {Methanocaldococcus jannaschii} SCOP: c.2.1.5 d.162.1.1 PDB: 1hyg_A* Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Back     alignment and structure
>2xxj_A L-LDH, L-lactate dehydrogenase; oxidoreductase, hyperthermophIle; HET: NAD; 1.964A {Thermus thermophilus} PDB: 2xxb_A* 3zzn_A* 2v7p_A* 2e37_A* 2v6m_A* 2xxe_A 4a73_A Back     alignment and structure
>1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* Back     alignment and structure
>3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A Back     alignment and structure
>3nep_X Malate dehydrogenase; halophIle, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle; 1.55A {Salinibacter ruber} Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>1smk_A Malate dehydrogenase, glyoxysomal; tricarboxylic cycle, glyoxysome, NAD, glyoxylate bypass, oxidoreductase; HET: CIT; 2.50A {Citrullus lanatus} PDB: 1sev_A Back     alignment and structure
>3mw9_A GDH 1, glutamate dehydrogenase 1; allostery, inhibition, oxidoreducta; HET: GLU GTP NAD; 2.40A {Bos taurus} SCOP: c.2.1.7 c.58.1.1 PDB: 3mvo_A* 3mvq_A* 3qmu_A* 3etd_A* 3ete_A* 3etg_A* 1l1f_A 1nr1_A 1nr7_A 1nqt_A 1hwx_A* 1hwy_A* 1hwz_A* Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>1s6y_A 6-phospho-beta-glucosidase; hydrolase, structural genomics, PSI, protein structure initi midwest center for structural genomics; 2.31A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>1x0v_A GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic; two independent domains, GXGXXG motif, oxidoreductase; 2.30A {Homo sapiens} PDB: 1x0x_A* 1wpq_A* 2pla_A* Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structur genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus} Back     alignment and structure
>1up7_A 6-phospho-beta-glucosidase; hydrolase, family4 hydrolase, Na dependent; HET: G6P NAD; 2.4A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.2 PDB: 1up6_A* 1up4_A Back     alignment and structure
>1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 Back     alignment and structure
>3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Back     alignment and structure
>1qp8_A Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A {Pyrobaculum aerophilum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} Back     alignment and structure
>3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A Back     alignment and structure
>4hy3_A Phosphoglycerate oxidoreductase; PSI-biology, structural genomics, protein structure initiati acid transport and metabolism, NAD binding domain.; 2.80A {Rhizobium etli} Back     alignment and structure
>2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} Back     alignment and structure
>1j4a_A D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp} SCOP: c.2.1.4 c.23.12.1 PDB: 1j49_A* 2dld_A* Back     alignment and structure
>2yq5_A D-isomer specific 2-hydroxyacid dehydrogenase; oxidoreductase; HET: NAD; 2.75A {Lactobacillus delbrueckii subsp} PDB: 2yq4_A* Back     alignment and structure
>3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* Back     alignment and structure
>4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>1dxy_A D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarboxylate dehydrogenase, D-lactate dehydrogenas oxidoreductase; HET: NAD; 1.86A {Lactobacillus casei} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>1u8x_X Maltose-6'-phosphate glucosidase; structural genomics, PSI, protein structure initiative, MCSG glucosidase, NAD-dependent; HET: G6P NAD; 2.05A {Bacillus subtilis} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>1yj8_A Glycerol-3-phosphate dehydrogenase; SGPP, structural genomics, PSI; 2.85A {Plasmodium falciparum} Back     alignment and structure
>4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... Back     alignment and structure
>2d4a_B Malate dehydrogenase; archaea, hyperthermophIle, oxidoreductase; 2.87A {Aeropyrum pernix} Back     alignment and structure
>4gsl_A Ubiquitin-like modifier-activating enzyme ATG7; ubiquitin-like protein activation enzyme, ubiquitin-like Pro transfer enzyme, protein transport; 2.70A {Saccharomyces cerevisiae} PDB: 3vh2_A 4gsk_A 3vh1_A Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} Back     alignment and structure
>3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} Back     alignment and structure
>3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} Back     alignment and structure
>3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B Back     alignment and structure
>4fgw_A Glycerol-3-phosphate dehydrogenase [NAD(+)] 1; oxidoreductase; 2.45A {Saccharomyces cerevisiae} Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>2qrj_A Saccharopine dehydrogenase, NAD+, L-lysine- forming; sulfate, rossmann fold, alpha-aminoadipate pathway, fungal lysine biosynthesis; 1.60A {Saccharomyces cerevisiae} PDB: 2qrk_A* 2qrl_A* 2q99_A 3ugk_A 3uh1_A* 3uha_A* Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} Back     alignment and structure
>1npy_A Hypothetical shikimate 5-dehydrogenase-like protein HI0607; structural genomics, PSI, protein structure initiative; 1.75A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} Back     alignment and structure
>1y7t_A Malate dehydrogenase; NAD-dependent-MDH-NADPH complex, oxidoreductase; HET: NDP; 1.65A {Thermus thermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1iz9_A* 2cvq_A* 1bmd_A* 1bdm_A* 1wze_A* 1wzi_A* Back     alignment and structure
>2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* Back     alignment and structure
>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>2i99_A MU-crystallin homolog; thyroid hormine binding protein, oxidoreductase; HET: NDP; 2.60A {Homo sapiens} Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* 3fn4_A Back     alignment and structure
>2x0j_A Malate dehydrogenase; oxidoreductase, hyperthermophilic, tricarboxylic acid cycle; HET: ENA; 2.79A {Archaeoglobus fulgidus dsm 4304} PDB: 2x0i_A* Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>1x7d_A Ornithine cyclodeaminase; binds NAD+, binds L-ornithine, binds L-proline, 2 bundle, beta barrel, rossmann fold, lyase; HET: NAD ORN MES; 1.60A {Pseudomonas putida} SCOP: c.2.1.13 PDB: 1u7h_A* Back     alignment and structure
>3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} Back     alignment and structure
>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A Back     alignment and structure
>1y8q_A Ubiquitin-like 1 activating enzyme E1A; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_A* 3kyc_A* 3kyd_A* Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Back     alignment and structure
>3vh1_A Ubiquitin-like modifier-activating enzyme ATG7; autophagy, zinc binding, metal binding protein; 3.00A {Saccharomyces cerevisiae} PDB: 3vh2_A Back     alignment and structure
>3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} Back     alignment and structure
>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} Back     alignment and structure
>1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepresso transcription repressor; HET: NAD; 1.95A {Homo sapiens} SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A* 3ga0_A 2ome_A* Back     alignment and structure
>1pgj_A 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; oxidoreductase, CHOH(D)-NADP+(B); 2.82A {Trypanosoma brucei} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>5mdh_A Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH(D)); HET: NAD; 2.40A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 4mdh_A* Back     alignment and structure
>3kb6_A D-lactate dehydrogenase; oxidoreductase, D-LDH, NAD, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; HET: MSE NAD 1PE; 2.12A {Aquifex aeolicus} Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A* Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>1omo_A Alanine dehydrogenase; two-domain, beta-sandwich-dimer, rossmann-fold NAD domain, human MU crystallin homolog; HET: NAD; 2.32A {Archaeoglobus fulgidus} SCOP: c.2.1.13 PDB: 1vll_A Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 461
d1o0sa2294 c.58.1.3 (A:2-295) Mitochondrial NAD(P)-dependent 1e-141
d1gq2a2257 c.58.1.3 (A:23-279) Mitochondrial NAD(P)-dependent 1e-138
d1pj3a2259 c.58.1.3 (A:21-279) Mitochondrial NAD(P)-dependent 1e-135
d1pj3a1 294 c.2.1.7 (A:280-573) Mitochondrial NAD(P)-dependent 4e-35
d1gq2a1 298 c.2.1.7 (A:280-580) Mitochondrial NAD(P)-dependent 4e-33
d1o0sa1 308 c.2.1.7 (A:296-603) Mitochondrial NAD(P)-dependent 1e-32
d1vl6a1222 c.2.1.7 (A:155-376) Malate oxidoreductase (malic e 2e-22
d1vl6a2154 c.58.1.3 (A:1-154) Malate oxidoreductase (malic en 2e-06
>d1o0sa2 c.58.1.3 (A:2-295) Mitochondrial NAD(P)-dependent malic enzyme {Pig roundworm (Ascaris suum) [TaxId: 6253]} Length = 294 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Aminoacid dehydrogenase-like, N-terminal domain
superfamily: Aminoacid dehydrogenase-like, N-terminal domain
family: Malic enzyme N-domain
domain: Mitochondrial NAD(P)-dependent malic enzyme
species: Pig roundworm (Ascaris suum) [TaxId: 6253]

 Score =  403 bits (1037), Expect = e-141
 Identities = 147/289 (50%), Positives = 197/289 (68%), Gaps = 10/289 (3%)

Query: 28  EDVYGEDRATEDQ-------LVTP-WTISVASGYCLLRDPRHNKGLAFTEKERDAHYLRG 79
           EDVY  +    D+       L  P           LL++PR NKG+ F+  ER    L G
Sbjct: 6   EDVYSHNLPPMDEKEMALYKLYRPERVTPKKRSAELLKEPRLNKGMGFSLYERQYLGLHG 65

Query: 80  LLPPAVISQQLQEKKLMNSIRQYEVPLQKYVAMMELEERNERLFYKLLIDNVEELLPVVY 139
           LLPPA ++Q+ Q  +++  +R+    L +Y+ +  L++RNE+LFY+++ D+V+EL+P+VY
Sbjct: 66  LLPPAFMTQEQQAYRVITKLREQPNDLARYIQLDGLQDRNEKLFYRVVCDHVKELMPIVY 125

Query: 140 TPTVGEACQKYGSIFRRPQGLYISLKEK--GKILEVLKNWPERSIQVIVVTDGERILGLG 197
           TPTVG ACQ +G I+R+P+GLYI++ +    KI ++L NW E  ++ IVVTDGERILGLG
Sbjct: 126 TPTVGLACQNFGYIYRKPKGLYITINDNSVSKIYQILSNWHEEDVRAIVVTDGERILGLG 185

Query: 198 DLGCQGMGIPVGKLALYTALGGIRPSACLPITVDVGTNNEQLLKDEFYIGLRQRRATGQE 257
           DLG  G+GIPVGKLALY ALGG++P  CLP+ +DVGTNN  LL D FYIGLR +R  G++
Sbjct: 186 DLGAYGIGIPVGKLALYVALGGVQPKWCLPVLLDVGTNNMDLLNDPFYIGLRHKRVRGKD 245

Query: 258 YAELLDEFMSAVKQNYGEKVLIQFEDFANHNAFELLAKYGTTHLVFNDD 306
           Y  LLD FM A  + YG+K LIQFEDFAN NAF LL KY   + +FNDD
Sbjct: 246 YDTLLDNFMKACTKKYGQKTLIQFEDFANPNAFRLLDKYQDKYTMFNDD 294
>d1gq2a2 c.58.1.3 (A:23-279) Mitochondrial NAD(P)-dependent malic enzyme {Domestic pigeon (Columba livia) [TaxId: 8932]} Length = 257 Back     information, alignment and structure
>d1pj3a2 c.58.1.3 (A:21-279) Mitochondrial NAD(P)-dependent malic enzyme {Human (Homo sapiens) [TaxId: 9606]} Length = 259 Back     information, alignment and structure
>d1pj3a1 c.2.1.7 (A:280-573) Mitochondrial NAD(P)-dependent malic enzyme {Human (Homo sapiens) [TaxId: 9606]} Length = 294 Back     information, alignment and structure
>d1gq2a1 c.2.1.7 (A:280-580) Mitochondrial NAD(P)-dependent malic enzyme {Domestic pigeon (Columba livia) [TaxId: 8932]} Length = 298 Back     information, alignment and structure
>d1o0sa1 c.2.1.7 (A:296-603) Mitochondrial NAD(P)-dependent malic enzyme {Pig roundworm (Ascaris suum) [TaxId: 6253]} Length = 308 Back     information, alignment and structure
>d1vl6a1 c.2.1.7 (A:155-376) Malate oxidoreductase (malic enzyme) {Thermotoga maritima [TaxId: 2336]} Length = 222 Back     information, alignment and structure
>d1vl6a2 c.58.1.3 (A:1-154) Malate oxidoreductase (malic enzyme) {Thermotoga maritima [TaxId: 2336]} Length = 154 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query461
d1gq2a2257 Mitochondrial NAD(P)-dependent malic enzyme {Domes 100.0
d1pj3a2259 Mitochondrial NAD(P)-dependent malic enzyme {Human 100.0
d1o0sa2294 Mitochondrial NAD(P)-dependent malic enzyme {Pig r 100.0
d1gq2a1 298 Mitochondrial NAD(P)-dependent malic enzyme {Domes 100.0
d1pj3a1 294 Mitochondrial NAD(P)-dependent malic enzyme {Human 100.0
d1o0sa1 308 Mitochondrial NAD(P)-dependent malic enzyme {Pig r 100.0
d1vl6a2154 Malate oxidoreductase (malic enzyme) {Thermotoga m 100.0
d1vl6a1222 Malate oxidoreductase (malic enzyme) {Thermotoga m 100.0
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 98.49
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 96.83
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 96.57
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 96.13
d1sc6a1188 Phosphoglycerate dehydrogenase {Escherichia coli [ 95.95
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 95.86
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 95.69
d1v9la1242 Glutamate dehydrogenase {Pyrobaculum islandicum [T 95.68
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 95.67
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 95.64
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 95.57
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 95.56
d1c1da1201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 95.5
d1b26a1234 Glutamate dehydrogenase {Thermotoga maritima [TaxI 95.49
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 95.33
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 95.16
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 95.07
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 94.95
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 94.91
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 94.89
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 94.81
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 94.7
d1obba1171 Alpha-glucosidase AglA {Thermotoga maritima [TaxId 94.62
d1vjta1193 Putative alpha-glucosidase TM0752 {Thermotoga mari 94.27
d1s6ya1169 6-phospho-beta-glucosidase {Bacillus stearothermop 94.1
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 93.99
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 93.87
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 93.87
d1gdha1191 D-glycerate dehydrogenase {Hyphomicrobium methylov 93.81
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 93.74
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 93.64
d1gtma1239 Glutamate dehydrogenase {Archaeon Pyrococcus furio 93.63
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 93.62
d1bgva1255 Glutamate dehydrogenase {Clostridium symbiosum [Ta 93.55
d1u8xx1167 Maltose-6'-phosphate glucosidase GlvA {Bacillus su 93.5
d1up7a1162 6-phospho-beta-glucosidase {Thermotoga maritima [T 93.5
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 93.36
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 93.26
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 93.21
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 93.09
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 93.06
d1b5qa1 347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 92.81
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 92.8
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 92.73
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 92.47
d1seza1 373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 92.2
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 92.17
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 92.06
d1c0pa1 268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 92.03
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 91.88
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 91.71
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 91.59
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 91.46
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 91.39
d2voua1 265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 91.36
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 91.31
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 91.26
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 91.21
d2iida1 370 L-aminoacid oxidase {Malayan pit viper (Calloselas 91.1
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 90.77
d1b0aa1166 Methylenetetrahydrofolate dehydrogenase/cyclohydro 90.49
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 90.21
d1leha1230 Leucine dehydrogenase {Bacillus sphaericus [TaxId: 90.14
d2dw4a2 449 Lysine-specific histone demethylase 1, LSD1 {Human 90.02
d1ygya1184 Phosphoglycerate dehydrogenase {Mycobacterium tube 89.35
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 89.17
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 89.02
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 88.71
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 88.59
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 88.34
d1lqta2 239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 88.23
d2bi7a1 314 UDP-galactopyranose mutase, N-terminal domain {Kle 88.22
d1cjca2 230 Adrenodoxin reductase of mitochondrial p450 system 88.19
d1w4xa1 298 Phenylacetone monooxygenase {Thermobifida fusca [T 87.46
d2bcgg1 297 Guanine nucleotide dissociation inhibitor, GDI {Ba 87.43
d1d5ta1 336 Guanine nucleotide dissociation inhibitor, GDI {Co 87.43
d2ivda1 347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 87.43
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 86.65
d2gv8a1 335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 85.91
d1a4ia1170 Methylenetetrahydrofolate dehydrogenase/cyclohydro 85.76
d1hwxa1 293 Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 85.6
d3c96a1 288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 85.35
d1pj5a2 305 N,N-dimethylglycine oxidase {Arthrobacter globifor 85.3
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 85.08
d1k0ia1 292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 84.75
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 84.68
d1pn0a1 360 Phenol hydroxylase {Soil-living yeast (Trichosporo 84.62
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 84.02
d1i8ta1 298 UDP-galactopyranose mutase, N-terminal domain {Esc 83.7
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 83.33
d2v5za1 383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 82.82
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 82.78
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 82.12
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 82.02
d1tuga1310 Aspartate carbamoyltransferase catalytic subunit { 81.98
d1diha1162 Dihydrodipicolinate reductase {Escherichia coli [T 81.73
d1ryia1 276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 81.61
d1v59a1 233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 80.76
d2i0za1 251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 80.37
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 80.25
>d1gq2a2 c.58.1.3 (A:23-279) Mitochondrial NAD(P)-dependent malic enzyme {Domestic pigeon (Columba livia) [TaxId: 8932]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Aminoacid dehydrogenase-like, N-terminal domain
superfamily: Aminoacid dehydrogenase-like, N-terminal domain
family: Malic enzyme N-domain
domain: Mitochondrial NAD(P)-dependent malic enzyme
species: Domestic pigeon (Columba livia) [TaxId: 8932]

Probab=100.00  E-value=4.7e-117  Score=856.36  Aligned_cols=257  Identities=57%  Similarity=1.046  Sum_probs=255.6

Q ss_pred             ccccccccCCCCCcCCCCCHHHHhhhccCCCCCCccccHHHHHHHHHHHhhcCCCchhHHHHHhhhhhhhhhhhHHHhhh
Q 012553           50 ASGYCLLRDPRHNKGLAFTEKERDAHYLRGLLPPAVISQQLQEKKLMNSIRQYEVPLQKYVAMMELEERNERLFYKLLID  129 (461)
Q Consensus        50 ~~G~~~l~~p~~NKG~aFt~~ER~~l~l~GLLPp~v~t~e~Q~~R~~~~~~~~~~~l~Ky~~L~~L~~~Ne~LFY~ll~~  129 (461)
                      ++|+++|+||.+|||||||.+||++|||+|||||+|+|+|+|++|||.|+++++++|+||+||++||++||+|||+++++
T Consensus         1 krG~~lL~~p~~NKGtAFt~~ER~~l~l~GLLP~~v~tle~Qv~r~~~~~~~~~~~l~Ky~yL~~L~~~Ne~LFY~ll~~   80 (257)
T d1gq2a2           1 KKGYEVLRDPHLNKGMAFTLEERQQLNIHGLLPPCFLGQDAQVYSILKNFERLTSDLDRYILLMSLQDRNEKLFYKVLTS   80 (257)
T ss_dssp             CCTTHHHHCTTTCCGGGSCHHHHHHTTCTTSSCSCBCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCHHHHHHHHHH
T ss_pred             CChHHHhcCCCccCccCCCHHHHHHcCCccCCCCCccCHHHHHHHHHHHHHhcCCcHHHHHHHHHHHHhChHHHHHHHHH
Confidence            48999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cccccCCcccccchHHHHHHHhhhhcCCCcccccccCcchHHHHHhcCCCCCeeEEEEecCceeeccCCCCCCccccchh
Q 012553          130 NVEELLPVVYTPTVGEACQKYGSIFRRPQGLYISLKEKGKILEVLKNWPERSIQVIVVTDGERILGLGDLGCQGMGIPVG  209 (461)
Q Consensus       130 ~~ee~lpivYTPtVg~ac~~~s~i~r~p~glyis~~d~g~i~~~l~nwp~~~v~viVVTDG~rILGLGDlG~~GmgI~~G  209 (461)
                      |++|+||||||||||+||++||++||+|+|||||++|+|+|+++|+|||.++|++||||||+|||||||+|++|||||+|
T Consensus        81 ~~~e~~PivYTPTVG~Ac~~ys~~yr~prGlyis~~d~g~i~~il~nwp~~~V~~iVVTDG~rILGlGD~G~~Gm~I~~g  160 (257)
T d1gq2a2          81 DIERFMPIVYTPTVGLACQHYGLAFRRPRGLFITIHDRGHIATMLQSWPESVIKAIVVTDGERILGLGDLGCYGMGIPVG  160 (257)
T ss_dssp             THHHHHHHHSTTHHHHHHHTHHHHCSSCCSEEEEGGGTTCHHHHHHTSSCSCCCEEEEECSSSCGGGCCCGGGGGHHHHH
T ss_pred             HHHHhcCcccCccHHHHHHHHhhhhccccceeeccCChHHHHHHHHhCCCCCeeEEEEecCceeeecCCcCcCccchhhh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhhHHHhhCCCCCCceeeEEeecCCCchhcccCcccccccccCCChhhhHHHHHHHHHHHHHhcCCCeeeeeecCCcccH
Q 012553          210 KLALYTALGGIRPSACLPITVDVGTNNEQLLKDEFYIGLRQRRATGQEYAELLDEFMSAVKQNYGEKVLIQFEDFANHNA  289 (461)
Q Consensus       210 Kl~Ly~a~gGI~P~~~lPI~LDvGTnne~LL~Dp~YlG~r~~R~~g~~Y~~~idefv~av~~~fGp~~lIq~EDf~~~~a  289 (461)
                      |++|||+||||||++|||||||||||||+||+||+|+|+||+|++|++|++||||||+||+++|||+++||||||+++||
T Consensus       161 Kl~lyta~~Gi~P~~~LPv~LDvGTnNe~LL~DP~YlG~R~~R~~g~eY~~fvdefv~av~~~~p~~~~i~~EDf~~~na  240 (257)
T d1gq2a2         161 KLALYTACGGVKPHQCLPVMLDVGTDNETLLKDPLYIGLRHKRIRGQAYDDLLDEFMEAVTSRYGMNCLIQFEDFANANA  240 (257)
T ss_dssp             HHHHHHHTTCCCGGGEEEEEEESCCCCHHHHHCTTCCSCSSCCCCTHHHHHHHHHHHHHHHHHHCTTCEEEECSCCHHHH
T ss_pred             HHHHHHHhcCCCHhhcCCeeecCCCChHHHhcCcccccccCCCCcchHHHHHHHHHHHHHHHhCCCCCEEehhhcCCchH
Confidence            99999999999999999999999999999999999999999999999999999999999999998899999999999999


Q ss_pred             HHHHHHHcCCCceeccC
Q 012553          290 FELLAKYGTTHLVFNDD  306 (461)
Q Consensus       290 f~iL~ryr~~~~~FnDD  306 (461)
                      |++|+|||+++||||||
T Consensus       241 ~~~L~~yr~~~~~FNDD  257 (257)
T d1gq2a2         241 FRLLHKYRNKYCTFNDD  257 (257)
T ss_dssp             HHHHHHHTTTSEEEETT
T ss_pred             HHHHHHHccCCCccCCC
Confidence            99999999999999999
>d1pj3a2 c.58.1.3 (A:21-279) Mitochondrial NAD(P)-dependent malic enzyme {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o0sa2 c.58.1.3 (A:2-295) Mitochondrial NAD(P)-dependent malic enzyme {Pig roundworm (Ascaris suum) [TaxId: 6253]} Back     information, alignment and structure
>d1gq2a1 c.2.1.7 (A:280-580) Mitochondrial NAD(P)-dependent malic enzyme {Domestic pigeon (Columba livia) [TaxId: 8932]} Back     information, alignment and structure
>d1pj3a1 c.2.1.7 (A:280-573) Mitochondrial NAD(P)-dependent malic enzyme {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o0sa1 c.2.1.7 (A:296-603) Mitochondrial NAD(P)-dependent malic enzyme {Pig roundworm (Ascaris suum) [TaxId: 6253]} Back     information, alignment and structure
>d1vl6a2 c.58.1.3 (A:1-154) Malate oxidoreductase (malic enzyme) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vl6a1 c.2.1.7 (A:155-376) Malate oxidoreductase (malic enzyme) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v9la1 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d1b26a1 c.2.1.7 (A:179-412) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d1obba1 c.2.1.5 (A:2-172) Alpha-glucosidase AglA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1s6ya1 c.2.1.5 (A:4-172) 6-phospho-beta-glucosidase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1gtma1 c.2.1.7 (A:181-419) Glutamate dehydrogenase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bgva1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} Back     information, alignment and structure
>d1u8xx1 c.2.1.5 (X:3-169) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1up7a1 c.2.1.5 (A:1-162) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1a4ia1 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1tuga1 c.78.1.1 (A:1-150,A:151-310) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1diha1 c.2.1.3 (A:2-130,A:241-273) Dihydrodipicolinate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure