Citrus Sinensis ID: 012718


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------46
MEAVVPKLASFNLLNPKSKSKSAIRRFSSALCVSSSPSVTSTDSVSLGHITRPDFPILHQEVYGSKKLVYLDNAATSQKPIAVLKALQNYYEAYNSNVHRGIHFLSAKATDEYELARKKVAAFINASDSGEIVFTKNATEAINLVAYSWGLSNLKSGDEVILTVAEHHSAIVPWQLVAQKTGANLKFLNLNDDESPDLDKLKEMLSRKTKLVVIHHISNMLASILPIEEIVHWSHDVGAKVLVDACQSVPHMVVDVQGLDADFLVASSHKMCGPTGIGFLFGKSDLLSAMPPFLGGGEMISDVFLDHSTFADPPSRFEAGTPAIGEAIGLGAAIDYLSTIGMQKIHAYEMELAKYLYENLLSIPNIRIYGPKPSEHVQRAALCSFNVENIHPTDIATLLDQQYGVATRSGHHCAQPLHRYLGVNASARASLHFYNTKEDVDEFIHALNETVSFFNVFK
ccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccEEEEEcccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEccHHHHHHHHHHHHHHcccccccEEEEccccccccccHHHHHHHHHccEEEEEEccccccccHHHHHHHccccccEEEEEEEccccccccHHHHHHHHHHHcccEEEEEccccccccccccccccccEEEEccccccccccccHHHcHHHHHHcccccccccccccEEEccccccccccccccccccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHcccccEEEEccccccccccEEEEEEEcccccHHHHHHHHcccccEEEccccccHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHccc
ccEEEccccccccccccccccccccccccHccccccccccccccHHHHHHHHHHccHHccEcccccccEEccccccccccHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHcccccHHHEEEEccHHHHHHHHHHHcHHHHcccccEEEEEccccHHHcHHHHHHHHHHccEEEEEcEcccccEcHHHHHHHccccEEEEEEEcEccccccEccHHHHHHHHHHcccEEEEEcccccccccccHHHHcccEEEEEHHHcccccccEEEEEcHHHHHHccccccccccEEEEEcccEEEccccHHHccccccHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHcccccEEEEccccccccccEEEEEEEcccccHccHHHHHHHHccEEcEEEccccHHHHHHcccccEEEEEccccccHHHHHHHHHHHHHHHHHHHHcc
meavvpklasfnllnpksksksAIRRFSSalcvssspsvtstdsvslghitrpdfpilhqevygskklvyldnaatsqKPIAVLKALQNYYEAYNSNVHRGIHFLSAKATDEYELARKKVAAFINASDSGEIVFTKNATEAINLVAYSWglsnlksgdEVILTVAEHHSAIVPWQLVAQKTGAnlkflnlnddespdlDKLKEMLSRKTKLVVIHHISNMLASILPIEEIVHWSHDVGAKVLVDACQSVPHMVVDVQGLDADFLVAsshkmcgptgigflfgksdllsamppflgggemisdvfldhstfadppsrfeagtpaiGEAIGLGAAIDYLSTIGMQKIHAYEMELAKYLYENLlsipniriygpkpsehVQRAALCsfnvenihptdiATLLDQqygvatrsghhcaqplhrylgvnaSARASlhfyntkeDVDEFIHALNETVSFFNVFK
meavvpklasfnllnpksksksaIRRFSsalcvssspsvtstdsvslghitrpdfpilHQEVYGSKKLVYLDNAATSQKPIAVLKALQNYYEAYNSNVHRGIHFLSAKATDEYELARKKVAAFINASDSGEIVFTKNATEAINLVAYSWGLSNLKSGDEVILTVAEHHSAIVPWQLVAQKTGANLKFLNLNDDESPDLDKLKEMLSRKTKLVVIHHISNMLASILPIEEIVHWSHDVGAKVLVDACQSVPHMVVDVQGLDADFLVASSHKMCGPTGIGFLFGKSDLLSAMPPFLGGGEMISDVFLDHSTFADPPSRFEAGTPAIGEAIGLGAAIDYLSTIGMQKIHAYEMELAKYLYENLLSIPNIRIYGPKPSEHVQRAALCSFNVENIHPTDIATLLDQQYGVATRSGHHCAQPLHRYLGVNASARASLHFYNTKEDVDEFIHALNETvsffnvfk
MEAVVPKLASFNLLNPKSKSKSAIRRFssalcvssspsvtstdsvsLGHITRPDFPILHQEVYGSKKLVYLDNAATSQKPIAVLKALQNYYEAYNSNVHRGIHFLSAKATDEYELARKKVAAFINASDSGEIVFTKNATEAINLVAYSWGLSNLKSGDEVILTVAEHHSAIVPWQLVAQKTGANLKFLNLNDDESPDLDKLKEMLSRKTKLVVIHHISNMLASILPIEEIVHWSHDVGAKVLVDACQSVPHMVVDVQGLDADFLVASSHKMCGPTGIGFLFGKSDLLSAMPPFLGGGEMISDVFLDHSTFADPPSRFEAGTPaigeaiglgaaiDYLSTIGMQKIHAYEMELAKYLYENLLSIPNIRIYGPKPSEHVQRAALCSFNVENIHPTDIATLLDQQYGVATRSGHHCAQPLHRYLGVNASARASLHFYNTKEDVDEFIHALNETVSFFNVFK
*********************************************SLGHITRPDFPILHQEVYGSKKLVYLDNAATSQKPIAVLKALQNYYEAYNSNVHRGIHFLSAKATDEYELARKKVAAFINASDSGEIVFTKNATEAINLVAYSWGLSNLKSGDEVILTVAEHHSAIVPWQLVAQKTGANLKFLNLN************MLSRKTKLVVIHHISNMLASILPIEEIVHWSHDVGAKVLVDACQSVPHMVVDVQGLDADFLVASSHKMCGPTGIGFLFGKSDLLSAMPPFLGGGEMISDVFLDHSTFADPPSRFEAGTPAIGEAIGLGAAIDYLSTIGMQKIHAYEMELAKYLYENLLSIPNIRIYGPKPSEHVQRAALCSFNVENIHPTDIATLLDQQYGVATRSGHHCAQPLHRYLGVNASARASLHFYNTKEDVDEFIHALNETVSFFNVF*
**********************************************LGHITRPDFPILHQEVYGSKKLVYLDNAATSQKPIAVLKALQNYYEAYNSNVHRGIHFLSAKATDEYELARKKVAAFINASDSGEIVFTKNATEAINLVAYSWGLSNLKSGDEVILTVAEHHSAIVPWQLVAQKTGANLKFLNLNDDESPDLDKLKEMLSRKTKLVVIHHISNMLASILPIEEIVHWSHDVGAKVLVDACQSVPHMVVDVQGLDADFLVASSHKMCGPTGIGFLFGKSDLLSAMPPFLGGGEMISDVFLDHSTFADPPSRFEAGTPAIGEAIGLGAAIDYLSTIGMQKIHAYEMELAKYLYENLLSIPNIRIYGPKPSEHVQRAALCSFNVENIHPTDIATLLDQQYGVATRSGHHCAQPLHRYLGVNASARASLHFYNTKEDVDEFIHALNETVSFFNVFK
MEAVVPKLASFNLLNPKSKSKSAIRRFS*****************SLGHITRPDFPILHQEVYGSKKLVYLDNAATSQKPIAVLKALQNYYEAYNSNVHRGIHFLSAKATDEYELARKKVAAFINASDSGEIVFTKNATEAINLVAYSWGLSNLKSGDEVILTVAEHHSAIVPWQLVAQKTGANLKFLNLNDDESPDLDKLKEMLSRKTKLVVIHHISNMLASILPIEEIVHWSHDVGAKVLVDACQSVPHMVVDVQGLDADFLVASSHKMCGPTGIGFLFGKSDLLSAMPPFLGGGEMISDVFLDHSTFADPPSRFEAGTPAIGEAIGLGAAIDYLSTIGMQKIHAYEMELAKYLYENLLSIPNIRIYGPKPSEHVQRAALCSFNVENIHPTDIATLLDQQYG********CAQPLHRYLGVNASARASLHFYNTKEDVDEFIHALNETVSFFNVFK
*EAV*PKLASFNLL*****************************SVSLGHITRPDFPILHQEVYGSKKLVYLDNAATSQKPIAVLKALQNYYEAYNSNVHRGIHFLSAKATDEYELARKKVAAFINASDSGEIVFTKNATEAINLVAYSWGLSNLKSGDEVILTVAEHHSAIVPWQLVAQKTGANLKFLNLNDDESPDLDKLKEMLSRKTKLVVIHHISNMLASILPIEEIVHWSHDVGAKVLVDACQSVPHMVVDVQGLDADFLVASSHKMCGPTGIGFLFGKSDLLSAMPPFLGGGEMISDVFLDHSTFADPPSRFEAGTPAIGEAIGLGAAIDYLSTIGMQKIHAYEMELAKYLYENLLSIPNIRIYGPKPSEHVQRAALCSFNVENIHPTDIATLLDQQYGVATRSGHHCAQPLHRYLGVNASARASLHFYNTKEDVDEFIHALNETVSFFNVFK
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEAVVPKLASFNLLNPKSKSKSAIRRFSSALCVSSSPSVTSTDSVSLGHITRPDFPILHQEVYGSKKLVYLDNAATSQKPIAVLKALQNYYEAYNSNVHRGIHFLSAKATDEYELARKKVAAFINASDSGEIVFTKNATEAINLVAYSWGLSNLKSGDEVILTVAEHHSAIVPWQLVAQKTGANLKFLNLNDDESPDLDKLKEMLSRKTKLVVIHHISNMLASILPIEEIVHWSHDVGAKVLVDACQSVPHMVVDVQGLDADFLVASSHKMCGPTGIGFLFGKSDLLSAMPPFLGGGEMISDVFLDHSTFADPPSRFEAGTPAIGEAIGLGAAIDYLSTIGMQKIHAYEMELAKYLYENLLSIPNIRIYGPKPSEHVQRAALCSFNVENIHPTDIATLLDQQYGVATRSGHHCAQPLHRYLGVNASARASLHFYNTKEDVDEFIHALNETVSFFNVFK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query458 2.2.26 [Sep-21-2011]
Q93WX6463 Cysteine desulfurase 2, c yes no 0.997 0.987 0.769 0.0
Q55793420 Probable cysteine desulfu N/A no 0.888 0.969 0.621 1e-150
O32164406 Probable cysteine desulfu yes no 0.871 0.982 0.513 1e-121
Q9K7A0406 Probable cysteine desulfu yes no 0.873 0.985 0.520 1e-118
Q9XAD5418 Probable cysteine desulfu yes no 0.895 0.980 0.494 1e-117
Q8CTA4413 Probable cysteine desulfu yes no 0.866 0.961 0.507 1e-116
Q5HQQ0413 Probable cysteine desulfu yes no 0.866 0.961 0.504 1e-115
Q8NXH0413 Probable cysteine desulfu yes no 0.866 0.961 0.509 1e-115
Q6GB11413 Probable cysteine desulfu yes no 0.866 0.961 0.509 1e-115
Q6GIH2413 Probable cysteine desulfu yes no 0.866 0.961 0.509 1e-115
>sp|Q93WX6|NFS2_ARATH Cysteine desulfurase 2, chloroplastic OS=Arabidopsis thaliana GN=NFS2 PE=1 SV=1 Back     alignment and function desciption
 Score =  716 bits (1849), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/464 (76%), Positives = 399/464 (85%), Gaps = 7/464 (1%)

Query: 1   MEAVVPKLASF-NLLNPKSKSKSAIR-----RFSSALCVSSSPSVTSTDSVSLGHITRPD 54
           ME V  KL SF N ++   +S S +R        SA   SS+   T ++SVSLGH  R D
Sbjct: 1   MEGVAMKLPSFPNAISIGHRSFSRVRCSSSLSVCSAAAASSATISTDSESVSLGHRVRKD 60

Query: 55  FPILHQEVYGSKKLVYLDNAATSQKPIAVLKALQNYYEAYNSNVHRGIHFLSAKATDEYE 114
           F ILHQEV GSK LVYLD+AATSQKP AVL ALQNYYE YNSNVHRGIH+LSAKATDE+E
Sbjct: 61  FRILHQEVNGSK-LVYLDSAATSQKPAAVLDALQNYYEFYNSNVHRGIHYLSAKATDEFE 119

Query: 115 LARKKVAAFINASDSGEIVFTKNATEAINLVAYSWGLSNLKSGDEVILTVAEHHSAIVPW 174
           LARKKVA FINASDS EIVFT+NATEAINLVAYSWGLSNLK GDEVILTVAEHHS IVPW
Sbjct: 120 LARKKVARFINASDSREIVFTRNATEAINLVAYSWGLSNLKPGDEVILTVAEHHSCIVPW 179

Query: 175 QLVAQKTGANLKFLNLNDDESPDLDKLKEMLSRKTKLVVIHHISNMLASILPIEEIVHWS 234
           Q+V+QKTGA LKF+ LN+DE PD++KL+E++S KTKLV +HH+SN+LAS LPIEEIV W+
Sbjct: 180 QIVSQKTGAVLKFVTLNEDEVPDINKLRELISPKTKLVAVHHVSNVLASSLPIEEIVVWA 239

Query: 235 HDVGAKVLVDACQSVPHMVVDVQGLDADFLVASSHKMCGPTGIGFLFGKSDLLSAMPPFL 294
           HDVGAKVLVDACQSVPHMVVDVQ L+ADFLVASSHKMCGPTGIGFL+GKSDLL +MPPFL
Sbjct: 240 HDVGAKVLVDACQSVPHMVVDVQKLNADFLVASSHKMCGPTGIGFLYGKSDLLHSMPPFL 299

Query: 295 GGGEMISDVFLDHSTFADPPSRFEAGTPAIGEAIGLGAAIDYLSTIGMQKIHAYEMELAK 354
           GGGEMISDVFLDHST+A+PPSRFEAGTPAIGEAI LGAA+DYLS IGM KIH YE+E+ K
Sbjct: 300 GGGEMISDVFLDHSTYAEPPSRFEAGTPAIGEAIALGAAVDYLSGIGMPKIHEYEVEIGK 359

Query: 355 YLYENLLSIPNIRIYGPKPSEHVQRAALCSFNVENIHPTDIATLLDQQYGVATRSGHHCA 414
           YLYE L S+P++RIYGP+PSE V R ALCSFNVE +HPTD+AT LDQQ+GVA RSGHHCA
Sbjct: 360 YLYEKLSSLPDVRIYGPRPSESVHRGALCSFNVEGLHPTDLATFLDQQHGVAIRSGHHCA 419

Query: 415 QPLHRYLGVNASARASLHFYNTKEDVDEFIHALNETVSFFNVFK 458
           QPLHRYLGVNASARASL+FYNTK+DVD FI AL +TVSFFN FK
Sbjct: 420 QPLHRYLGVNASARASLYFYNTKDDVDAFIVALADTVSFFNSFK 463




Catalyzes the removal of elemental sulfur and selenium atoms from L-cysteine, L-cystine, L-selenocysteine, and L-selenocystine to produce L-alanine. Supplies the inorganic sulfur for iron-sulfur (Fe-S) clusters.
Arabidopsis thaliana (taxid: 3702)
EC: 4EC: .EC: 4EC: .EC: 1EC: .EC: 1EC: 6
>sp|Q55793|CSD_SYNY3 Probable cysteine desulfurase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=csd PE=1 SV=1 Back     alignment and function description
>sp|O32164|CSD_BACSU Probable cysteine desulfurase OS=Bacillus subtilis (strain 168) GN=csd PE=3 SV=1 Back     alignment and function description
>sp|Q9K7A0|CSD_BACHD Probable cysteine desulfurase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=csd PE=3 SV=2 Back     alignment and function description
>sp|Q9XAD5|CSD_STRCO Probable cysteine desulfurase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=csd PE=3 SV=1 Back     alignment and function description
>sp|Q8CTA4|CSD_STAES Probable cysteine desulfurase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=csd PE=3 SV=1 Back     alignment and function description
>sp|Q5HQQ0|CSD_STAEQ Probable cysteine desulfurase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=csd PE=3 SV=1 Back     alignment and function description
>sp|Q8NXH0|CSD_STAAW Probable cysteine desulfurase OS=Staphylococcus aureus (strain MW2) GN=csd PE=3 SV=1 Back     alignment and function description
>sp|Q6GB11|CSD_STAAS Probable cysteine desulfurase OS=Staphylococcus aureus (strain MSSA476) GN=csd PE=3 SV=1 Back     alignment and function description
>sp|Q6GIH2|CSD_STAAR Probable cysteine desulfurase OS=Staphylococcus aureus (strain MRSA252) GN=csd PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query458
255564466469 cysteine desulfurylase, putative [Ricinu 0.997 0.974 0.789 0.0
225435925463 PREDICTED: cysteine desulfurase 2, chlor 0.993 0.982 0.794 0.0
356555847468 PREDICTED: cysteine desulfurase 2, chlor 0.986 0.965 0.771 0.0
224106029469 predicted protein [Populus trichocarpa] 1.0 0.976 0.756 0.0
449444833485 PREDICTED: cysteine desulfurase 2, chlor 0.989 0.934 0.746 0.0
297849158466 hypothetical protein ARALYDRAFT_470910 [ 0.997 0.980 0.762 0.0
22329419463 cysteine desulfurase 2 [Arabidopsis thal 0.997 0.987 0.769 0.0
116789873485 unknown [Picea sitchensis] 0.956 0.903 0.735 0.0
6664318526 T27G7.17 [Arabidopsis thaliana] 0.997 0.868 0.677 0.0
212274653460 uncharacterized protein LOC100191757 [Ze 0.936 0.932 0.714 0.0
>gi|255564466|ref|XP_002523229.1| cysteine desulfurylase, putative [Ricinus communis] gi|223537525|gb|EEF39150.1| cysteine desulfurylase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  761 bits (1964), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/466 (78%), Positives = 414/466 (88%), Gaps = 9/466 (1%)

Query: 1   MEAVVPKLASFNLLNPKSKSKSA---IRRFSSALCVSSSPSVTSTD-----SVSLGHITR 52
           M+ VV KL S  LLNPKS + S+   + +FSS    + + + T  D     S+SLGHITR
Sbjct: 5   MDGVVFKLPSIKLLNPKSTTHSSPIRLAKFSSFAIPALATTGTEGDQALHASLSLGHITR 64

Query: 53  PDFPILHQEVYGSKKLVYLDNAATSQKPIAVLKALQNYYEAYNSNVHRGIHFLSAKATDE 112
           PDFPILHQEV GSK LVYLDNAATSQKP +VLKA+QNYYE+YNSNVHRGIH+LSAKATDE
Sbjct: 65  PDFPILHQEVNGSK-LVYLDNAATSQKPNSVLKAIQNYYESYNSNVHRGIHYLSAKATDE 123

Query: 113 YELARKKVAAFINASDSGEIVFTKNATEAINLVAYSWGLSNLKSGDEVILTVAEHHSAIV 172
           YELARKKVAAFINASDS EIVFT+NATEAINLVAYSWG +NLK GDEVILT+AEHHS IV
Sbjct: 124 YELARKKVAAFINASDSREIVFTRNATEAINLVAYSWGFTNLKPGDEVILTLAEHHSNIV 183

Query: 173 PWQLVAQKTGANLKFLNLNDDESPDLDKLKEMLSRKTKLVVIHHISNMLASILPIEEIVH 232
           PWQLVA +TGA L+F++LN++E PD+ KLKE +S KTKLVV+HHISN+LAS LP+E+I+H
Sbjct: 184 PWQLVANRTGAVLRFVDLNENEVPDVLKLKETISEKTKLVVVHHISNVLASFLPVEDIIH 243

Query: 233 WSHDVGAKVLVDACQSVPHMVVDVQGLDADFLVASSHKMCGPTGIGFLFGKSDLLSAMPP 292
           W+H  GAKVL+DACQSVPHMVVDVQGLDADFLVASSHKMCGPTGIGFL+GKSD+LS MPP
Sbjct: 244 WAHGAGAKVLIDACQSVPHMVVDVQGLDADFLVASSHKMCGPTGIGFLYGKSDILSTMPP 303

Query: 293 FLGGGEMISDVFLDHSTFADPPSRFEAGTPAIGEAIGLGAAIDYLSTIGMQKIHAYEMEL 352
           FLGGGEMI+DVFLDHST+ADPPSRFEAGTPAIGEAIGLGAAIDYL  IGMQKIH YEMEL
Sbjct: 304 FLGGGEMIADVFLDHSTYADPPSRFEAGTPAIGEAIGLGAAIDYLLGIGMQKIHDYEMEL 363

Query: 353 AKYLYENLLSIPNIRIYGPKPSEHVQRAALCSFNVENIHPTDIATLLDQQYGVATRSGHH 412
           A YLYE+L S+P++RIYGPKPSE+V RAALCSFNVENIHPTDIAT LDQQ+GVA RSGHH
Sbjct: 364 ANYLYESLSSVPSVRIYGPKPSENVHRAALCSFNVENIHPTDIATFLDQQHGVAIRSGHH 423

Query: 413 CAQPLHRYLGVNASARASLHFYNTKEDVDEFIHALNETVSFFNVFK 458
           CAQPLHR+LGVNASARASLHFYNTKEDVD+FI ALN+T++FFN FK
Sbjct: 424 CAQPLHRHLGVNASARASLHFYNTKEDVDDFIQALNDTINFFNSFK 469




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225435925|ref|XP_002267920.1| PREDICTED: cysteine desulfurase 2, chloroplastic [Vitis vinifera] gi|296083920|emb|CBI24308.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356555847|ref|XP_003546241.1| PREDICTED: cysteine desulfurase 2, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|224106029|ref|XP_002314018.1| predicted protein [Populus trichocarpa] gi|222850426|gb|EEE87973.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449444833|ref|XP_004140178.1| PREDICTED: cysteine desulfurase 2, chloroplastic-like [Cucumis sativus] gi|449481029|ref|XP_004156061.1| PREDICTED: cysteine desulfurase 2, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|297849158|ref|XP_002892460.1| hypothetical protein ARALYDRAFT_470910 [Arabidopsis lyrata subsp. lyrata] gi|297338302|gb|EFH68719.1| hypothetical protein ARALYDRAFT_470910 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|22329419|ref|NP_172325.2| cysteine desulfurase 2 [Arabidopsis thaliana] gi|75249321|sp|Q93WX6.1|NFS2_ARATH RecName: Full=Cysteine desulfurase 2, chloroplastic; AltName: Full=NIFS-like protein; AltName: Full=Plastid sufS-like protein; AltName: Full=Protein AtCpNifS; AltName: Full=Selenocysteine lyase; Flags: Precursor gi|16152176|gb|AAL14994.1|AF419347_1 NIFS-like protein CpNifsp precursor [Arabidopsis thaliana] gi|20453112|gb|AAM19798.1| At1g08490/T27G7_14 [Arabidopsis thaliana] gi|23506185|gb|AAN31104.1| At1g08490/T27G7_14 [Arabidopsis thaliana] gi|27085243|gb|AAL79956.1| cysteine desulfurase [Arabidopsis thaliana] gi|332190177|gb|AEE28298.1| cysteine desulfurase 2 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|116789873|gb|ABK25420.1| unknown [Picea sitchensis] Back     alignment and taxonomy information
>gi|6664318|gb|AAF22900.1|AC006932_17 T27G7.17 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|212274653|ref|NP_001130656.1| uncharacterized protein LOC100191757 [Zea mays] gi|194689756|gb|ACF78962.1| unknown [Zea mays] gi|223949161|gb|ACN28664.1| unknown [Zea mays] gi|238011162|gb|ACR36616.1| unknown [Zea mays] gi|413924704|gb|AFW64636.1| hypothetical protein ZEAMMB73_601161 [Zea mays] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query458
TAIR|locus:2201856463 CPNIFS "chloroplastic NIFS-lik 0.997 0.987 0.730 5.7e-178
TIGR_CMR|BA_5215406 BA_5215 "cysteine desulfurase 0.875 0.987 0.506 8.3e-106
TIGR_CMR|CBU_1357405 CBU_1357 "selenocysteine lyase 0.866 0.980 0.449 5e-92
UNIPROTKB|Q9EXP2412 sufS "Cysteine desulfurase" [D 0.851 0.946 0.454 1.5e-90
UNIPROTKB|P77444406 sufS [Escherichia coli K-12 (t 0.849 0.958 0.453 2e-88
UNIPROTKB|P63516417 csd "Probable cysteine desulfu 0.866 0.952 0.444 9.9e-87
UNIPROTKB|Q9KPQ7404 csd "Probable cysteine desulfu 0.858 0.972 0.422 4.9e-85
TIGR_CMR|VC_2309404 VC_2309 "aminotransferase, cla 0.858 0.972 0.422 4.9e-85
TIGR_CMR|SPO_2014406 SPO_2014 "cysteine desulfurase 0.849 0.958 0.422 1.2e-81
UNIPROTKB|Q8EAV2456 sufS "Cysteine desulfurase" [S 0.847 0.850 0.435 5.4e-79
TAIR|locus:2201856 CPNIFS "chloroplastic NIFS-like cysteine desulfurase" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1728 (613.3 bits), Expect = 5.7e-178, P = 5.7e-178
 Identities = 339/464 (73%), Positives = 377/464 (81%)

Query:     1 MEAVVPKLASF-NLLNPKSKSKSAIR-----RFXXXXXXXXXXXXXXXXXXXLGHITRPD 54
             ME V  KL SF N ++   +S S +R                          LGH  R D
Sbjct:     1 MEGVAMKLPSFPNAISIGHRSFSRVRCSSSLSVCSAAAASSATISTDSESVSLGHRVRKD 60

Query:    55 FPILHQEVYGSKKLVYLDNAATSQKPIAVLKALQNYYEAYNSNVHRGIHFLSAKATDEYE 114
             F ILHQEV GSK LVYLD+AATSQKP AVL ALQNYYE YNSNVHRGIH+LSAKATDE+E
Sbjct:    61 FRILHQEVNGSK-LVYLDSAATSQKPAAVLDALQNYYEFYNSNVHRGIHYLSAKATDEFE 119

Query:   115 LARKKVAAFINASDSGEIVFTKNATEAINLVAYSWGLSNLKSGDEVILTVAEHHSAIVPW 174
             LARKKVA FINASDS EIVFT+NATEAINLVAYSWGLSNLK GDEVILTVAEHHS IVPW
Sbjct:   120 LARKKVARFINASDSREIVFTRNATEAINLVAYSWGLSNLKPGDEVILTVAEHHSCIVPW 179

Query:   175 QLVAQKTGANLKFLNLNDDESPDLDKLKEMLSRKTKLVVIHHISNMLASILPIEEIVHWS 234
             Q+V+QKTGA LKF+ LN+DE PD++KL+E++S KTKLV +HH+SN+LAS LPIEEIV W+
Sbjct:   180 QIVSQKTGAVLKFVTLNEDEVPDINKLRELISPKTKLVAVHHVSNVLASSLPIEEIVVWA 239

Query:   235 HDVGAKVLVDACQSVPHMVVDVQGLDADFLVASSHKMCGPTGIGFLFGKSDLLSAMPPFL 294
             HDVGAKVLVDACQSVPHMVVDVQ L+ADFLVASSHKMCGPTGIGFL+GKSDLL +MPPFL
Sbjct:   240 HDVGAKVLVDACQSVPHMVVDVQKLNADFLVASSHKMCGPTGIGFLYGKSDLLHSMPPFL 299

Query:   295 GGGEMISDVFLDHSTFADPPSRFEAGTPXXXXXXXXXXXXDYLSTIGMQKIHAYEMELAK 354
             GGGEMISDVFLDHST+A+PPSRFEAGTP            DYLS IGM KIH YE+E+ K
Sbjct:   300 GGGEMISDVFLDHSTYAEPPSRFEAGTPAIGEAIALGAAVDYLSGIGMPKIHEYEVEIGK 359

Query:   355 YLYENLLSIPNIRIYGPKPSEHVQRAALCSFNVENIHPTDIATLLDQQYGVATRSGHHCA 414
             YLYE L S+P++RIYGP+PSE V R ALCSFNVE +HPTD+AT LDQQ+GVA RSGHHCA
Sbjct:   360 YLYEKLSSLPDVRIYGPRPSESVHRGALCSFNVEGLHPTDLATFLDQQHGVAIRSGHHCA 419

Query:   415 QPLHRYLGVNASARASLHFYNTKEDVDEFIHALNETVSFFNVFK 458
             QPLHRYLGVNASARASL+FYNTK+DVD FI AL +TVSFFN FK
Sbjct:   420 QPLHRYLGVNASARASLYFYNTKDDVDAFIVALADTVSFFNSFK 463




GO:0003824 "catalytic activity" evidence=IEA
GO:0006534 "cysteine metabolic process" evidence=IEA
GO:0008152 "metabolic process" evidence=IEA
GO:0008483 "transaminase activity" evidence=ISS
GO:0030170 "pyridoxal phosphate binding" evidence=IEA
GO:0031071 "cysteine desulfurase activity" evidence=IEA;IDA
GO:0001887 "selenium compound metabolic process" evidence=IDA
GO:0006790 "sulfur compound metabolic process" evidence=IDA
GO:0009000 "selenocysteine lyase activity" evidence=IDA
GO:0009507 "chloroplast" evidence=IDA
GO:0018283 "iron incorporation into metallo-sulfur cluster" evidence=IDA
GO:0010269 "response to selenium ion" evidence=IMP
GO:0000302 "response to reactive oxygen species" evidence=RCA
GO:0009073 "aromatic amino acid family biosynthetic process" evidence=RCA
GO:0010039 "response to iron ion" evidence=RCA
GO:0016226 "iron-sulfur cluster assembly" evidence=RCA
GO:0055072 "iron ion homeostasis" evidence=RCA
TIGR_CMR|BA_5215 BA_5215 "cysteine desulfurase SufS" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
TIGR_CMR|CBU_1357 CBU_1357 "selenocysteine lyase" [Coxiella burnetii RSA 493 (taxid:227377)] Back     alignment and assigned GO terms
UNIPROTKB|Q9EXP2 sufS "Cysteine desulfurase" [Dickeya dadantii 3937 (taxid:198628)] Back     alignment and assigned GO terms
UNIPROTKB|P77444 sufS [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
UNIPROTKB|P63516 csd "Probable cysteine desulfurase" [Mycobacterium tuberculosis (taxid:1773)] Back     alignment and assigned GO terms
UNIPROTKB|Q9KPQ7 csd "Probable cysteine desulfurase" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms
TIGR_CMR|VC_2309 VC_2309 "aminotransferase, class V" [Vibrio cholerae O1 biovar El Tor (taxid:686)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_2014 SPO_2014 "cysteine desulfurase SufS" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
UNIPROTKB|Q8EAV2 sufS "Cysteine desulfurase" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
B5F7C4SUFS_SALA44, ., 4, ., 1, ., 1, 60.47610.85370.9630yesno
Q93WX6NFS2_ARATH4, ., 4, ., 1, ., 1, 60.76930.99780.9870yesno
B7MV59SUFS_ECO814, ., 4, ., 1, ., 1, 60.46860.85370.9630yesno
B7NTV6SUFS_ECO7I4, ., 4, ., 1, ., 1, 60.46860.85370.9630yesno
Q9HMM6CSD_HALSA2, ., 8, ., 1, ., 70.50370.87110.9614yesno
Q5HQQ0CSD_STAEQ2, ., 8, ., 1, ., 70.50490.86680.9612yesno
B5QVS9SUFS_SALEP4, ., 4, ., 1, ., 1, 60.47360.85370.9630yesno
Q7CQN5SUFS_SALTY4, ., 4, ., 1, ., 1, 60.47360.85370.9630yesno
Q6GIH2CSD_STAAR2, ., 8, ., 1, ., 70.50990.86680.9612yesno
A9N142SUFS_SALPB4, ., 4, ., 1, ., 1, 60.47360.85370.9630yesno
B7M0N5SUFS_ECO8A4, ., 4, ., 1, ., 1, 60.46610.85370.9630yesno
B2U2I4SUFS_SHIB34, ., 4, ., 1, ., 1, 60.46860.85370.9630yesno
B5FIM3SUFS_SALDC4, ., 4, ., 1, ., 1, 60.47110.85370.9630yesno
B7LQ96SUFS_ESCF34, ., 4, ., 1, ., 1, 60.46860.85370.9630yesno
A4W9R3SUFS_ENT384, ., 4, ., 1, ., 1, 60.47860.85370.9630yesno
C4ZYE2SUFS_ECOBW4, ., 4, ., 1, ., 1, 60.46860.85370.9630yesno
Q321D9SUFS_SHIBS4, ., 4, ., 1, ., 1, 60.46860.85370.9630yesno
B6IBB9SUFS_ECOSE4, ., 4, ., 1, ., 1, 60.46860.85370.9630yesno
B4TUT5SUFS_SALSV4, ., 4, ., 1, ., 1, 60.47360.85370.9630yesno
O32164CSD_BACSU2, ., 8, ., 1, ., 70.51350.87110.9827yesno
Q57PR2SUFS_SALCH4, ., 4, ., 1, ., 1, 60.47610.85370.9630yesno
A1ABL8SUFS_ECOK14, ., 4, ., 1, ., 1, 60.46860.85370.9630yesno
A7MF59SUFS_CROS84, ., 4, ., 1, ., 1, 60.48140.86460.9753yesno
Q9XAD5CSD_STRCO2, ., 8, ., 1, ., 70.49400.89510.9808yesno
A8A0M6SUFS_ECOHS4, ., 4, ., 1, ., 1, 60.46860.85370.9630yesno
Q55793CSD_SYNY32, ., 8, ., 1, ., 70.62190.88860.9690N/Ano
Q6GB11CSD_STAAS2, ., 8, ., 1, ., 70.50990.86680.9612yesno
C6DKM6SUFS_PECCP4, ., 4, ., 1, ., 1, 60.46110.85370.9606yesno
B1XFY8SUFS_ECODH4, ., 4, ., 1, ., 1, 60.46860.85370.9630yesno
Q8NXH0CSD_STAAW2, ., 8, ., 1, ., 70.50990.86680.9612yesno
Q9EXP2SUFS_DICD34, ., 4, ., 1, ., 1, 60.46750.85580.9514yesno
B7L5N2SUFS_ECO554, ., 4, ., 1, ., 1, 60.46860.85370.9630yesno
Q1RBB6SUFS_ECOUT4, ., 4, ., 1, ., 1, 60.46860.85370.9630yesno
B1LE56SUFS_ECOSM4, ., 4, ., 1, ., 1, 60.46860.85370.9630yesno
Q3Z233SUFS_SHISS4, ., 4, ., 1, ., 1, 60.47110.85370.9630yesno
P99177CSD_STAAN2, ., 8, ., 1, ., 70.50740.86680.9612yesno
P63518CSD_STAAM2, ., 8, ., 1, ., 70.50740.86680.9612yesno
B7MA32SUFS_ECO454, ., 4, ., 1, ., 1, 60.46860.85370.9630yesno
B5RAT4SUFS_SALG24, ., 4, ., 1, ., 1, 60.47360.85370.9630yesno
B4TGK9SUFS_SALHS4, ., 4, ., 1, ., 1, 60.47360.85370.9630yesno
Q8CTA4CSD_STAES2, ., 8, ., 1, ., 70.50740.86680.9612yesno
Q5HHH0CSD_STAAC2, ., 8, ., 1, ., 70.50990.86680.9612yesno
B4T4R6SUFS_SALNS4, ., 4, ., 1, ., 1, 60.47360.85370.9630yesno
Q9K7A0CSD_BACHD2, ., 8, ., 1, ., 70.52080.87330.9852yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer4.4.1.160.979
4th Layer2.8.1.70.979
3rd Layer2.8.10.983

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query458
PLN02855424 PLN02855, PLN02855, Bifunctional selenocysteine ly 0.0
TIGR01979403 TIGR01979, sufS, cysteine desulfurases, SufSfamily 0.0
cd06453373 cd06453, SufS_like, Cysteine desulfurase (SufS)-li 0.0
COG0520405 COG0520, csdA, Selenocysteine lyase/Cysteine desul 1e-180
pfam00266370 pfam00266, Aminotran_5, Aminotransferase class-V 1e-179
PRK09295406 PRK09295, PRK09295, bifunctional cysteine desulfur 1e-152
PRK10874401 PRK10874, PRK10874, cysteine sulfinate desulfinase 1e-127
TIGR03392398 TIGR03392, FeS_syn_CsdA, cysteine desulfurase, cat 1e-120
TIGR01977376 TIGR01977, am_tr_V_EF2568, cysteine desulfurase fa 8e-84
TIGR01976397 TIGR01976, am_tr_V_VC1184, cysteine desulfurase fa 1e-74
COG1104386 COG1104, NifS, Cysteine sulfinate desulfinase/cyst 3e-48
TIGR03402379 TIGR03402, FeS_nifS, cysteine desulfurase NifS 4e-43
PLN02651364 PLN02651, PLN02651, cysteine desulfurase 6e-27
TIGR02006402 TIGR02006, IscS, cysteine desulfurase IscS 2e-26
TIGR03235353 TIGR03235, DNA_S_dndA, cysteine desulfurase DndA 1e-25
PRK14012404 PRK14012, PRK14012, cysteine desulfurase; Provisio 2e-25
TIGR03403382 TIGR03403, nifS_epsilon, cysteine desulfurase, Nif 2e-25
PRK02948381 PRK02948, PRK02948, cysteine desulfurase; Provisio 4e-15
cd01494170 cd01494, AAT_I, Aspartate aminotransferase (AAT) s 1e-14
TIGR04343370 TIGR04343, egtE_PLP_lyase, ergothioneine biosynthe 3e-14
TIGR03301355 TIGR03301, PhnW-AepZ, 2-aminoethylphosphonate amin 3e-10
COG3844407 COG3844, COG3844, Kynureninase [Amino acid transpo 2e-09
PRK07324373 PRK07324, PRK07324, transaminase; Validated 3e-08
PRK09331387 PRK09331, PRK09331, Sep-tRNA:Cys-tRNA synthetase; 2e-07
PRK13479368 PRK13479, PRK13479, 2-aminoethylphosphonate--pyruv 3e-07
PLN02724 805 PLN02724, PLN02724, Molybdenum cofactor sulfurase 5e-07
COG0075383 COG0075, COG0075, Serine-pyruvate aminotransferase 9e-07
TIGR03812373 TIGR03812, tyr_de_CO2_Arch, tyrosine decarboxylase 6e-06
TIGR01814406 TIGR01814, kynureninase, kynureninase 6e-06
cd06452361 cd06452, SepCysS, Sep-tRNA:Cys-tRNA synthase 7e-06
cd06451356 cd06451, AGAT_like, Alanine-glyoxylate aminotransf 8e-06
TIGR02326363 TIGR02326, transamin_PhnW, 2-aminoethylphosphonate 9e-06
PRK08045386 PRK08045, PRK08045, cystathionine gamma-synthase; 1e-05
TIGR02539370 TIGR02539, SepCysS, O-phospho-L-seryl-tRNA:Cys-tRN 6e-05
COG1103382 COG1103, COG1103, Archaea-specific pyridoxal phosp 6e-05
pfam01053382 pfam01053, Cys_Met_Meta_PP, Cys/Met metabolism PLP 6e-05
cd00609350 cd00609, AAT_like, Aspartate aminotransferase fami 1e-04
cd00614369 cd00614, CGS_like, CGS_like: Cystathionine gamma-s 1e-04
PRK06836394 PRK06836, PRK06836, aspartate aminotransferase; Pr 1e-04
PRK08861388 PRK08861, PRK08861, cystathionine gamma-synthase; 1e-04
COG0076460 COG0076, GadB, Glutamate decarboxylase and related 3e-04
COG0626396 COG0626, MetC, Cystathionine beta-lyases/cystathio 4e-04
COG0399374 COG0399, WecE, Predicted pyridoxal phosphate-depen 5e-04
TIGR02080382 TIGR02080, O_succ_thio_ly, O-succinylhomoserine (t 7e-04
TIGR03947359 TIGR03947, viomycin_VioD, capreomycidine synthase 7e-04
TIGR01325381 TIGR01325, O_suc_HS_sulf, O-succinylhomoserine sul 7e-04
TIGR01328391 TIGR01328, met_gam_lyase, methionine gamma-lyase 8e-04
TIGR01329378 TIGR01329, cysta_beta_ly_E, cystathionine beta-lya 8e-04
COG0079356 COG0079, HisC, Histidinol-phosphate/aromatic amino 0.001
PRK08574385 PRK08574, PRK08574, cystathionine gamma-synthase; 0.002
COG0436393 COG0436, COG0436, Aspartate/tyrosine/aromatic amin 0.002
cd00616352 cd00616, AHBA_syn, 3-amino-5-hydroxybenzoic acid s 0.003
PLN02409401 PLN02409, PLN02409, serine--glyoxylate aminotransa 0.004
>gnl|CDD|215460 PLN02855, PLN02855, Bifunctional selenocysteine lyase/cysteine desulfurase Back     alignment and domain information
 Score =  825 bits (2132), Expect = 0.0
 Identities = 337/419 (80%), Positives = 369/419 (88%), Gaps = 1/419 (0%)

Query: 40  TSTDSVSLGHITRPDFPILHQEVYGSKKLVYLDNAATSQKPIAVLKALQNYYEAYNSNVH 99
            S  SVSLG  TRPDFPIL Q V GSK LVYLDNAATSQKP AVL ALQ+YYE YNSNVH
Sbjct: 6   ASAASVSLGAETRPDFPILDQTVNGSK-LVYLDNAATSQKPAAVLDALQDYYEEYNSNVH 64

Query: 100 RGIHFLSAKATDEYELARKKVAAFINASDSGEIVFTKNATEAINLVAYSWGLSNLKSGDE 159
           RGIH LSAKATD YELARKKVAAFINAS S EIVFT+NATEAINLVAY+WGL+NLK GDE
Sbjct: 65  RGIHALSAKATDAYELARKKVAAFINASTSREIVFTRNATEAINLVAYTWGLANLKPGDE 124

Query: 160 VILTVAEHHSAIVPWQLVAQKTGANLKFLNLNDDESPDLDKLKEMLSRKTKLVVIHHISN 219
           VIL+VAEHHS IVPWQLVAQKTGA LKF+ L  DE  D+++LKE+LS KTKLV  HH+SN
Sbjct: 125 VILSVAEHHSNIVPWQLVAQKTGAVLKFVGLTPDEVLDVEQLKELLSEKTKLVATHHVSN 184

Query: 220 MLASILPIEEIVHWSHDVGAKVLVDACQSVPHMVVDVQGLDADFLVASSHKMCGPTGIGF 279
           +L SILP+E+IVHW+H VGAKVLVDACQSVPHM VDVQ L ADFLVASSHKMCGPTGIGF
Sbjct: 185 VLGSILPVEDIVHWAHAVGAKVLVDACQSVPHMPVDVQTLGADFLVASSHKMCGPTGIGF 244

Query: 280 LFGKSDLLSAMPPFLGGGEMISDVFLDHSTFADPPSRFEAGTPAIGEAIGLGAAIDYLST 339
           L+GKSDLL +MPPFLGGGEMISDVFLDHST+A PPSRFEAGTPAIGEAIGLGAAIDYLS 
Sbjct: 245 LWGKSDLLESMPPFLGGGEMISDVFLDHSTYAPPPSRFEAGTPAIGEAIGLGAAIDYLSE 304

Query: 340 IGMQKIHAYEMELAKYLYENLLSIPNIRIYGPKPSEHVQRAALCSFNVENIHPTDIATLL 399
           IGM +IH YE+EL  YLYE L S+P +RIYGPKPSE V RAALC+FNVE IHPTD++T L
Sbjct: 305 IGMDRIHEYEVELGTYLYEKLSSVPGVRIYGPKPSEGVGRAALCAFNVEGIHPTDLSTFL 364

Query: 400 DQQYGVATRSGHHCAQPLHRYLGVNASARASLHFYNTKEDVDEFIHALNETVSFFNVFK 458
           DQQ+GVA RSGHHCAQPLHRYLGVNASARASL+FYNTKE+VD FIHAL +T++FF+ FK
Sbjct: 365 DQQHGVAIRSGHHCAQPLHRYLGVNASARASLYFYNTKEEVDAFIHALKDTIAFFSSFK 423


Length = 424

>gnl|CDD|131034 TIGR01979, sufS, cysteine desulfurases, SufSfamily Back     alignment and domain information
>gnl|CDD|99746 cd06453, SufS_like, Cysteine desulfurase (SufS)-like Back     alignment and domain information
>gnl|CDD|223594 COG0520, csdA, Selenocysteine lyase/Cysteine desulfurase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|215829 pfam00266, Aminotran_5, Aminotransferase class-V Back     alignment and domain information
>gnl|CDD|181766 PRK09295, PRK09295, bifunctional cysteine desulfurase/selenocysteine lyase; Validated Back     alignment and domain information
>gnl|CDD|182799 PRK10874, PRK10874, cysteine sulfinate desulfinase; Provisional Back     alignment and domain information
>gnl|CDD|132433 TIGR03392, FeS_syn_CsdA, cysteine desulfurase, catalytic subunit CsdA Back     alignment and domain information
>gnl|CDD|131032 TIGR01977, am_tr_V_EF2568, cysteine desulfurase family protein Back     alignment and domain information
>gnl|CDD|233664 TIGR01976, am_tr_V_VC1184, cysteine desulfurase family protein, VC1184 subfamily Back     alignment and domain information
>gnl|CDD|224029 COG1104, NifS, Cysteine sulfinate desulfinase/cysteine desulfurase and related enzymes [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|132443 TIGR03402, FeS_nifS, cysteine desulfurase NifS Back     alignment and domain information
>gnl|CDD|178257 PLN02651, PLN02651, cysteine desulfurase Back     alignment and domain information
>gnl|CDD|131061 TIGR02006, IscS, cysteine desulfurase IscS Back     alignment and domain information
>gnl|CDD|163191 TIGR03235, DNA_S_dndA, cysteine desulfurase DndA Back     alignment and domain information
>gnl|CDD|184450 PRK14012, PRK14012, cysteine desulfurase; Provisional Back     alignment and domain information
>gnl|CDD|132444 TIGR03403, nifS_epsilon, cysteine desulfurase, NifS family, epsilon proteobacteria type Back     alignment and domain information
>gnl|CDD|179511 PRK02948, PRK02948, cysteine desulfurase; Provisional Back     alignment and domain information
>gnl|CDD|99742 cd01494, AAT_I, Aspartate aminotransferase (AAT) superfamily (fold type I) of pyridoxal phosphate (PLP)-dependent enzymes Back     alignment and domain information
>gnl|CDD|234554 TIGR04343, egtE_PLP_lyase, ergothioneine biosynthesis PLP-dependent enzyme EgtE Back     alignment and domain information
>gnl|CDD|213793 TIGR03301, PhnW-AepZ, 2-aminoethylphosphonate aminotransferase Back     alignment and domain information
>gnl|CDD|226363 COG3844, COG3844, Kynureninase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|235989 PRK07324, PRK07324, transaminase; Validated Back     alignment and domain information
>gnl|CDD|236469 PRK09331, PRK09331, Sep-tRNA:Cys-tRNA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|184076 PRK13479, PRK13479, 2-aminoethylphosphonate--pyruvate transaminase; Provisional Back     alignment and domain information
>gnl|CDD|215384 PLN02724, PLN02724, Molybdenum cofactor sulfurase Back     alignment and domain information
>gnl|CDD|223153 COG0075, COG0075, Serine-pyruvate aminotransferase/archaeal aspartate aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|234361 TIGR03812, tyr_de_CO2_Arch, tyrosine decarboxylase MnfA Back     alignment and domain information
>gnl|CDD|130873 TIGR01814, kynureninase, kynureninase Back     alignment and domain information
>gnl|CDD|99745 cd06452, SepCysS, Sep-tRNA:Cys-tRNA synthase Back     alignment and domain information
>gnl|CDD|99744 cd06451, AGAT_like, Alanine-glyoxylate aminotransferase (AGAT) family Back     alignment and domain information
>gnl|CDD|131379 TIGR02326, transamin_PhnW, 2-aminoethylphosphonate--pyruvate transaminase Back     alignment and domain information
>gnl|CDD|169194 PRK08045, PRK08045, cystathionine gamma-synthase; Provisional Back     alignment and domain information
>gnl|CDD|233915 TIGR02539, SepCysS, O-phospho-L-seryl-tRNA:Cys-tRNA synthase Back     alignment and domain information
>gnl|CDD|224028 COG1103, COG1103, Archaea-specific pyridoxal phosphate-dependent enzymes [General function prediction only] Back     alignment and domain information
>gnl|CDD|216267 pfam01053, Cys_Met_Meta_PP, Cys/Met metabolism PLP-dependent enzyme Back     alignment and domain information
>gnl|CDD|99734 cd00609, AAT_like, Aspartate aminotransferase family Back     alignment and domain information
>gnl|CDD|99738 cd00614, CGS_like, CGS_like: Cystathionine gamma-synthase is a PLP dependent enzyme and catalyzes the committed step of methionine biosynthesis Back     alignment and domain information
>gnl|CDD|180720 PRK06836, PRK06836, aspartate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|181567 PRK08861, PRK08861, cystathionine gamma-synthase; Provisional Back     alignment and domain information
>gnl|CDD|223154 COG0076, GadB, Glutamate decarboxylase and related PLP-dependent proteins [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|223699 COG0626, MetC, Cystathionine beta-lyases/cystathionine gamma-synthases [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|223476 COG0399, WecE, Predicted pyridoxal phosphate-dependent enzyme apparently involved in regulation of cell wall biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|131135 TIGR02080, O_succ_thio_ly, O-succinylhomoserine (thiol)-lyase Back     alignment and domain information
>gnl|CDD|188462 TIGR03947, viomycin_VioD, capreomycidine synthase Back     alignment and domain information
>gnl|CDD|188131 TIGR01325, O_suc_HS_sulf, O-succinylhomoserine sulfhydrylase Back     alignment and domain information
>gnl|CDD|130395 TIGR01328, met_gam_lyase, methionine gamma-lyase Back     alignment and domain information
>gnl|CDD|233359 TIGR01329, cysta_beta_ly_E, cystathionine beta-lyase, eukaryotic Back     alignment and domain information
>gnl|CDD|223157 COG0079, HisC, Histidinol-phosphate/aromatic aminotransferase and cobyric acid decarboxylase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|236298 PRK08574, PRK08574, cystathionine gamma-synthase; Provisional Back     alignment and domain information
>gnl|CDD|223513 COG0436, COG0436, Aspartate/tyrosine/aromatic aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|99740 cd00616, AHBA_syn, 3-amino-5-hydroxybenzoic acid synthase family (AHBA_syn) Back     alignment and domain information
>gnl|CDD|178031 PLN02409, PLN02409, serine--glyoxylate aminotransaminase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 458
COG0520405 csdA Selenocysteine lyase/Cysteine desulfurase [Po 100.0
PLN02855424 Bifunctional selenocysteine lyase/cysteine desulfu 100.0
PRK09295406 bifunctional cysteine desulfurase/selenocysteine l 100.0
TIGR03392398 FeS_syn_CsdA cysteine desulfurase, catalytic subun 100.0
PRK10874401 cysteine sulfinate desulfinase; Provisional 100.0
TIGR01979403 sufS cysteine desulfurases, SufS subfamily. This m 100.0
COG1104386 NifS Cysteine sulfinate desulfinase/cysteine desul 100.0
PF00266371 Aminotran_5: Aminotransferase class-V; InterPro: I 100.0
cd06453373 SufS_like Cysteine desulfurase (SufS)-like. This f 100.0
PLN02651364 cysteine desulfurase 100.0
PLN02724 805 Molybdenum cofactor sulfurase 100.0
TIGR03402379 FeS_nifS cysteine desulfurase NifS. Members of thi 100.0
TIGR01976397 am_tr_V_VC1184 cysteine desulfurase family protein 100.0
TIGR01977376 am_tr_V_EF2568 cysteine desulfurase family protein 100.0
TIGR02006402 IscS cysteine desulfurase IscS. This model represe 100.0
TIGR03403382 nifS_epsilon cysteine desulfurase, NifS family, ep 100.0
KOG1549428 consensus Cysteine desulfurase NFS1 [Amino acid tr 100.0
TIGR01814406 kynureninase kynureninase. This model describes ky 100.0
PRK02948381 cysteine desulfurase; Provisional 100.0
PRK14012404 cysteine desulfurase; Provisional 100.0
TIGR03235353 DNA_S_dndA cysteine desulfurase DndA. This model d 100.0
PLN02409401 serine--glyoxylate aminotransaminase 100.0
cd06451356 AGAT_like Alanine-glyoxylate aminotransferase (AGA 100.0
PRK03080378 phosphoserine aminotransferase; Provisional 100.0
TIGR02326363 transamin_PhnW 2-aminoethylphosphonate--pyruvate t 100.0
TIGR01364349 serC_1 phosphoserine aminotransferase. This model 100.0
cd00611355 PSAT_like Phosphoserine aminotransferase (PSAT) fa 100.0
COG3844407 Kynureninase [Amino acid transport and metabolism] 100.0
COG0436393 Aspartate/tyrosine/aromatic aminotransferase [Amin 100.0
PRK13479368 2-aminoethylphosphonate--pyruvate transaminase; Pr 100.0
PRK05355360 3-phosphoserine/phosphohydroxythreonine aminotrans 100.0
COG0075383 Serine-pyruvate aminotransferase/archaeal aspartat 100.0
TIGR03301355 PhnW-AepZ 2-aminoethylphosphonate aminotransferase 100.0
TIGR01788431 Glu-decarb-GAD glutamate decarboxylase. This model 100.0
PRK02769380 histidine decarboxylase; Provisional 100.0
PRK09331387 Sep-tRNA:Cys-tRNA synthetase; Provisional 100.0
PRK06225380 aspartate aminotransferase; Provisional 100.0
PRK13520371 L-tyrosine decarboxylase; Provisional 100.0
TIGR01141346 hisC histidinol-phosphate aminotransferase. Histid 100.0
PRK06207405 aspartate aminotransferase; Provisional 100.0
PRK05957389 aspartate aminotransferase; Provisional 100.0
PTZ00094452 serine hydroxymethyltransferase; Provisional 100.0
TIGR01366361 serC_3 phosphoserine aminotransferase, putative. T 100.0
TIGR02539370 SepCysS Sep-tRNA:Cys-tRNA synthase. Aminoacylation 100.0
PRK07681399 aspartate aminotransferase; Provisional 100.0
PRK05387353 histidinol-phosphate aminotransferase; Provisional 100.0
PRK06108382 aspartate aminotransferase; Provisional 100.0
PLN02187462 rooty/superroot1 100.0
PLN00145430 tyrosine/nicotianamine aminotransferase; Provision 100.0
PRK01533366 histidinol-phosphate aminotransferase; Validated 100.0
PLN03026380 histidinol-phosphate aminotransferase; Provisional 100.0
PRK04870356 histidinol-phosphate aminotransferase; Provisional 100.0
PRK08960387 hypothetical protein; Provisional 100.0
PRK03158359 histidinol-phosphate aminotransferase; Provisional 100.0
cd00613398 GDC-P Glycine cleavage system P-protein, alpha- an 100.0
cd06452361 SepCysS Sep-tRNA:Cys-tRNA synthase. This family be 100.0
PRK14807351 histidinol-phosphate aminotransferase; Provisional 100.0
KOG0259447 consensus Tyrosine aminotransferase [Amino acid tr 100.0
PRK07324373 transaminase; Validated 100.0
TIGR03540383 DapC_direct LL-diaminopimelate aminotransferase. T 100.0
PLN00175413 aminotransferase family protein; Provisional 100.0
PRK07682378 hypothetical protein; Validated 100.0
TIGR03812373 tyr_de_CO2_Arch tyrosine decarboxylase MnfA. Membe 100.0
cd06450345 DOPA_deC_like DOPA decarboxylase family. This fami 100.0
PRK09276385 LL-diaminopimelate aminotransferase; Provisional 100.0
PRK09105370 putative aminotransferase; Provisional 100.0
PRK00950361 histidinol-phosphate aminotransferase; Validated 100.0
PRK08361391 aspartate aminotransferase; Provisional 100.0
PTZ00433412 tyrosine aminotransferase; Provisional 100.0
PRK02731367 histidinol-phosphate aminotransferase; Validated 100.0
PRK07366388 succinyldiaminopimelate transaminase; Validated 100.0
PRK08056356 threonine-phosphate decarboxylase; Provisional 100.0
TIGR01264401 tyr_amTase_E tyrosine aminotransferase, eukaryotic 100.0
PLN03032374 serine decarboxylase; Provisional 100.0
TIGR01822393 2am3keto_CoA 2-amino-3-ketobutyrate coenzyme A lig 100.0
TIGR01265403 tyr_nico_aTase tyrosine/nicotianamine aminotransfe 100.0
PRK09147396 succinyldiaminopimelate transaminase; Provisional 100.0
PRK05764393 aspartate aminotransferase; Provisional 100.0
PRK06290410 aspartate aminotransferase; Provisional 100.0
PRK05942394 aspartate aminotransferase; Provisional 100.0
COG0079356 HisC Histidinol-phosphate/aromatic aminotransferas 100.0
TIGR03538393 DapC_gpp succinyldiaminopimelate transaminase. Thi 100.0
PRK06348384 aspartate aminotransferase; Provisional 100.0
PLN02656409 tyrosine transaminase 100.0
PRK07337388 aminotransferase; Validated 100.0
PLN00143409 tyrosine/nicotianamine aminotransferase; Provision 100.0
cd06454349 KBL_like KBL_like; this family belongs to the pyri 99.98
TIGR03537350 DapC succinyldiaminopimelate transaminase. Note: t 99.98
PRK08068389 transaminase; Reviewed 99.98
PRK07568397 aspartate aminotransferase; Provisional 99.98
PRK07908349 hypothetical protein; Provisional 99.98
PRK07550386 hypothetical protein; Provisional 99.98
PRK00451447 glycine dehydrogenase subunit 1; Validated 99.98
PRK08912387 hypothetical protein; Provisional 99.98
PRK07309391 aromatic amino acid aminotransferase; Validated 99.98
PRK13355517 bifunctional HTH-domain containing protein/aminotr 99.98
PTZ00377481 alanine aminotransferase; Provisional 99.98
PRK07179407 hypothetical protein; Provisional 99.98
PRK04366481 glycine dehydrogenase subunit 2; Validated 99.98
PRK15481431 transcriptional regulatory protein PtsJ; Provision 99.98
KOG2862385 consensus Alanine-glyoxylate aminotransferase AGT1 99.98
PRK08363398 alanine aminotransferase; Validated 99.98
PRK07683387 aminotransferase A; Validated 99.98
PRK06358354 threonine-phosphate decarboxylase; Provisional 99.97
PRK06107402 aspartate aminotransferase; Provisional 99.97
PRK12414384 putative aminotransferase; Provisional 99.97
PRK02610374 histidinol-phosphate aminotransferase; Provisional 99.97
PRK03321352 putative aminotransferase; Provisional 99.97
PRK09148405 aminotransferase; Validated 99.97
PRK05166371 histidinol-phosphate aminotransferase; Provisional 99.97
PRK04635354 histidinol-phosphate aminotransferase; Provisional 99.97
PRK09265404 aminotransferase AlaT; Validated 99.97
PRK08636403 aspartate aminotransferase; Provisional 99.97
TIGR00858360 bioF 8-amino-7-oxononanoate synthase. This model r 99.97
PRK08153369 histidinol-phosphate aminotransferase; Provisional 99.97
PRK09082386 methionine aminotransferase; Validated 99.97
PRK01688351 histidinol-phosphate aminotransferase; Provisional 99.97
PRK05937370 8-amino-7-oxononanoate synthase; Provisional 99.97
PRK14809357 histidinol-phosphate aminotransferase; Provisional 99.97
PRK07392360 threonine-phosphate decarboxylase; Validated 99.97
PRK06836394 aspartate aminotransferase; Provisional 99.97
TIGR01437363 selA_rel uncharacterized pyridoxal phosphate-depen 99.97
PRK05958385 8-amino-7-oxononanoate synthase; Reviewed 99.97
KOG0257420 consensus Kynurenine aminotransferase, glutamine t 99.97
PLN02452365 phosphoserine transaminase 99.97
COG1168388 MalY Bifunctional PLP-dependent enzyme with beta-c 99.97
PLN02376496 1-aminocyclopropane-1-carboxylate synthase 99.97
PLN02450468 1-aminocyclopropane-1-carboxylate synthase 99.97
PLN02607447 1-aminocyclopropane-1-carboxylate synthase 99.97
PLN02414 993 glycine dehydrogenase (decarboxylating) 99.97
PRK08175395 aminotransferase; Validated 99.97
TIGR01821402 5aminolev_synth 5-aminolevulinic acid synthase. Th 99.97
PRK03317368 histidinol-phosphate aminotransferase; Provisional 99.97
PRK07777387 aminotransferase; Validated 99.97
PRK13392410 5-aminolevulinate synthase; Provisional 99.97
COG1167459 ARO8 Transcriptional regulators containing a DNA-b 99.97
PRK14808335 histidinol-phosphate aminotransferase; Provisional 99.97
PLN02483489 serine palmitoyltransferase 99.97
PRK06855433 aminotransferase; Validated 99.97
PRK06939397 2-amino-3-ketobutyrate coenzyme A ligase; Provisio 99.97
PLN02822481 serine palmitoyltransferase 99.97
PRK07590409 L,L-diaminopimelate aminotransferase; Validated 99.97
PLN02721353 threonine aldolase 99.97
PRK09064407 5-aminolevulinate synthase; Validated 99.97
PLN02414993 glycine dehydrogenase (decarboxylating) 99.97
PRK05839374 hypothetical protein; Provisional 99.97
TIGR03542402 DAPAT_plant LL-diaminopimelate aminotransferase. T 99.97
PRK03967337 histidinol-phosphate aminotransferase; Provisional 99.97
TIGR01825385 gly_Cac_T_rel pyridoxal phosphate-dependent acyltr 99.97
PRK06425332 histidinol-phosphate aminotransferase; Validated 99.96
PLN026721082 methionine S-methyltransferase 99.96
PRK13393406 5-aminolevulinate synthase; Provisional 99.96
PF00155363 Aminotran_1_2: Aminotransferase class I and II 1-a 99.96
PRK04781364 histidinol-phosphate aminotransferase; Provisional 99.96
cd00378402 SHMT Serine-glycine hydroxymethyltransferase (SHMT 99.96
cd00609350 AAT_like Aspartate aminotransferase family. This f 99.96
PLN02231534 alanine transaminase 99.96
TIGR01140330 L_thr_O3P_dcar L-threonine-O-3-phosphate decarboxy 99.96
PRK00011416 glyA serine hydroxymethyltransferase; Reviewed 99.96
TIGR03799522 NOD_PanD_pyr putative pyridoxal-dependent aspartat 99.96
PRK12462364 phosphoserine aminotransferase; Provisional 99.96
PRK05367 954 glycine dehydrogenase; Provisional 99.96
PRK07865364 N-succinyldiaminopimelate aminotransferase; Review 99.96
PRK08064390 cystathionine beta-lyase; Provisional 99.96
PLN02880490 tyrosine decarboxylase 99.96
cd00616352 AHBA_syn 3-amino-5-hydroxybenzoic acid synthase fa 99.96
PRK08133390 O-succinylhomoserine sulfhydrylase; Validated 99.96
TIGR03539357 DapC_actino succinyldiaminopimelate transaminase. 99.96
cd06502338 TA_like Low-specificity threonine aldolase (TA). T 99.96
PLN02590539 probable tyrosine decarboxylase 99.96
PRK07504398 O-succinylhomoserine sulfhydrylase; Reviewed 99.96
PRK05968389 hypothetical protein; Provisional 99.96
PRK08249398 cystathionine gamma-synthase; Provisional 99.96
PRK09028394 cystathionine beta-lyase; Provisional 99.95
cd00614369 CGS_like CGS_like: Cystathionine gamma-synthase is 99.95
PRK06767386 methionine gamma-lyase; Provisional 99.95
TIGR01329378 cysta_beta_ly_E cystathionine beta-lyase, eukaryot 99.95
PRK08354311 putative aminotransferase; Provisional 99.95
PRK08861388 cystathionine gamma-synthase; Provisional 99.95
PRK05664330 threonine-phosphate decarboxylase; Reviewed 99.95
PRK08134433 O-acetylhomoserine aminocarboxypropyltransferase; 99.95
PRK08776405 cystathionine gamma-synthase; Provisional 99.95
PRK09275527 aspartate aminotransferase; Provisional 99.95
PRK06959339 putative threonine-phosphate decarboxylase; Provis 99.95
PRK09440416 avtA valine--pyruvate transaminase; Provisional 99.95
PRK13238460 tnaA tryptophanase/L-cysteine desulfhydrase, PLP-d 99.95
PRK08045386 cystathionine gamma-synthase; Provisional 99.95
TIGR01328391 met_gam_lyase methionine gamma-lyase. This model d 99.95
TIGR01365374 serC_2 phosphoserine aminotransferase, Methanosarc 99.95
TIGR01324377 cysta_beta_ly_B cystathionine beta-lyase, bacteria 99.95
TIGR01325380 O_suc_HS_sulf O-succinylhomoserine sulfhydrylase. 99.95
TIGR03801521 asp_4_decarbox aspartate 4-decarboxylase. This enz 99.95
PRK07503403 methionine gamma-lyase; Provisional 99.95
PRK06460376 hypothetical protein; Provisional 99.95
COG0156388 BioF 7-keto-8-aminopelargonate synthetase and rela 99.95
PRK06234400 methionine gamma-lyase; Provisional 99.95
PRK07810403 O-succinylhomoserine sulfhydrylase; Provisional 99.95
PLN02263470 serine decarboxylase 99.95
PRK08114395 cystathionine beta-lyase; Provisional 99.95
PRK11658379 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate amin 99.95
PRK09257396 aromatic amino acid aminotransferase; Provisional 99.95
PRK13580493 serine hydroxymethyltransferase; Provisional 99.95
PRK08248431 O-acetylhomoserine aminocarboxypropyltransferase; 99.94
COG0399374 WecE Predicted pyridoxal phosphate-dependent enzym 99.94
TIGR02080382 O_succ_thio_ly O-succinylhomoserine (thiol)-lyase. 99.94
TIGR03588380 PseC UDP-4-keto-6-deoxy-N-acetylglucosamine 4-amin 99.94
PLN02242418 methionine gamma-lyase 99.94
KOG3846465 consensus L-kynurenine hydrolase [Amino acid trans 99.94
PRK07811388 cystathionine gamma-synthase; Provisional 99.94
PRK10534333 L-threonine aldolase; Provisional 99.94
PRK03244398 argD acetylornithine aminotransferase; Provisional 99.94
PTZ00376404 aspartate aminotransferase; Provisional 99.94
PRK08637388 hypothetical protein; Provisional 99.94
PRK08574385 cystathionine gamma-synthase; Provisional 99.94
PRK13034416 serine hydroxymethyltransferase; Reviewed 99.94
PRK08247366 cystathionine gamma-synthase; Reviewed 99.94
cd00610413 OAT_like Acetyl ornithine aminotransferase family. 99.94
PLN03227392 serine palmitoyltransferase-like protein; Provisio 99.94
PRK07812436 O-acetylhomoserine aminocarboxypropyltransferase; 99.94
PLN02955476 8-amino-7-oxononanoate synthase 99.94
PRK05367954 glycine dehydrogenase; Provisional 99.94
PLN03226475 serine hydroxymethyltransferase; Provisional 99.94
PRK05613437 O-acetylhomoserine aminocarboxypropyltransferase; 99.94
TIGR03576346 pyridox_MJ0158 pyridoxal phosphate enzyme, MJ0158 99.94
PRK05967395 cystathionine beta-lyase; Provisional 99.94
PRK04073396 rocD ornithine--oxo-acid transaminase; Provisional 99.94
PLN02271586 serine hydroxymethyltransferase 99.94
PRK00854401 rocD ornithine--oxo-acid transaminase; Reviewed 99.93
PRK06702432 O-acetylhomoserine aminocarboxypropyltransferase; 99.93
PRK07050394 cystathionine beta-lyase; Provisional 99.93
TIGR01326418 OAH_OAS_sulfhy OAH/OAS sulfhydrylase. This model d 99.93
PRK01278389 argD acetylornithine transaminase protein; Provisi 99.93
PRK05994427 O-acetylhomoserine aminocarboxypropyltransferase; 99.93
PRK06176380 cystathionine gamma-synthase/cystathionine beta-ly 99.93
PRK12566954 glycine dehydrogenase; Provisional 99.93
TIGR02379376 ECA_wecE TDP-4-keto-6-deoxy-D-glucose transaminase 99.93
COG1103382 Archaea-specific pyridoxal phosphate-dependent enz 99.93
PRK07582366 cystathionine gamma-lyase; Validated 99.93
PRK06084425 O-acetylhomoserine aminocarboxypropyltransferase; 99.93
PRK07505402 hypothetical protein; Provisional 99.93
PRK05939397 hypothetical protein; Provisional 99.93
TIGR00707379 argD acetylornithine and succinylornithine aminotr 99.93
COG0076460 GadB Glutamate decarboxylase and related PLP-depen 99.93
PRK07671377 cystathionine beta-lyase; Provisional 99.93
PRK07269364 cystathionine gamma-synthase; Reviewed 99.93
PF01041363 DegT_DnrJ_EryC1: DegT/DnrJ/EryC1/StrS aminotransfe 99.93
COG2873426 MET17 O-acetylhomoserine sulfhydrylase [Amino acid 99.93
TIGR00461939 gcvP glycine dehydrogenase (decarboxylating). This 99.93
PRK07049427 methionine gamma-lyase; Validated 99.93
PLN02368407 alanine transaminase 99.93
PTZ00125400 ornithine aminotransferase-like protein; Provision 99.92
PLN02509464 cystathionine beta-lyase 99.92
PRK02627396 acetylornithine aminotransferase; Provisional 99.92
PRK04311464 selenocysteine synthase; Provisional 99.92
PRK11706375 TDP-4-oxo-6-deoxy-D-glucose transaminase; Provisio 99.92
PF01053386 Cys_Met_Meta_PP: Cys/Met metabolism PLP-dependent 99.92
TIGR00474454 selA seryl-tRNA(sec) selenium transferase. In bact 99.92
PLN02397423 aspartate transaminase 99.92
COG4992404 ArgD Ornithine/acetylornithine aminotransferase [A 99.91
PRK15407438 lipopolysaccharide biosynthesis protein RfbH; Prov 99.91
KOG1360570 consensus 5-aminolevulinate synthase [Coenzyme tra 99.91
PRK02936377 argD acetylornithine aminotransferase; Provisional 99.91
KOG0256471 consensus 1-aminocyclopropane-1-carboxylate syntha 99.91
cd00617431 Tnase_like Tryptophanase family (Tnase). This fami 99.91
cd00615294 Orn_deC_like Ornithine decarboxylase family. This 99.91
PRK04260375 acetylornithine aminotransferase; Provisional 99.9
COG2008342 GLY1 Threonine aldolase [Amino acid transport and 99.9
COG0626396 MetC Cystathionine beta-lyases/cystathionine gamma 99.9
PF00282373 Pyridoxal_deC: Pyridoxal-dependent decarboxylase c 99.9
PRK05093403 argD bifunctional N-succinyldiaminopimelate-aminot 99.9
TIGR03246397 arg_catab_astC succinylornithine transaminase fami 99.9
TIGR01885401 Orn_aminotrans ornithine aminotransferase. This mo 99.9
PRK12381406 bifunctional succinylornithine transaminase/acetyl 99.89
PRK06434384 cystathionine gamma-lyase; Validated 99.89
TIGR00461 939 gcvP glycine dehydrogenase (decarboxylating). This 99.89
KOG0634472 consensus Aromatic amino acid aminotransferase and 99.89
PLN02624474 ornithine-delta-aminotransferase 99.88
TIGR03531444 selenium_SpcS O-phosphoseryl-tRNA(Sec) selenium tr 99.88
PRK05964423 adenosylmethionine--8-amino-7-oxononanoate transam 99.88
COG0112413 GlyA Glycine/serine hydroxymethyltransferase [Amin 99.88
PLN00144382 acetylornithine transaminase 99.87
COG0160447 GabT 4-aminobutyrate aminotransferase and related 99.87
KOG0053409 consensus Cystathionine beta-lyases/cystathionine 99.87
KOG1368384 consensus Threonine aldolase [Amino acid transport 99.87
TIGR02407412 ectoine_ectB diaminobutyrate--2-oxoglutarate amino 99.87
PRK03715395 argD acetylornithine transaminase protein; Provisi 99.86
cd01494170 AAT_I Aspartate aminotransferase (AAT) superfamily 99.86
TIGR00713423 hemL glutamate-1-semialdehyde-2,1-aminomutase. Thi 99.86
PRK08360443 4-aminobutyrate aminotransferase; Provisional 99.86
TIGR03811608 tyr_de_CO2_Ent tyrosine decarboxylase, Enterococcu 99.86
KOG1359417 consensus Glycine C-acetyltransferase/2-amino-3-ke 99.86
TIGR00700420 GABAtrnsam 4-aminobutyrate aminotransferase, proka 99.86
PRK11522459 putrescine--2-oxoglutarate aminotransferase; Provi 99.85
PRK08117433 4-aminobutyrate aminotransferase; Provisional 99.85
PRK06777421 4-aminobutyrate aminotransferase; Provisional 99.85
COG3977417 Alanine-alpha-ketoisovalerate (or valine-pyruvate) 99.85
TIGR03372442 putres_am_tran putrescine aminotransferase. Member 99.85
PRK09264425 diaminobutyrate--2-oxoglutarate aminotransferase; 99.85
PF00464399 SHMT: Serine hydroxymethyltransferase; InterPro: I 99.84
COG1932365 SerC Phosphoserine aminotransferase [Coenzyme meta 99.84
PRK09792421 4-aminobutyrate transaminase; Provisional 99.84
PRK08088425 4-aminobutyrate aminotransferase; Validated 99.84
PRK07495425 4-aminobutyrate aminotransferase; Provisional 99.84
PF12897425 Aminotran_MocR: Alanine-glyoxylate amino-transfera 99.83
PLN02760504 4-aminobutyrate:pyruvate transaminase 99.83
KOG1383491 consensus Glutamate decarboxylase/sphingosine phos 99.83
PRK13360442 omega amino acid--pyruvate transaminase; Provision 99.83
PRK06541460 hypothetical protein; Provisional 99.83
PRK06058443 4-aminobutyrate aminotransferase; Provisional 99.83
KOG0633375 consensus Histidinol phosphate aminotransferase [A 99.83
PF01276417 OKR_DC_1: Orn/Lys/Arg decarboxylase, major domain; 99.83
PRK08593445 4-aminobutyrate aminotransferase; Provisional 99.83
PRK04612408 argD acetylornithine transaminase protein; Provisi 99.83
PRK06918451 4-aminobutyrate aminotransferase; Reviewed 99.83
COG0001432 HemL Glutamate-1-semialdehyde aminotransferase [Co 99.83
PRK04013364 argD acetylornithine/acetyl-lysine aminotransferas 99.82
PRK09221445 beta alanine--pyruvate transaminase; Provisional 99.82
PRK05965459 hypothetical protein; Provisional 99.82
PRK06062451 hypothetical protein; Provisional 99.81
PRK06105460 aminotransferase; Provisional 99.81
PRK15029 755 arginine decarboxylase; Provisional 99.81
PRK07678451 aminotransferase; Validated 99.81
PRK05639457 4-aminobutyrate aminotransferase; Provisional 99.81
COG1003496 GcvP Glycine cleavage system protein P (pyridoxal- 99.81
PRK07482461 hypothetical protein; Provisional 99.81
PRK06173429 adenosylmethionine--8-amino-7-oxononanoate transam 99.8
PRK07986428 adenosylmethionine--8-amino-7-oxononanoate transam 99.8
PRK06943453 adenosylmethionine--8-amino-7-oxononanoate transam 99.8
PRK05769441 4-aminobutyrate aminotransferase; Provisional 99.8
PRK06916460 adenosylmethionine--8-amino-7-oxononanoate transam 99.79
PRK13578 720 ornithine decarboxylase; Provisional 99.79
PRK05630422 adenosylmethionine--8-amino-7-oxononanoate transam 99.79
PRK07030466 adenosylmethionine--8-amino-7-oxononanoate transam 99.79
PRK07480456 putative aminotransferase; Validated 99.79
KOG1357519 consensus Serine palmitoyltransferase [Posttransla 99.78
TIGR02618450 tyr_phenol_ly tyrosine phenol-lyase. This model de 99.78
PRK06938464 diaminobutyrate--2-oxoglutarate aminotransferase; 99.78
TIGR00709442 dat 2,4-diaminobutyrate 4-transaminases. This fami 99.78
PRK06082459 4-aminobutyrate aminotransferase; Provisional 99.78
PRK00062426 glutamate-1-semialdehyde aminotransferase; Provisi 99.78
PRK07036466 hypothetical protein; Provisional 99.78
PF02347429 GDC-P: Glycine cleavage system P-protein; InterPro 99.78
PRK08742472 adenosylmethionine--8-amino-7-oxononanoate transam 99.78
PRK07481449 hypothetical protein; Provisional 99.77
PRK07046453 aminotransferase; Validated 99.77
TIGR00508427 bioA adenosylmethionine-8-amino-7-oxononanoate tra 99.77
PRK13237460 tyrosine phenol-lyase; Provisional 99.77
PRK12389428 glutamate-1-semialdehyde aminotransferase; Provisi 99.76
PRK12403460 putative aminotransferase; Provisional 99.76
PRK00615433 glutamate-1-semialdehyde aminotransferase; Provisi 99.76
PRK07483443 hypothetical protein; Provisional 99.76
PRK06917447 hypothetical protein; Provisional 99.76
COG1448396 TyrB Aspartate/tyrosine/aromatic aminotransferase 99.75
COG0403450 GcvP Glycine cleavage system protein P (pyridoxal- 99.75
KOG1402427 consensus Ornithine aminotransferase [Amino acid t 99.74
TIGR03251431 LAT_fam L-lysine 6-transaminase. Characterized mem 99.74
COG0161449 BioA Adenosylmethionine-8-amino-7-oxononanoate ami 99.74
KOG0628511 consensus Aromatic-L-amino-acid/L-histidine decarb 99.74
PRK06931459 diaminobutyrate--2-oxoglutarate aminotransferase; 99.74
PLN02482474 glutamate-1-semialdehyde 2,1-aminomutase 99.74
PRK061481013 hypothetical protein; Provisional 99.74
TIGR00699464 GABAtrns_euk 4-aminobutyrate aminotransferase, euk 99.73
PRK06149972 hypothetical protein; Provisional 99.73
PRK15400 714 lysine decarboxylase CadA; Provisional 99.73
PRK08297443 L-lysine aminotransferase; Provisional 99.73
PRK15399 713 lysine decarboxylase LdcC; Provisional 99.71
KOG0629510 consensus Glutamate decarboxylase and related prot 99.69
KOG0258475 consensus Alanine aminotransferase [Amino acid tra 99.68
COG1982 557 LdcC Arginine/lysine/ornithine decarboxylases [Ami 99.67
PLN02974817 adenosylmethionine-8-amino-7-oxononanoate transami 99.64
KOG2467477 consensus Glycine/serine hydroxymethyltransferase 99.62
PRK12566 954 glycine dehydrogenase; Provisional 99.62
KOG1404442 consensus Alanine-glyoxylate aminotransferase AGT2 99.61
PRK06209431 glutamate-1-semialdehyde 2,1-aminomutase; Provisio 99.61
PF01212290 Beta_elim_lyase: Beta-eliminating lyase; InterPro: 99.6
KOG1358467 consensus Serine palmitoyltransferase [Posttransla 99.58
KOG1401433 consensus Acetylornithine aminotransferase [Amino 99.57
TIGR02617467 tnaA_trp_ase tryptophanase, leader peptide-associa 99.57
KOG20401001 consensus Glycine dehydrogenase (decarboxylating) 99.56
KOG2790370 consensus Phosphoserine aminotransferase [Coenzyme 99.55
COG1921395 SelA Selenocysteine synthase [seryl-tRNASer seleni 99.48
PF05889389 SLA_LP_auto_ag: Soluble liver antigen/liver pancre 99.45
PF00202339 Aminotran_3: Aminotransferase class-III; InterPro: 99.45
PF03841367 SelA: L-seryl-tRNA selenium transferase; InterPro: 99.41
PF06838403 Met_gamma_lyase: Methionine gamma-lyase ; InterPro 99.38
PF04864363 Alliinase_C: Allinase; InterPro: IPR006948 Allicin 99.35
COG3033471 TnaA Tryptophanase [Amino acid transport and metab 99.32
KOG1403452 consensus Predicted alanine-glyoxylate aminotransf 99.29
KOG2040 1001 consensus Glycine dehydrogenase (decarboxylating) 99.19
KOG1412410 consensus Aspartate aminotransferase/Glutamic oxal 99.1
COG4100416 Cystathionine beta-lyase family protein involved i 98.88
KOG1411427 consensus Aspartate aminotransferase/Glutamic oxal 98.7
KOG1405484 consensus 4-aminobutyrate aminotransferase [Amino 98.63
KOG2142 728 consensus Molybdenum cofactor sulfurase [Coenzyme 98.39
KOG3843432 consensus Predicted serine hydroxymethyltransferas 97.7
PLN02994153 1-aminocyclopropane-1-carboxylate synthase 97.5
KOG0630 838 consensus Predicted pyridoxal-dependent decarboxyl 93.85
KOG2142 728 consensus Molybdenum cofactor sulfurase [Coenzyme 92.17
TIGR03573343 WbuX N-acetyl sugar amidotransferase. This enzyme 80.75
>COG0520 csdA Selenocysteine lyase/Cysteine desulfurase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
Probab=100.00  E-value=5.1e-63  Score=473.66  Aligned_cols=397  Identities=55%  Similarity=0.892  Sum_probs=372.5

Q ss_pred             hhhcCCCCcccccccCCCCeEEecCCCCCCCcHHHHHHHHHHHHHhccCCCCCcchhhhHHHHHHHHHHHHHHHHcCCCC
Q 012718           49 HITRPDFPILHQEVYGSKKLVYLDNAATSQKPIAVLKALQNYYEAYNSNVHRGIHFLSAKATDEYELARKKVAAFINASD  128 (458)
Q Consensus        49 ~~~r~~f~~~~~~~~~~~~~i~l~~~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~la~~~g~~~  128 (458)
                      ..+|++||.+.+..  +++++|||++..++.|..+++++.+++..++.|++++.+..+....+.++++|+.+|+++|+++
T Consensus         6 ~~~r~~fp~l~~~~--~~~~vylD~aa~~~~p~~V~~a~~~~~~~~~an~~r~~~~~~~~~t~~~e~aRe~va~~~~a~~   83 (405)
T COG0520           6 AAVRADFPALKREV--GKPLVYLDNAATSQKPQAVLDAVAEYYRRYNANVHRGAHTLAEEATDLYEAAREAVARFLNADS   83 (405)
T ss_pred             HHHHhhCHHHhhcc--CCCeEEecCcccccCCHHHHHHHHHHHHhhcCCcCcccchHHHHHHHHHHHHHHHHHHHhCCCC
Confidence            34788999986544  3578999999999999999999999999999999999999988899999999999999999996


Q ss_pred             CCcEEEeCChhHHHHHHHHHcCCCCCCCCCEEEEcCCCCccchHHHHHHHHHcCCeEEEEeCCCCCCCCHHHHHHhhcCC
Q 012718          129 SGEIVFTKNATEAINLVAYSWGLSNLKSGDEVILTVAEHHSAIVPWQLVAQKTGANLKFLNLNDDESPDLDKLKEMLSRK  208 (458)
Q Consensus       129 ~~~v~~t~g~t~a~~~~~~~l~~~~~~~g~~vl~~~~~~~s~~~~~~~~a~~~g~~~~~v~~~~~~~~d~~~l~~~l~~~  208 (458)
                      .++|+||.|+|+++++++.++... +++||+|++++.+|+++..+|+.++++.|++++.+|++++|.++++++++.++++
T Consensus        84 ~~eIvft~~tT~aln~va~~l~~~-~~~gdeIv~s~~EH~sn~~pw~~~~~~~Ga~v~~i~~~~~g~~~~~~~~~~i~~~  162 (405)
T COG0520          84 SDEIVFTRGTTEALNLVARGLGRS-LKPGDEIVVSDLEHHSNIVPWQELAKRTGAKVRVIPLDDDGLLDLDALEKLITPK  162 (405)
T ss_pred             CCeEEEeCChhHHHHHHHHHhhhh-hcCCCEEEEccCcchhhHHHHHHHHHhcCcEEEEEecCCCCCcCHHHHHHhcCCC
Confidence            449999999999999999998532 7899999999999999999999999999999999999989999999999999999


Q ss_pred             ceEEEEecccCcCcccccHHHHHHHHHhcCcEEEEeccccCCcccCCCCCCCCcEEEecccC-CCCCCceeEEEEecccc
Q 012718          209 TKLVVIHHISNMLASILPIEEIVHWSHDVGAKVLVDACQSVPHMVVDVQGLDADFLVASSHK-MCGPTGIGFLFGKSDLL  287 (458)
Q Consensus       209 ~~~v~~~~~~n~tG~~~~l~~i~~l~~~~~~~vivD~a~~~g~~~~~~~~~~~d~~~~s~~K-~~gp~g~G~l~~~~~~~  287 (458)
                      |++|.+++++|.||.+.|+++|+++||++|++++||++|+.|+.++|+.++++||+++|+|| ++||.|+|+|+++++++
T Consensus       163 Tklvais~vSn~tG~~~pv~~I~~la~~~ga~v~VDaaq~~~h~~idv~~l~~Df~afsgHKwl~gP~GiGvLy~r~~~l  242 (405)
T COG0520         163 TKLVALSHVSNVTGTVNPVKEIAELAHEHGALVLVDAAQAAGHLPIDVQELGCDFLAFSGHKWLLGPTGIGVLYVRKELL  242 (405)
T ss_pred             ceEEEEECccccccccchHHHHHHHHHHcCCEEEEECccccCccCCCchhcCCCEEEEcccccccCCCceEEEEEchHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999 88999999999999999


Q ss_pred             ccCCCccccCcceEeeec-CCCCCCCCCCccCCCCCCHHHHHHHHHHHHHHHHhCHHHHHHHHHHHHHHHHHHHhcCCCE
Q 012718          288 SAMPPFLGGGEMISDVFL-DHSTFADPPSRFEAGTPAIGEAIGLGAAIDYLSTIGMQKIHAYEMELAKYLYENLLSIPNI  366 (458)
Q Consensus       288 ~~l~~~~~g~~~~~~~~~-~~~~~~~~~~~~~~gt~~~~~~~~l~~al~~~~~~g~~~~~~~~~~l~~~l~~~L~~~~~~  366 (458)
                      +.+.|...||+.+..... ....+...+.+|+.||+++.+.+++.++++++.+.|++.+.++.+++.+++.+.|+++|++
T Consensus       243 ~~l~P~~~gg~~~~~~~~~~~~~~~~~p~rfe~gTpn~~~~i~l~aAl~~~~~ig~~~i~~~e~~L~~~~~~~L~~~~~v  322 (405)
T COG0520         243 EELEPFLGGGGMIEYVSRDEGVTLAELPLRFEAGTPNIAGAIGLAAALDYLLEIGMEAIEAHERELTEYLLEGLSELPGV  322 (405)
T ss_pred             hhcCCcccCCCceeeecccccccccCcchhhccCCchHHHHHhHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHhcCCCe
Confidence            999999999998887665 4466788899999999999999999999999999999999999999999999999999999


Q ss_pred             EEeCCCCCCcCccccEEEEEeCCCChHHHHHHHhhhcCeEeccCCCCChhhHhhcCCCCeEEEeeCCCCCHHHHHHHHHH
Q 012718          367 RIYGPKPSEHVQRAALCSFNVENIHPTDIATLLDQQYGVATRSGHHCAQPLHRYLGVNASARASLHFYNTKEDVDEFIHA  446 (458)
Q Consensus       367 ~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~~~l~~~~gi~~~~g~~~~~~~~~~~g~~~~lRis~~~~~t~~di~~l~~~  446 (458)
                      ++++++.   ..++++++|++++.+..++...|.++ ||.++.|++|..+.+..++.+..+|+|+++|||.+|||+|+++
T Consensus       323 ~i~g~~~---~~r~~~vsF~v~~~~~~dv~~~L~~~-gI~vr~g~~ca~p~~~~~~~~~~iR~S~~~YNt~edid~l~~a  398 (405)
T COG0520         323 EIYGPPD---ADRGGIVSFNVKGIHPHDVATLLDEK-GIAVRAGHHCAQPLHRLLGVDATIRASLHLYNTEEDVDRLLEA  398 (405)
T ss_pred             EEecCCc---ccCceEEEEEeCCCCHHHHHHHHHhC-CeEEEeccccccHHHHhcCCCCceEEEEeecCCHHHHHHHHHH
Confidence            9999874   25689999999999999999999999 9999999999999999999999999999999999999999999


Q ss_pred             HHHHHH
Q 012718          447 LNETVS  452 (458)
Q Consensus       447 l~~~~~  452 (458)
                      |+++.+
T Consensus       399 L~~~~~  404 (405)
T COG0520         399 LKKALA  404 (405)
T ss_pred             HHHHhh
Confidence            998764



>PLN02855 Bifunctional selenocysteine lyase/cysteine desulfurase Back     alignment and domain information
>PRK09295 bifunctional cysteine desulfurase/selenocysteine lyase; Validated Back     alignment and domain information
>TIGR03392 FeS_syn_CsdA cysteine desulfurase, catalytic subunit CsdA Back     alignment and domain information
>PRK10874 cysteine sulfinate desulfinase; Provisional Back     alignment and domain information
>TIGR01979 sufS cysteine desulfurases, SufS subfamily Back     alignment and domain information
>COG1104 NifS Cysteine sulfinate desulfinase/cysteine desulfurase and related enzymes [Amino acid transport and metabolism] Back     alignment and domain information
>PF00266 Aminotran_5: Aminotransferase class-V; InterPro: IPR000192 Aminotransferases share certain mechanistic features with other pyridoxal- phosphate dependent enzymes, such as the covalent binding of the pyridoxal- phosphate group to a lysine residue Back     alignment and domain information
>cd06453 SufS_like Cysteine desulfurase (SufS)-like Back     alignment and domain information
>PLN02651 cysteine desulfurase Back     alignment and domain information
>PLN02724 Molybdenum cofactor sulfurase Back     alignment and domain information
>TIGR03402 FeS_nifS cysteine desulfurase NifS Back     alignment and domain information
>TIGR01976 am_tr_V_VC1184 cysteine desulfurase family protein, VC1184 subfamily Back     alignment and domain information
>TIGR01977 am_tr_V_EF2568 cysteine desulfurase family protein Back     alignment and domain information
>TIGR02006 IscS cysteine desulfurase IscS Back     alignment and domain information
>TIGR03403 nifS_epsilon cysteine desulfurase, NifS family, epsilon proteobacteria type Back     alignment and domain information
>KOG1549 consensus Cysteine desulfurase NFS1 [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01814 kynureninase kynureninase Back     alignment and domain information
>PRK02948 cysteine desulfurase; Provisional Back     alignment and domain information
>PRK14012 cysteine desulfurase; Provisional Back     alignment and domain information
>TIGR03235 DNA_S_dndA cysteine desulfurase DndA Back     alignment and domain information
>PLN02409 serine--glyoxylate aminotransaminase Back     alignment and domain information
>cd06451 AGAT_like Alanine-glyoxylate aminotransferase (AGAT) family Back     alignment and domain information
>PRK03080 phosphoserine aminotransferase; Provisional Back     alignment and domain information
>TIGR02326 transamin_PhnW 2-aminoethylphosphonate--pyruvate transaminase Back     alignment and domain information
>TIGR01364 serC_1 phosphoserine aminotransferase Back     alignment and domain information
>cd00611 PSAT_like Phosphoserine aminotransferase (PSAT) family Back     alignment and domain information
>COG3844 Kynureninase [Amino acid transport and metabolism] Back     alignment and domain information
>COG0436 Aspartate/tyrosine/aromatic aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13479 2-aminoethylphosphonate--pyruvate transaminase; Provisional Back     alignment and domain information
>PRK05355 3-phosphoserine/phosphohydroxythreonine aminotransferase; Provisional Back     alignment and domain information
>COG0075 Serine-pyruvate aminotransferase/archaeal aspartate aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03301 PhnW-AepZ 2-aminoethylphosphonate aminotransferase Back     alignment and domain information
>TIGR01788 Glu-decarb-GAD glutamate decarboxylase Back     alignment and domain information
>PRK02769 histidine decarboxylase; Provisional Back     alignment and domain information
>PRK09331 Sep-tRNA:Cys-tRNA synthetase; Provisional Back     alignment and domain information
>PRK06225 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK13520 L-tyrosine decarboxylase; Provisional Back     alignment and domain information
>TIGR01141 hisC histidinol-phosphate aminotransferase Back     alignment and domain information
>PRK06207 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK05957 aspartate aminotransferase; Provisional Back     alignment and domain information
>PTZ00094 serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>TIGR01366 serC_3 phosphoserine aminotransferase, putative Back     alignment and domain information
>TIGR02539 SepCysS Sep-tRNA:Cys-tRNA synthase Back     alignment and domain information
>PRK07681 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK05387 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK06108 aspartate aminotransferase; Provisional Back     alignment and domain information
>PLN02187 rooty/superroot1 Back     alignment and domain information
>PLN00145 tyrosine/nicotianamine aminotransferase; Provisional Back     alignment and domain information
>PRK01533 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PLN03026 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK04870 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK08960 hypothetical protein; Provisional Back     alignment and domain information
>PRK03158 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>cd00613 GDC-P Glycine cleavage system P-protein, alpha- and beta-subunits Back     alignment and domain information
>cd06452 SepCysS Sep-tRNA:Cys-tRNA synthase Back     alignment and domain information
>PRK14807 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>KOG0259 consensus Tyrosine aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07324 transaminase; Validated Back     alignment and domain information
>TIGR03540 DapC_direct LL-diaminopimelate aminotransferase Back     alignment and domain information
>PLN00175 aminotransferase family protein; Provisional Back     alignment and domain information
>PRK07682 hypothetical protein; Validated Back     alignment and domain information
>TIGR03812 tyr_de_CO2_Arch tyrosine decarboxylase MnfA Back     alignment and domain information
>cd06450 DOPA_deC_like DOPA decarboxylase family Back     alignment and domain information
>PRK09276 LL-diaminopimelate aminotransferase; Provisional Back     alignment and domain information
>PRK09105 putative aminotransferase; Provisional Back     alignment and domain information
>PRK00950 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PRK08361 aspartate aminotransferase; Provisional Back     alignment and domain information
>PTZ00433 tyrosine aminotransferase; Provisional Back     alignment and domain information
>PRK02731 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PRK07366 succinyldiaminopimelate transaminase; Validated Back     alignment and domain information
>PRK08056 threonine-phosphate decarboxylase; Provisional Back     alignment and domain information
>TIGR01264 tyr_amTase_E tyrosine aminotransferase, eukaryotic Back     alignment and domain information
>PLN03032 serine decarboxylase; Provisional Back     alignment and domain information
>TIGR01822 2am3keto_CoA 2-amino-3-ketobutyrate coenzyme A ligase Back     alignment and domain information
>TIGR01265 tyr_nico_aTase tyrosine/nicotianamine aminotransferases Back     alignment and domain information
>PRK09147 succinyldiaminopimelate transaminase; Provisional Back     alignment and domain information
>PRK05764 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK06290 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK05942 aspartate aminotransferase; Provisional Back     alignment and domain information
>COG0079 HisC Histidinol-phosphate/aromatic aminotransferase and cobyric acid decarboxylase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03538 DapC_gpp succinyldiaminopimelate transaminase Back     alignment and domain information
>PRK06348 aspartate aminotransferase; Provisional Back     alignment and domain information
>PLN02656 tyrosine transaminase Back     alignment and domain information
>PRK07337 aminotransferase; Validated Back     alignment and domain information
>PLN00143 tyrosine/nicotianamine aminotransferase; Provisional Back     alignment and domain information
>cd06454 KBL_like KBL_like; this family belongs to the pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I) Back     alignment and domain information
>TIGR03537 DapC succinyldiaminopimelate transaminase Back     alignment and domain information
>PRK08068 transaminase; Reviewed Back     alignment and domain information
>PRK07568 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK07908 hypothetical protein; Provisional Back     alignment and domain information
>PRK07550 hypothetical protein; Provisional Back     alignment and domain information
>PRK00451 glycine dehydrogenase subunit 1; Validated Back     alignment and domain information
>PRK08912 hypothetical protein; Provisional Back     alignment and domain information
>PRK07309 aromatic amino acid aminotransferase; Validated Back     alignment and domain information
>PRK13355 bifunctional HTH-domain containing protein/aminotransferase; Provisional Back     alignment and domain information
>PTZ00377 alanine aminotransferase; Provisional Back     alignment and domain information
>PRK07179 hypothetical protein; Provisional Back     alignment and domain information
>PRK04366 glycine dehydrogenase subunit 2; Validated Back     alignment and domain information
>PRK15481 transcriptional regulatory protein PtsJ; Provisional Back     alignment and domain information
>KOG2862 consensus Alanine-glyoxylate aminotransferase AGT1 [General function prediction only] Back     alignment and domain information
>PRK08363 alanine aminotransferase; Validated Back     alignment and domain information
>PRK07683 aminotransferase A; Validated Back     alignment and domain information
>PRK06358 threonine-phosphate decarboxylase; Provisional Back     alignment and domain information
>PRK06107 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK12414 putative aminotransferase; Provisional Back     alignment and domain information
>PRK02610 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK03321 putative aminotransferase; Provisional Back     alignment and domain information
>PRK09148 aminotransferase; Validated Back     alignment and domain information
>PRK05166 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK04635 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK09265 aminotransferase AlaT; Validated Back     alignment and domain information
>PRK08636 aspartate aminotransferase; Provisional Back     alignment and domain information
>TIGR00858 bioF 8-amino-7-oxononanoate synthase Back     alignment and domain information
>PRK08153 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK09082 methionine aminotransferase; Validated Back     alignment and domain information
>PRK01688 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK05937 8-amino-7-oxononanoate synthase; Provisional Back     alignment and domain information
>PRK14809 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK07392 threonine-phosphate decarboxylase; Validated Back     alignment and domain information
>PRK06836 aspartate aminotransferase; Provisional Back     alignment and domain information
>TIGR01437 selA_rel uncharacterized pyridoxal phosphate-dependent enzyme Back     alignment and domain information
>PRK05958 8-amino-7-oxononanoate synthase; Reviewed Back     alignment and domain information
>KOG0257 consensus Kynurenine aminotransferase, glutamine transaminase K [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02452 phosphoserine transaminase Back     alignment and domain information
>COG1168 MalY Bifunctional PLP-dependent enzyme with beta-cystathionase and maltose regulon repressor activities [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02376 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>PLN02450 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>PLN02607 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>PLN02414 glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK08175 aminotransferase; Validated Back     alignment and domain information
>TIGR01821 5aminolev_synth 5-aminolevulinic acid synthase Back     alignment and domain information
>PRK03317 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK07777 aminotransferase; Validated Back     alignment and domain information
>PRK13392 5-aminolevulinate synthase; Provisional Back     alignment and domain information
>COG1167 ARO8 Transcriptional regulators containing a DNA-binding HTH domain and an aminotransferase domain (MocR family) and their eukaryotic orthologs [Transcription / Amino acid transport and metabolism] Back     alignment and domain information
>PRK14808 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PLN02483 serine palmitoyltransferase Back     alignment and domain information
>PRK06855 aminotransferase; Validated Back     alignment and domain information
>PRK06939 2-amino-3-ketobutyrate coenzyme A ligase; Provisional Back     alignment and domain information
>PLN02822 serine palmitoyltransferase Back     alignment and domain information
>PRK07590 L,L-diaminopimelate aminotransferase; Validated Back     alignment and domain information
>PLN02721 threonine aldolase Back     alignment and domain information
>PRK09064 5-aminolevulinate synthase; Validated Back     alignment and domain information
>PLN02414 glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK05839 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03542 DAPAT_plant LL-diaminopimelate aminotransferase Back     alignment and domain information
>PRK03967 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>TIGR01825 gly_Cac_T_rel pyridoxal phosphate-dependent acyltransferase, putative Back     alignment and domain information
>PRK06425 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PLN02672 methionine S-methyltransferase Back     alignment and domain information
>PRK13393 5-aminolevulinate synthase; Provisional Back     alignment and domain information
>PF00155 Aminotran_1_2: Aminotransferase class I and II 1-aminocyclopropane-1-carboxylate synthase signature aspartate aminotransferase signature; InterPro: IPR004839 Aminotransferases share certain mechanistic features with other pyridoxal-phosphate dependent enzymes, such as the covalent binding of the pyridoxal-phosphate group to a lysine residue Back     alignment and domain information
>PRK04781 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>cd00378 SHMT Serine-glycine hydroxymethyltransferase (SHMT) Back     alignment and domain information
>cd00609 AAT_like Aspartate aminotransferase family Back     alignment and domain information
>PLN02231 alanine transaminase Back     alignment and domain information
>TIGR01140 L_thr_O3P_dcar L-threonine-O-3-phosphate decarboxylase Back     alignment and domain information
>PRK00011 glyA serine hydroxymethyltransferase; Reviewed Back     alignment and domain information
>TIGR03799 NOD_PanD_pyr putative pyridoxal-dependent aspartate 1-decarboxylase Back     alignment and domain information
>PRK12462 phosphoserine aminotransferase; Provisional Back     alignment and domain information
>PRK05367 glycine dehydrogenase; Provisional Back     alignment and domain information
>PRK07865 N-succinyldiaminopimelate aminotransferase; Reviewed Back     alignment and domain information
>PRK08064 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PLN02880 tyrosine decarboxylase Back     alignment and domain information
>cd00616 AHBA_syn 3-amino-5-hydroxybenzoic acid synthase family (AHBA_syn) Back     alignment and domain information
>PRK08133 O-succinylhomoserine sulfhydrylase; Validated Back     alignment and domain information
>TIGR03539 DapC_actino succinyldiaminopimelate transaminase Back     alignment and domain information
>cd06502 TA_like Low-specificity threonine aldolase (TA) Back     alignment and domain information
>PLN02590 probable tyrosine decarboxylase Back     alignment and domain information
>PRK07504 O-succinylhomoserine sulfhydrylase; Reviewed Back     alignment and domain information
>PRK05968 hypothetical protein; Provisional Back     alignment and domain information
>PRK08249 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK09028 cystathionine beta-lyase; Provisional Back     alignment and domain information
>cd00614 CGS_like CGS_like: Cystathionine gamma-synthase is a PLP dependent enzyme and catalyzes the committed step of methionine biosynthesis Back     alignment and domain information
>PRK06767 methionine gamma-lyase; Provisional Back     alignment and domain information
>TIGR01329 cysta_beta_ly_E cystathionine beta-lyase, eukaryotic Back     alignment and domain information
>PRK08354 putative aminotransferase; Provisional Back     alignment and domain information
>PRK08861 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK05664 threonine-phosphate decarboxylase; Reviewed Back     alignment and domain information
>PRK08134 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK08776 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK09275 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK06959 putative threonine-phosphate decarboxylase; Provisional Back     alignment and domain information
>PRK09440 avtA valine--pyruvate transaminase; Provisional Back     alignment and domain information
>PRK13238 tnaA tryptophanase/L-cysteine desulfhydrase, PLP-dependent; Provisional Back     alignment and domain information
>PRK08045 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>TIGR01328 met_gam_lyase methionine gamma-lyase Back     alignment and domain information
>TIGR01365 serC_2 phosphoserine aminotransferase, Methanosarcina type Back     alignment and domain information
>TIGR01324 cysta_beta_ly_B cystathionine beta-lyase, bacterial Back     alignment and domain information
>TIGR01325 O_suc_HS_sulf O-succinylhomoserine sulfhydrylase Back     alignment and domain information
>TIGR03801 asp_4_decarbox aspartate 4-decarboxylase Back     alignment and domain information
>PRK07503 methionine gamma-lyase; Provisional Back     alignment and domain information
>PRK06460 hypothetical protein; Provisional Back     alignment and domain information
>COG0156 BioF 7-keto-8-aminopelargonate synthetase and related enzymes [Coenzyme metabolism] Back     alignment and domain information
>PRK06234 methionine gamma-lyase; Provisional Back     alignment and domain information
>PRK07810 O-succinylhomoserine sulfhydrylase; Provisional Back     alignment and domain information
>PLN02263 serine decarboxylase Back     alignment and domain information
>PRK08114 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK11658 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>PRK09257 aromatic amino acid aminotransferase; Provisional Back     alignment and domain information
>PRK13580 serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>PRK08248 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>COG0399 WecE Predicted pyridoxal phosphate-dependent enzyme apparently involved in regulation of cell wall biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR02080 O_succ_thio_ly O-succinylhomoserine (thiol)-lyase Back     alignment and domain information
>TIGR03588 PseC UDP-4-keto-6-deoxy-N-acetylglucosamine 4-aminotransferase Back     alignment and domain information
>PLN02242 methionine gamma-lyase Back     alignment and domain information
>KOG3846 consensus L-kynurenine hydrolase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07811 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK10534 L-threonine aldolase; Provisional Back     alignment and domain information
>PRK03244 argD acetylornithine aminotransferase; Provisional Back     alignment and domain information
>PTZ00376 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK08637 hypothetical protein; Provisional Back     alignment and domain information
>PRK08574 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK13034 serine hydroxymethyltransferase; Reviewed Back     alignment and domain information
>PRK08247 cystathionine gamma-synthase; Reviewed Back     alignment and domain information
>cd00610 OAT_like Acetyl ornithine aminotransferase family Back     alignment and domain information
>PLN03227 serine palmitoyltransferase-like protein; Provisional Back     alignment and domain information
>PRK07812 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PLN02955 8-amino-7-oxononanoate synthase Back     alignment and domain information
>PRK05367 glycine dehydrogenase; Provisional Back     alignment and domain information
>PLN03226 serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>PRK05613 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>TIGR03576 pyridox_MJ0158 pyridoxal phosphate enzyme, MJ0158 family Back     alignment and domain information
>PRK05967 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK04073 rocD ornithine--oxo-acid transaminase; Provisional Back     alignment and domain information
>PLN02271 serine hydroxymethyltransferase Back     alignment and domain information
>PRK00854 rocD ornithine--oxo-acid transaminase; Reviewed Back     alignment and domain information
>PRK06702 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK07050 cystathionine beta-lyase; Provisional Back     alignment and domain information
>TIGR01326 OAH_OAS_sulfhy OAH/OAS sulfhydrylase Back     alignment and domain information
>PRK01278 argD acetylornithine transaminase protein; Provisional Back     alignment and domain information
>PRK05994 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK06176 cystathionine gamma-synthase/cystathionine beta-lyase; Validated Back     alignment and domain information
>PRK12566 glycine dehydrogenase; Provisional Back     alignment and domain information
>TIGR02379 ECA_wecE TDP-4-keto-6-deoxy-D-glucose transaminase Back     alignment and domain information
>COG1103 Archaea-specific pyridoxal phosphate-dependent enzymes [General function prediction only] Back     alignment and domain information
>PRK07582 cystathionine gamma-lyase; Validated Back     alignment and domain information
>PRK06084 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK07505 hypothetical protein; Provisional Back     alignment and domain information
>PRK05939 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00707 argD acetylornithine and succinylornithine aminotransferases Back     alignment and domain information
>COG0076 GadB Glutamate decarboxylase and related PLP-dependent proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07671 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK07269 cystathionine gamma-synthase; Reviewed Back     alignment and domain information
>PF01041 DegT_DnrJ_EryC1: DegT/DnrJ/EryC1/StrS aminotransferase family; InterPro: IPR000653 This entry represents a family that are probably all pyridoxal-phosphate-dependent aminotransferase enzymes with a variety of molecular functions Back     alignment and domain information
>COG2873 MET17 O-acetylhomoserine sulfhydrylase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00461 gcvP glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK07049 methionine gamma-lyase; Validated Back     alignment and domain information
>PLN02368 alanine transaminase Back     alignment and domain information
>PTZ00125 ornithine aminotransferase-like protein; Provisional Back     alignment and domain information
>PLN02509 cystathionine beta-lyase Back     alignment and domain information
>PRK02627 acetylornithine aminotransferase; Provisional Back     alignment and domain information
>PRK04311 selenocysteine synthase; Provisional Back     alignment and domain information
>PRK11706 TDP-4-oxo-6-deoxy-D-glucose transaminase; Provisional Back     alignment and domain information
>PF01053 Cys_Met_Meta_PP: Cys/Met metabolism PLP-dependent enzyme; InterPro: IPR000277 Pyridoxal phosphate is the active form of vitamin B6 (pyridoxine or pyridoxal) Back     alignment and domain information
>TIGR00474 selA seryl-tRNA(sec) selenium transferase Back     alignment and domain information
>PLN02397 aspartate transaminase Back     alignment and domain information
>COG4992 ArgD Ornithine/acetylornithine aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK15407 lipopolysaccharide biosynthesis protein RfbH; Provisional Back     alignment and domain information
>KOG1360 consensus 5-aminolevulinate synthase [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK02936 argD acetylornithine aminotransferase; Provisional Back     alignment and domain information
>KOG0256 consensus 1-aminocyclopropane-1-carboxylate synthase, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>cd00617 Tnase_like Tryptophanase family (Tnase) Back     alignment and domain information
>cd00615 Orn_deC_like Ornithine decarboxylase family Back     alignment and domain information
>PRK04260 acetylornithine aminotransferase; Provisional Back     alignment and domain information
>COG2008 GLY1 Threonine aldolase [Amino acid transport and metabolism] Back     alignment and domain information
>COG0626 MetC Cystathionine beta-lyases/cystathionine gamma-synthases [Amino acid transport and metabolism] Back     alignment and domain information
>PF00282 Pyridoxal_deC: Pyridoxal-dependent decarboxylase conserved domain; InterPro: IPR002129 Pyridoxal phosphate is the active form of vitamin B6 (pyridoxine or pyridoxal) Back     alignment and domain information
>PRK05093 argD bifunctional N-succinyldiaminopimelate-aminotransferase/acetylornithine transaminase protein; Reviewed Back     alignment and domain information
>TIGR03246 arg_catab_astC succinylornithine transaminase family Back     alignment and domain information
>TIGR01885 Orn_aminotrans ornithine aminotransferase Back     alignment and domain information
>PRK12381 bifunctional succinylornithine transaminase/acetylornithine transaminase; Provisional Back     alignment and domain information
>PRK06434 cystathionine gamma-lyase; Validated Back     alignment and domain information
>TIGR00461 gcvP glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>KOG0634 consensus Aromatic amino acid aminotransferase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02624 ornithine-delta-aminotransferase Back     alignment and domain information
>TIGR03531 selenium_SpcS O-phosphoseryl-tRNA(Sec) selenium transferase Back     alignment and domain information
>PRK05964 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>COG0112 GlyA Glycine/serine hydroxymethyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN00144 acetylornithine transaminase Back     alignment and domain information
>COG0160 GabT 4-aminobutyrate aminotransferase and related aminotransferases [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0053 consensus Cystathionine beta-lyases/cystathionine gamma-synthases [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1368 consensus Threonine aldolase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02407 ectoine_ectB diaminobutyrate--2-oxoglutarate aminotransferase Back     alignment and domain information
>PRK03715 argD acetylornithine transaminase protein; Provisional Back     alignment and domain information
>cd01494 AAT_I Aspartate aminotransferase (AAT) superfamily (fold type I) of pyridoxal phosphate (PLP)-dependent enzymes Back     alignment and domain information
>TIGR00713 hemL glutamate-1-semialdehyde-2,1-aminomutase Back     alignment and domain information
>PRK08360 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>TIGR03811 tyr_de_CO2_Ent tyrosine decarboxylase, Enterococcus type Back     alignment and domain information
>KOG1359 consensus Glycine C-acetyltransferase/2-amino-3-ketobutyrate-CoA ligase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00700 GABAtrnsam 4-aminobutyrate aminotransferase, prokaryotic type Back     alignment and domain information
>PRK11522 putrescine--2-oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>PRK08117 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK06777 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>COG3977 Alanine-alpha-ketoisovalerate (or valine-pyruvate) aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03372 putres_am_tran putrescine aminotransferase Back     alignment and domain information
>PRK09264 diaminobutyrate--2-oxoglutarate aminotransferase; Validated Back     alignment and domain information
>PF00464 SHMT: Serine hydroxymethyltransferase; InterPro: IPR001085 Synonym(s): Serine hydroxymethyltransferase, Serine aldolase, Threonine aldolase Serine hydroxymethyltransferase (SHMT) is a pyridoxal phosphate (PLP) dependent enzyme and belongs to the aspartate aminotransferase superfamily (fold type I) [] Back     alignment and domain information
>COG1932 SerC Phosphoserine aminotransferase [Coenzyme metabolism / Amino acid transport and metabolism] Back     alignment and domain information
>PRK09792 4-aminobutyrate transaminase; Provisional Back     alignment and domain information
>PRK08088 4-aminobutyrate aminotransferase; Validated Back     alignment and domain information
>PRK07495 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PF12897 Aminotran_MocR: Alanine-glyoxylate amino-transferase; InterPro: IPR024551 This entry represents a family of putative aminotransferases Back     alignment and domain information
>PLN02760 4-aminobutyrate:pyruvate transaminase Back     alignment and domain information
>KOG1383 consensus Glutamate decarboxylase/sphingosine phosphate lyase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13360 omega amino acid--pyruvate transaminase; Provisional Back     alignment and domain information
>PRK06541 hypothetical protein; Provisional Back     alignment and domain information
>PRK06058 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>KOG0633 consensus Histidinol phosphate aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PF01276 OKR_DC_1: Orn/Lys/Arg decarboxylase, major domain; InterPro: IPR000310 Pyridoxal-dependent decarboxylases are bacterial proteins acting on ornithine, lysine, arginine and related substrates [] Back     alignment and domain information
>PRK08593 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK04612 argD acetylornithine transaminase protein; Provisional Back     alignment and domain information
>PRK06918 4-aminobutyrate aminotransferase; Reviewed Back     alignment and domain information
>COG0001 HemL Glutamate-1-semialdehyde aminotransferase [Coenzyme metabolism] Back     alignment and domain information
>PRK04013 argD acetylornithine/acetyl-lysine aminotransferase; Provisional Back     alignment and domain information
>PRK09221 beta alanine--pyruvate transaminase; Provisional Back     alignment and domain information
>PRK05965 hypothetical protein; Provisional Back     alignment and domain information
>PRK06062 hypothetical protein; Provisional Back     alignment and domain information
>PRK06105 aminotransferase; Provisional Back     alignment and domain information
>PRK15029 arginine decarboxylase; Provisional Back     alignment and domain information
>PRK07678 aminotransferase; Validated Back     alignment and domain information
>PRK05639 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>COG1003 GcvP Glycine cleavage system protein P (pyridoxal-binding), C-terminal domain [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07482 hypothetical protein; Provisional Back     alignment and domain information
>PRK06173 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK07986 adenosylmethionine--8-amino-7-oxononanoate transaminase; Validated Back     alignment and domain information
>PRK06943 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK05769 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK06916 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK13578 ornithine decarboxylase; Provisional Back     alignment and domain information
>PRK05630 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK07030 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK07480 putative aminotransferase; Validated Back     alignment and domain information
>KOG1357 consensus Serine palmitoyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02618 tyr_phenol_ly tyrosine phenol-lyase Back     alignment and domain information
>PRK06938 diaminobutyrate--2-oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>TIGR00709 dat 2,4-diaminobutyrate 4-transaminases Back     alignment and domain information
>PRK06082 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK00062 glutamate-1-semialdehyde aminotransferase; Provisional Back     alignment and domain information
>PRK07036 hypothetical protein; Provisional Back     alignment and domain information
>PF02347 GDC-P: Glycine cleavage system P-protein; InterPro: IPR020580 This family consists of glycine cleavage system P-proteins (1 Back     alignment and domain information
>PRK08742 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK07481 hypothetical protein; Provisional Back     alignment and domain information
>PRK07046 aminotransferase; Validated Back     alignment and domain information
>TIGR00508 bioA adenosylmethionine-8-amino-7-oxononanoate transaminase Back     alignment and domain information
>PRK13237 tyrosine phenol-lyase; Provisional Back     alignment and domain information
>PRK12389 glutamate-1-semialdehyde aminotransferase; Provisional Back     alignment and domain information
>PRK12403 putative aminotransferase; Provisional Back     alignment and domain information
>PRK00615 glutamate-1-semialdehyde aminotransferase; Provisional Back     alignment and domain information
>PRK07483 hypothetical protein; Provisional Back     alignment and domain information
>PRK06917 hypothetical protein; Provisional Back     alignment and domain information
>COG1448 TyrB Aspartate/tyrosine/aromatic aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>COG0403 GcvP Glycine cleavage system protein P (pyridoxal-binding), N-terminal domain [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1402 consensus Ornithine aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03251 LAT_fam L-lysine 6-transaminase Back     alignment and domain information
>COG0161 BioA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase [Coenzyme metabolism] Back     alignment and domain information
>KOG0628 consensus Aromatic-L-amino-acid/L-histidine decarboxylase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06931 diaminobutyrate--2-oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>PLN02482 glutamate-1-semialdehyde 2,1-aminomutase Back     alignment and domain information
>PRK06148 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00699 GABAtrns_euk 4-aminobutyrate aminotransferase, eukaryotic type Back     alignment and domain information
>PRK06149 hypothetical protein; Provisional Back     alignment and domain information
>PRK15400 lysine decarboxylase CadA; Provisional Back     alignment and domain information
>PRK08297 L-lysine aminotransferase; Provisional Back     alignment and domain information
>PRK15399 lysine decarboxylase LdcC; Provisional Back     alignment and domain information
>KOG0629 consensus Glutamate decarboxylase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0258 consensus Alanine aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>COG1982 LdcC Arginine/lysine/ornithine decarboxylases [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02974 adenosylmethionine-8-amino-7-oxononanoate transaminase Back     alignment and domain information
>KOG2467 consensus Glycine/serine hydroxymethyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12566 glycine dehydrogenase; Provisional Back     alignment and domain information
>KOG1404 consensus Alanine-glyoxylate aminotransferase AGT2 [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06209 glutamate-1-semialdehyde 2,1-aminomutase; Provisional Back     alignment and domain information
>PF01212 Beta_elim_lyase: Beta-eliminating lyase; InterPro: IPR001597 This domain is found in many tryptophanases (tryptophan indole-lyase, TNase), tyrosine phenol-lyases (TPL) and threonine aldolases Back     alignment and domain information
>KOG1358 consensus Serine palmitoyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1401 consensus Acetylornithine aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02617 tnaA_trp_ase tryptophanase, leader peptide-associated Back     alignment and domain information
>KOG2040 consensus Glycine dehydrogenase (decarboxylating) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2790 consensus Phosphoserine aminotransferase [Coenzyme transport and metabolism; Amino acid transport and metabolism] Back     alignment and domain information
>COG1921 SelA Selenocysteine synthase [seryl-tRNASer selenium transferase] [Amino acid transport and metabolism] Back     alignment and domain information
>PF05889 SLA_LP_auto_ag: Soluble liver antigen/liver pancreas antigen (SLA/LP autoantigen); InterPro: IPR008829 This family consists of several eukaryotic and archaeal proteins which are related to the Homo sapiens soluble liver antigen/liver pancreas antigen (SLA/LP autoantigen) Back     alignment and domain information
>PF00202 Aminotran_3: Aminotransferase class-III; InterPro: IPR005814 Aminotransferases share certain mechanistic features with other pyridoxalphosphate-dependent enzymes, such as the covalent binding of the pyridoxalphosphate group to a lysine residue Back     alignment and domain information
>PF03841 SelA: L-seryl-tRNA selenium transferase; InterPro: IPR018319 In prokaryotes, the incorporation of selenocysteine as the 21st amino acid, encoded by TGA, requires several elements: SelC is the tRNA itself, SelD acts as a donor of reduced selenium, SelA modifies a serine residue on SelC into selenocysteine, and SelB is a selenocysteine-specific translation elongation factor Back     alignment and domain information
>PF06838 Met_gamma_lyase: Methionine gamma-lyase ; InterPro: IPR009651 This family represents the aluminium resistance protein, which confers resistance to aluminium in bacteria [] Back     alignment and domain information
>PF04864 Alliinase_C: Allinase; InterPro: IPR006948 Allicin is a thiosulphinate that gives rise to dithiines, allyl sulphides and ajoenes, the three groups of active compounds in Allium species Back     alignment and domain information
>COG3033 TnaA Tryptophanase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1403 consensus Predicted alanine-glyoxylate aminotransferase [General function prediction only] Back     alignment and domain information
>KOG2040 consensus Glycine dehydrogenase (decarboxylating) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1412 consensus Aspartate aminotransferase/Glutamic oxaloacetic transaminase AAT2/GOT1 [Amino acid transport and metabolism] Back     alignment and domain information
>COG4100 Cystathionine beta-lyase family protein involved in aluminum resistance [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG1411 consensus Aspartate aminotransferase/Glutamic oxaloacetic transaminase AAT1/GOT2 [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1405 consensus 4-aminobutyrate aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2142 consensus Molybdenum cofactor sulfurase [Coenzyme transport and metabolism] Back     alignment and domain information
>KOG3843 consensus Predicted serine hydroxymethyltransferase SLA/LP (autoimmune hepatitis marker in humans) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN02994 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>KOG0630 consensus Predicted pyridoxal-dependent decarboxylase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2142 consensus Molybdenum cofactor sulfurase [Coenzyme transport and metabolism] Back     alignment and domain information
>TIGR03573 WbuX N-acetyl sugar amidotransferase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query458
1t3i_A420 Structure Of Slr0077SUFS, THE ESSENTIAL CYSTEINE De 1e-144
1i29_A406 Crystal Structure Of Csdb Complexed With L-Propargy 9e-97
1jf9_A408 Crystal Structure Of Selenocysteine Lyase Length = 1e-96
1kmj_A406 E. Coli NifsCSDB PROTEIN AT 2.0A WITH THE CYSTEINE 2e-95
1c0n_A406 Csdb Protein, Nifs Homologue Length = 406 4e-94
4eb5_A382 A. Fulgidus Iscs-Iscu Complex Structure Length = 38 5e-23
1ecx_A384 Nifs-Like Protein Length = 384 4e-20
3cai_A406 Crystal Structure Of Mycobacterium Tuberculosis Rv3 8e-19
1eg5_A384 Nifs-like Protein Length = 384 9e-18
3lvj_A423 Crystal Structure Of E.Coli Iscs-Tusa Complex (Form 1e-15
1p3w_B404 X-Ray Crystal Structure Of E. Coli Iscs Length = 40 5e-15
1elq_A390 Crystal Structure Of The Cystine C-S Lyase C-Des Le 7e-14
1n2t_A386 C-Des Mutant K223a With Gly Covalenty Linked To The 7e-13
3vax_A400 Crytal Structure Of Dnda From Streptomyces Lividans 1e-10
3a9x_A432 Crystal Structure Of Rat Selenocysteine Lyase Lengt 4e-09
3gzd_A440 Human Selenocysteine Lyase, P1 Crystal Form Length 5e-09
3gzc_A440 Structure Of Human Selenocysteine Lyase Length = 44 5e-09
1qz9_A416 The Three Dimensional Structure Of Kynureninase Fro 2e-06
2w8w_A427 N100y Spt With Plp-Ser Length = 427 2e-06
2w8j_A427 Spt With Plp-Ser Length = 427 3e-06
2jgt_A422 Low Resolution Structure Of Spt Length = 422 3e-06
4ixo_A380 X-ray Structure Of Nifs-like Protein From Rickettsi 7e-06
2w8u_A427 Spt With Plp, N100y Length = 427 1e-05
2w8t_A427 Spt With Plp, N100c Length = 427 1e-05
2w8v_A427 Spt With Plp, N100w Length = 427 1e-05
2jg2_A422 High Resolution Structure Of Spt With Plp Internal 1e-05
>pdb|1T3I|A Chain A, Structure Of Slr0077SUFS, THE ESSENTIAL CYSTEINE Desulfurase From Synechocystis Pcc 6803 Length = 420 Back     alignment and structure

Iteration: 1

Score = 507 bits (1305), Expect = e-144, Method: Compositional matrix adjust. Identities = 245/409 (59%), Positives = 300/409 (73%), Gaps = 3/409 (0%) Query: 47 LGHITRPDFPILHQEVYGSKKLVYLDNAATSQKPIAVLKALQNYYEAYNSNVHRGIHFLS 106 L R DFPIL+QE+ G LVYLDNAATSQKP AVL+ L +YYE N+NVHRG H LS Sbjct: 9 LAATVRQDFPILNQEING-HPLVYLDNAATSQKPRAVLEKLMHYYENDNANVHRGAHQLS 67 Query: 107 AKATDEYELARKKVAAFINASDSGEIVFTKNATEAINLVAYSWGLSNLKSGDEVILTVAE 166 +ATD YE R KVA FINA EIV+T+NATEAINLVAYSWG++NLK+GDE+I TV E Sbjct: 68 VRATDAYEAVRNKVAKFINARSPREIVYTRNATEAINLVAYSWGMNNLKAGDEIITTVME 127 Query: 167 HHSAIVPWQLVAQKTGANLKFLNLNDDESPDLDKLKEMLSRKTKLVVIHHISNMLASILP 226 HHS +VPWQ+VA KTGA LKF+ L++ ES DL+ K +LS KTKLV + HISN L + P Sbjct: 128 HHSNLVPWQMVAAKTGAVLKFVQLDEQESFDLEHFKTLLSEKTKLVTVVHISNTLGCVNP 187 Query: 227 IEEIVHWSHDVGAKVLVDACQSVPHMVVDVQGLDADFLVASSHKMCGPTGIGFLFGKSDL 286 EEI +H GAKVLVDACQS PH +DVQ +D D+LVAS HKMC PTGIGFL+GK ++ Sbjct: 188 AEEIAQLAHQAGAKVLVDACQSAPHYPLDVQLIDCDWLVASGHKMCAPTGIGFLYGKEEI 247 Query: 287 LSAMPPFLGGGEMISDVFLDHSTFADPPSRFEAGTPXXXXXXXXXXXXDYLSTIGMQKIH 346 L AMPPF GGGEMI++VF DH T + P +FEAGTP DYL+ +GM+ IH Sbjct: 248 LEAMPPFFGGGEMIAEVFFDHFTTGELPHKFEAGTPAIAEAIALGAAVDYLTDLGMENIH 307 Query: 347 AYEMELAKYLYENLLSIPNIRIYGPKPSEHVQRAALCSFNVENIHPTDIATLLDQQYGVA 406 YE+EL YL++ L IP +R+YGP P +H RAAL SFNV +H +D+AT++DQ G+A Sbjct: 308 NYEVELTHYLWQGLGQIPQLRLYGPNP-KHGDRAALASFNVAGLHASDVATMVDQD-GIA 365 Query: 407 TRSGHHCAQPLHRYLGVNASARASLHFYNTKEDVDEFIHALNETVSFFN 455 RSGHHC QPLHR + SARASL+FYNTKE++D F+ +L T+ FF+ Sbjct: 366 IRSGHHCTQPLHRLFDASGSARASLYFYNTKEEIDLFLQSLQATIRFFS 414
>pdb|1I29|A Chain A, Crystal Structure Of Csdb Complexed With L-Propargylglycine Length = 406 Back     alignment and structure
>pdb|1JF9|A Chain A, Crystal Structure Of Selenocysteine Lyase Length = 408 Back     alignment and structure
>pdb|1KMJ|A Chain A, E. Coli NifsCSDB PROTEIN AT 2.0A WITH THE CYSTEINE PERSULFIDE Intermediate (Residue Css). Length = 406 Back     alignment and structure
>pdb|1C0N|A Chain A, Csdb Protein, Nifs Homologue Length = 406 Back     alignment and structure
>pdb|4EB5|A Chain A, A. Fulgidus Iscs-Iscu Complex Structure Length = 382 Back     alignment and structure
>pdb|1ECX|A Chain A, Nifs-Like Protein Length = 384 Back     alignment and structure
>pdb|3CAI|A Chain A, Crystal Structure Of Mycobacterium Tuberculosis Rv3778c Protein Length = 406 Back     alignment and structure
>pdb|1EG5|A Chain A, Nifs-like Protein Length = 384 Back     alignment and structure
>pdb|3LVJ|A Chain A, Crystal Structure Of E.Coli Iscs-Tusa Complex (Form 1) Length = 423 Back     alignment and structure
>pdb|1P3W|B Chain B, X-Ray Crystal Structure Of E. Coli Iscs Length = 404 Back     alignment and structure
>pdb|1ELQ|A Chain A, Crystal Structure Of The Cystine C-S Lyase C-Des Length = 390 Back     alignment and structure
>pdb|1N2T|A Chain A, C-Des Mutant K223a With Gly Covalenty Linked To The Plp-Cofactor Length = 386 Back     alignment and structure
>pdb|3VAX|A Chain A, Crytal Structure Of Dnda From Streptomyces Lividans Length = 400 Back     alignment and structure
>pdb|3A9X|A Chain A, Crystal Structure Of Rat Selenocysteine Lyase Length = 432 Back     alignment and structure
>pdb|3GZD|A Chain A, Human Selenocysteine Lyase, P1 Crystal Form Length = 440 Back     alignment and structure
>pdb|3GZC|A Chain A, Structure Of Human Selenocysteine Lyase Length = 440 Back     alignment and structure
>pdb|1QZ9|A Chain A, The Three Dimensional Structure Of Kynureninase From Pseudomonas Fluorescens Length = 416 Back     alignment and structure
>pdb|2W8W|A Chain A, N100y Spt With Plp-Ser Length = 427 Back     alignment and structure
>pdb|2W8J|A Chain A, Spt With Plp-Ser Length = 427 Back     alignment and structure
>pdb|2JGT|A Chain A, Low Resolution Structure Of Spt Length = 422 Back     alignment and structure
>pdb|4IXO|A Chain A, X-ray Structure Of Nifs-like Protein From Rickettsia Africae Esf-5 Length = 380 Back     alignment and structure
>pdb|2W8U|A Chain A, Spt With Plp, N100y Length = 427 Back     alignment and structure
>pdb|2W8T|A Chain A, Spt With Plp, N100c Length = 427 Back     alignment and structure
>pdb|2W8V|A Chain A, Spt With Plp, N100w Length = 427 Back     alignment and structure
>pdb|2JG2|A Chain A, High Resolution Structure Of Spt With Plp Internal Aldimine Length = 422 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query458
1t3i_A420 Probable cysteine desulfurase; PLP-binding enzyme, 0.0
1kmj_A406 Selenocysteine lyase; persulfide perselenide NIFS 0.0
3cai_A406 Possible aminotransferase; RV3778C; 1.80A {Mycobac 0.0
1elu_A390 L-cysteine/L-cystine C-S lyase; FES cluster biosyn 0.0
2e7j_A371 SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-st 1e-124
1qz9_A416 Kynureninase; kynurenine, tryptophan, PLP, vitamin 2e-83
4eb5_A382 Probable cysteine desulfurase 2; scaffold, transfe 1e-47
3lvm_A423 Cysteine desulfurase; structural genomics, montrea 4e-47
3e9k_A465 Kynureninase; kynurenine-L-hydrolase, kynurenine h 6e-47
1eg5_A384 Aminotransferase; PLP-dependent enzymes, iron-sulf 6e-46
3a9z_A432 Selenocysteine lyase; PLP, cytoplasm, pyridoxal ph 3e-41
3f0h_A376 Aminotransferase; RER070207000802, structural geno 7e-11
1m32_A366 2-aminoethylphosphonate-pyruvate aminotransferase; 2e-09
3op7_A375 Aminotransferase class I and II; PLP-dependent tra 6e-08
3kgw_A393 Alanine-glyoxylate aminotransferase; AAH25799.1, p 9e-08
2z9v_A392 Aspartate aminotransferase; pyridoxamine, pyruvate 2e-07
3isl_A416 Purine catabolism protein PUCG; pyridoxalphosphate 2e-07
1vjo_A393 Alanine--glyoxylate aminotransferase; 17130350, AL 3e-07
3ht4_A431 Aluminum resistance protein; lyase, putative cysta 3e-07
3mad_A514 Sphingosine-1-phosphate lyase; carboxy-lyase activ 4e-07
2huf_A393 Alanine glyoxylate aminotransferase; alpha and bet 6e-07
3nnk_A411 Ureidoglycine-glyoxylate aminotransferase; PLP-dep 7e-07
2aeu_A374 Hypothetical protein MJ0158; selenocysteine syntha 8e-07
3i16_A427 Aluminum resistance protein; YP_878183.1, carbon-s 1e-06
2ch1_A396 3-hydroxykynurenine transaminase; PLP-enzyme, kynu 2e-06
3zrp_A384 Serine-pyruvate aminotransferase (AGXT); HET: PLP; 2e-06
3jzl_A409 Putative cystathionine beta-lyase involved in ALU 2e-06
2z67_A456 O-phosphoseryl-tRNA(SEC) selenium transferase; sel 2e-06
2yrr_A353 Aminotransferase, class V; structural genomics, NP 2e-05
3b8x_A390 WBDK, pyridoxamine 5-phosphate-dependent dehydrase 2e-05
2dr1_A386 PH1308 protein, 386AA long hypothetical serine ami 7e-05
2bkw_A385 Alanine-glyoxylate aminotransferase 1; analine-gly 1e-04
3bb8_A437 CDP-4-keto-6-deoxy-D-glucose-3-dehydrase; aspartat 2e-04
3mc6_A497 Sphingosine-1-phosphate lyase; carboxy-lyase activ 2e-04
3hvy_A427 Cystathionine beta-lyase family protein, YNBB B.S 2e-04
3ndn_A414 O-succinylhomoserine sulfhydrylase; seattle struct 5e-04
3g0t_A437 Putative aminotransferase; NP_905498.1, putative a 7e-04
>1t3i_A Probable cysteine desulfurase; PLP-binding enzyme, transferase; HET: 2OS PLP; 1.80A {Synechocystis SP} SCOP: c.67.1.3 Length = 420 Back     alignment and structure
 Score =  717 bits (1853), Expect = 0.0
 Identities = 255/417 (61%), Positives = 313/417 (75%), Gaps = 3/417 (0%)

Query: 39  VTSTDSVSLGHITRPDFPILHQEVYGSKKLVYLDNAATSQKPIAVLKALQNYYEAYNSNV 98
           + +    SL    R DFPIL+QE+ G   LVYLDNAATSQKP AVL+ L +YYE  N+NV
Sbjct: 1   MVALQIPSLAATVRQDFPILNQEING-HPLVYLDNAATSQKPRAVLEKLMHYYENDNANV 59

Query: 99  HRGIHFLSAKATDEYELARKKVAAFINASDSGEIVFTKNATEAINLVAYSWGLSNLKSGD 158
           HRG H LS +ATD YE  R KVA FINA    EIV+T+NATEAINLVAYSWG++NLK+GD
Sbjct: 60  HRGAHQLSVRATDAYEAVRNKVAKFINARSPREIVYTRNATEAINLVAYSWGMNNLKAGD 119

Query: 159 EVILTVAEHHSAIVPWQLVAQKTGANLKFLNLNDDESPDLDKLKEMLSRKTKLVVIHHIS 218
           E+I TV EHHS +VPWQ+VA KTGA LKF+ L++ ES DL+  K +LS KTKLV + HIS
Sbjct: 120 EIITTVMEHHSNLVPWQMVAAKTGAVLKFVQLDEQESFDLEHFKTLLSEKTKLVTVVHIS 179

Query: 219 NMLASILPIEEIVHWSHDVGAKVLVDACQSVPHMVVDVQGLDADFLVASSHKMCGPTGIG 278
           N L  + P EEI   +H  GAKVLVDACQS PH  +DVQ +D D+LVAS HKMC PTGIG
Sbjct: 180 NTLGCVNPAEEIAQLAHQAGAKVLVDACQSAPHYPLDVQLIDCDWLVASGHKMCAPTGIG 239

Query: 279 FLFGKSDLLSAMPPFLGGGEMISDVFLDHSTFADPPSRFEAGTPAIGEAIGLGAAIDYLS 338
           FL+GK ++L AMPPF GGGEMI++VF DH T  + P +FEAGTPAI EAI LGAA+DYL+
Sbjct: 240 FLYGKEEILEAMPPFFGGGEMIAEVFFDHFTTGELPHKFEAGTPAIAEAIALGAAVDYLT 299

Query: 339 TIGMQKIHAYEMELAKYLYENLLSIPNIRIYGPKPSEHVQRAALCSFNVENIHPTDIATL 398
            +GM+ IH YE+EL  YL++ L  IP +R+YGP P +H  RAAL SFNV  +H +D+AT+
Sbjct: 300 DLGMENIHNYEVELTHYLWQGLGQIPQLRLYGPNP-KHGDRAALASFNVAGLHASDVATM 358

Query: 399 LDQQYGVATRSGHHCAQPLHRYLGVNASARASLHFYNTKEDVDEFIHALNETVSFFN 455
           +DQ  G+A RSGHHC QPLHR    + SARASL+FYNTKE++D F+ +L  T+ FF+
Sbjct: 359 VDQD-GIAIRSGHHCTQPLHRLFDASGSARASLYFYNTKEEIDLFLQSLQATIRFFS 414


>1kmj_A Selenocysteine lyase; persulfide perselenide NIFS pyridoxal phosphate, structural PSI, protein structure initiative; HET: PLP; 2.00A {Escherichia coli} SCOP: c.67.1.3 PDB: 1i29_A* 1jf9_A* 1kmk_A* 1c0n_A* Length = 406 Back     alignment and structure
>3cai_A Possible aminotransferase; RV3778C; 1.80A {Mycobacterium tuberculosis} Length = 406 Back     alignment and structure
>1elu_A L-cysteine/L-cystine C-S lyase; FES cluster biosynthesis, pyridoxal 5'-phosphate, thiocystei aminoacrylate, enzyme-product complex; HET: PDA; 1.55A {Synechocystis SP} SCOP: c.67.1.3 PDB: 1elq_A* 1n2t_A* 1n31_A* Length = 390 Back     alignment and structure
>2e7j_A SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-strand, lyase, structural genomics; HET: PLP; 2.40A {Archaeoglobus fulgidus} SCOP: c.67.1.9 PDB: 2e7i_A* Length = 371 Back     alignment and structure
>1qz9_A Kynureninase; kynurenine, tryptophan, PLP, vitamin B6, pyridoxal-5'-phosph hydrolase; HET: PLP P3G; 1.85A {Pseudomonas fluorescens} SCOP: c.67.1.3 Length = 416 Back     alignment and structure
>4eb5_A Probable cysteine desulfurase 2; scaffold, transferase-metal binding protein complex; HET: PLP EPE; 2.53A {Archaeoglobus fulgidus} PDB: 4eb7_A* Length = 382 Back     alignment and structure
>3lvm_A Cysteine desulfurase; structural genomics, montreal-kingston bacterial structural genomics initiative, BSGI, transferase; HET: PLP; 2.05A {Escherichia coli} PDB: 3lvk_A* 3lvl_B* 3lvj_A* 1p3w_B* Length = 423 Back     alignment and structure
>3e9k_A Kynureninase; kynurenine-L-hydrolase, kynurenine hydrolase, pyridoxal-5'-phosphate, inhibitor complex, 3-hydroxy hippur hydroxyhippuric acid, PLP; HET: PLP 3XH; 1.70A {Homo sapiens} PDB: 2hzp_A* Length = 465 Back     alignment and structure
>1eg5_A Aminotransferase; PLP-dependent enzymes, iron-sulfur-cluster synthesis, C-S BE transferase; HET: PLP; 2.00A {Thermotoga maritima} SCOP: c.67.1.3 PDB: 1ecx_A* Length = 384 Back     alignment and structure
>3a9z_A Selenocysteine lyase; PLP, cytoplasm, pyridoxal phosphate, transferase; HET: PLP SLP; 1.55A {Rattus norvegicus} PDB: 3a9x_A* 3a9y_A* 3gzd_A* 3gzc_A* 2hdy_A* Length = 432 Back     alignment and structure
>3f0h_A Aminotransferase; RER070207000802, structural genomics, JOIN for structural genomics, JCSG; HET: MSE LLP; 1.70A {Eubacterium rectale} Length = 376 Back     alignment and structure
>1m32_A 2-aminoethylphosphonate-pyruvate aminotransferase; PLP-dependent aminotransferase fold; HET: PLP; 2.20A {Salmonella typhimurium} SCOP: c.67.1.3 Length = 366 Back     alignment and structure
>3op7_A Aminotransferase class I and II; PLP-dependent transferase, structural genomics, joint center structural genomics, JCSG; HET: LLP UNL; 1.70A {Streptococcus suis 89} PDB: 3p6k_A* Length = 375 Back     alignment and structure
>3kgw_A Alanine-glyoxylate aminotransferase; AAH25799.1, putative aminotransferase, structural genomics, center for structural genomics, JCSG; HET: PLP; 1.65A {Mus musculus} PDB: 3kgx_A 3imz_A* 3r9a_A* 1h0c_A* 1j04_A* Length = 393 Back     alignment and structure
>2z9v_A Aspartate aminotransferase; pyridoxamine, pyruvate; HET: PXM; 1.70A {Mesorhizobium loti} PDB: 2z9u_A* 2z9w_A* 2z9x_A* Length = 392 Back     alignment and structure
>3isl_A Purine catabolism protein PUCG; pyridoxalphosphate, PLP dependent enzymes, purine metabolism transaminases, aminotransferases; HET: PLP; 2.06A {Bacillus subtilis} Length = 416 Back     alignment and structure
>1vjo_A Alanine--glyoxylate aminotransferase; 17130350, ALR1004, STR genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: PLP; 1.70A {Nostoc SP} SCOP: c.67.1.3 Length = 393 Back     alignment and structure
>3ht4_A Aluminum resistance protein; lyase, putative cystathionine BEAT-lyase, aluminium resistance protein, Q81A77_baccr, NESG, BCR213; 2.90A {Bacillus cereus atcc 14579} Length = 431 Back     alignment and structure
>3mad_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxal phosphate; HET: LLP; 2.00A {Symbiobacterium thermophilum} PDB: 3maf_A* 3mau_A* 3mbb_A* Length = 514 Back     alignment and structure
>2huf_A Alanine glyoxylate aminotransferase; alpha and beta protein, PLP-dependent transferase; HET: LLP; 1.75A {Aedes aegypti} PDB: 2hui_A* 2huu_A* Length = 393 Back     alignment and structure
>3nnk_A Ureidoglycine-glyoxylate aminotransferase; PLP-dependent; HET: LLP; 2.58A {Klebsiella pneumoniae} Length = 411 Back     alignment and structure
>2aeu_A Hypothetical protein MJ0158; selenocysteine synthase, PLP, pyridoxal phosphate, HOMO- oligomerization, unknown function; 1.70A {Methanocaldococcus jannaschii} SCOP: c.67.1.8 PDB: 2aev_A* Length = 374 Back     alignment and structure
>3i16_A Aluminum resistance protein; YP_878183.1, carbon-sulfur lyase involved in aluminum resist structural genomics; HET: MSE TLA PLP; 2.00A {Clostridium novyi} PDB: 3gwp_A* Length = 427 Back     alignment and structure
>2ch1_A 3-hydroxykynurenine transaminase; PLP-enzyme, kynurenine pathway, transferase; HET: LLP; 2.4A {Anopheles gambiae} SCOP: c.67.1.3 PDB: 2ch2_A* Length = 396 Back     alignment and structure
>3zrp_A Serine-pyruvate aminotransferase (AGXT); HET: PLP; 1.75A {Sulfolobus solfataricus} PDB: 3zrq_A* 3zrr_A* Length = 384 Back     alignment and structure
>3jzl_A Putative cystathionine beta-lyase involved in ALU resistance; putative cystathionine beta-lyase involved in aluminum resis structural genomics; HET: LLP; 1.91A {Listeria monocytogenes str} PDB: 3fd0_A* Length = 409 Back     alignment and structure
>2z67_A O-phosphoseryl-tRNA(SEC) selenium transferase; selenocysteine biosynthesis, seven-stranded BETE-strand, PYR 5'-phosphate; HET: PLP; 2.50A {Methanococcus maripaludis} SCOP: c.67.1.9 Length = 456 Back     alignment and structure
>2yrr_A Aminotransferase, class V; structural genomics, NPPSFA, national PROJ protein structural and functional analyses; HET: PLP; 1.86A {Thermus thermophilus} PDB: 2yri_A* Length = 353 Back     alignment and structure
>3b8x_A WBDK, pyridoxamine 5-phosphate-dependent dehydrase; aspartate aminotransferase, colitose, perosamine, O-antigen, pyridoxal phosphate,; HET: G4M; 1.70A {Escherichia coli} PDB: 2gms_A* 2gmu_A* 2r0t_A* 3gr9_A* Length = 390 Back     alignment and structure
>2dr1_A PH1308 protein, 386AA long hypothetical serine aminotransferase; PLP, structural genomics, NPPSFA; HET: PLP; 1.90A {Pyrococcus horikoshii} Length = 386 Back     alignment and structure
>2bkw_A Alanine-glyoxylate aminotransferase 1; analine-glyoxylate aminotransferase, pyridoxal-5-phosphate, SAD, glycolate pathway; HET: LLP; 2.57A {Saccharomyces cerevisiae} SCOP: c.67.1.3 Length = 385 Back     alignment and structure
>3mc6_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxyl phosphate; HET: LLP; 3.15A {Saccharomyces cerevisiae} Length = 497 Back     alignment and structure
>3hvy_A Cystathionine beta-lyase family protein, YNBB B.S ortholog; NP_348457.1, putative cystathionine beta-lyase involved in A resistance; HET: LLP MSE; 2.00A {Clostridium acetobutylicum} Length = 427 Back     alignment and structure
>3ndn_A O-succinylhomoserine sulfhydrylase; seattle structural genomics center for infectious disease, S mycobacterium, PLP, schiff base; HET: LLP; 1.85A {Mycobacterium tuberculosis} Length = 414 Back     alignment and structure
>3g0t_A Putative aminotransferase; NP_905498.1, putative aspartate aminotransferase, structural genomics, joint center for structural genomics; HET: MSE LLP PE4; 1.75A {Porphyromonas gingivalis} Length = 437 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query458
1kmj_A406 Selenocysteine lyase; persulfide perselenide NIFS 100.0
1t3i_A420 Probable cysteine desulfurase; PLP-binding enzyme, 100.0
3cai_A406 Possible aminotransferase; RV3778C; 1.80A {Mycobac 100.0
4hvk_A382 Probable cysteine desulfurase 2; transferase and I 100.0
3e9k_A465 Kynureninase; kynurenine-L-hydrolase, kynurenine h 100.0
1elu_A390 L-cysteine/L-cystine C-S lyase; FES cluster biosyn 100.0
4eb5_A382 Probable cysteine desulfurase 2; scaffold, transfe 100.0
3lvm_A423 Cysteine desulfurase; structural genomics, montrea 100.0
1eg5_A384 Aminotransferase; PLP-dependent enzymes, iron-sulf 100.0
3e77_A377 Phosphoserine aminotransferase; SERC, PLP, structu 100.0
3vax_A400 Putative uncharacterized protein DNDA; desulfurase 100.0
2z9v_A392 Aspartate aminotransferase; pyridoxamine, pyruvate 100.0
3qm2_A386 Phosphoserine aminotransferase; structural genomic 100.0
2dr1_A386 PH1308 protein, 386AA long hypothetical serine ami 100.0
3a9z_A432 Selenocysteine lyase; PLP, cytoplasm, pyridoxal ph 100.0
1qz9_A416 Kynureninase; kynurenine, tryptophan, PLP, vitamin 100.0
2huf_A393 Alanine glyoxylate aminotransferase; alpha and bet 100.0
1vjo_A393 Alanine--glyoxylate aminotransferase; 17130350, AL 100.0
3m5u_A361 Phosphoserine aminotransferase; alpha-beta half sa 100.0
3zrp_A384 Serine-pyruvate aminotransferase (AGXT); HET: PLP; 100.0
3nnk_A411 Ureidoglycine-glyoxylate aminotransferase; PLP-dep 100.0
1iug_A352 Putative aspartate aminotransferase; wild type, py 100.0
3isl_A416 Purine catabolism protein PUCG; pyridoxalphosphate 100.0
3ffr_A362 Phosphoserine aminotransferase SERC; structural ge 100.0
2ch1_A396 3-hydroxykynurenine transaminase; PLP-enzyme, kynu 100.0
3kgw_A393 Alanine-glyoxylate aminotransferase; AAH25799.1, p 100.0
2yrr_A353 Aminotransferase, class V; structural genomics, NP 100.0
2e7j_A371 SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-st 100.0
3f0h_A376 Aminotransferase; RER070207000802, structural geno 100.0
1m32_A366 2-aminoethylphosphonate-pyruvate aminotransferase; 100.0
2c0r_A362 PSAT, phosphoserine aminotransferase; pyridoxal-5' 100.0
2bkw_A385 Alanine-glyoxylate aminotransferase 1; analine-gly 100.0
1w23_A360 Phosphoserine aminotransferase; pyridoxal-5'-phosp 100.0
3ffh_A363 Histidinol-phosphate aminotransferase; APC88260, l 100.0
3f9t_A397 TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L 100.0
3euc_A367 Histidinol-phosphate aminotransferase 2; YP_297314 100.0
3dyd_A427 Tyrosine aminotransferase; PLP, SGC, structural ge 100.0
3ly1_A354 Putative histidinol-phosphate aminotransferase; st 100.0
3get_A365 Histidinol-phosphate aminotransferase; NP_281508.1 100.0
3dzz_A391 Putative pyridoxal 5'-phosphate-dependent C-S LYA; 100.0
4dq6_A391 Putative pyridoxal phosphate-dependent transferas; 100.0
1gd9_A389 Aspartate aminotransferase; pyridoxal enzyme, temp 100.0
3a2b_A398 Serine palmitoyltransferase; vitamin B6-dependent 100.0
3g0t_A437 Putative aminotransferase; NP_905498.1, putative a 100.0
3kax_A383 Aminotransferase, classes I and II; PLP, C-S lyase 100.0
2w8t_A427 SPT, serine palmitoyltransferase; HET: LLP; 1.25A 100.0
1b5p_A385 Protein (aspartate aminotransferase); pyridoxal en 100.0
2z61_A370 Probable aspartate aminotransferase 2; amino acid 100.0
3nra_A407 Aspartate aminotransferase; structural genomics, j 100.0
1v2d_A381 Glutamine aminotransferase; PLP, riken structural 100.0
3ftb_A361 Histidinol-phosphate aminotransferase; structural 100.0
1j32_A388 Aspartate aminotransferase; HET: PLP; 2.10A {Phorm 100.0
3hdo_A360 Histidinol-phosphate aminotransferase; PSI-II, his 100.0
3p1t_A337 Putative histidinol-phosphate aminotransferase; PL 100.0
3fdb_A377 Beta C-S lyase, putative PLP-dependent beta-cystat 100.0
1xi9_A406 Putative transaminase; alanine aminotransferase, s 100.0
1o4s_A389 Aspartate aminotransferase; TM1255, structural gen 100.0
3ke3_A379 Putative serine-pyruvate aminotransferase; structu 100.0
3hbx_A502 GAD 1, glutamate decarboxylase 1; calmodulin-bindi 100.0
1bw0_A416 TAT, protein (tyrosine aminotransferase); tyrosine 100.0
3tqx_A399 2-amino-3-ketobutyrate coenzyme A ligase; energy m 100.0
3h14_A391 Aminotransferase, classes I and II; YP_167802.1, S 100.0
1fc4_A401 2-amino-3-ketobutyrate conenzyme A ligase; 2-amino 100.0
2dgk_A452 GAD-beta, GADB, glutamate decarboxylase beta; gadb 100.0
1c7n_A399 Cystalysin; transferase, aminotransferase, pyridox 100.0
3mad_A514 Sphingosine-1-phosphate lyase; carboxy-lyase activ 100.0
2qma_A497 Diaminobutyrate-pyruvate transaminase and L-2,4- d 100.0
1u08_A386 Hypothetical aminotransferase YBDL; alpha beta pro 100.0
2dou_A376 Probable N-succinyldiaminopimelate aminotransfera; 100.0
3cq5_A369 Histidinol-phosphate aminotransferase; PLP, PMP, a 100.0
2x5d_A412 Probable aminotransferase; HET: LLP PLP; 2.25A {Ps 100.0
3l8a_A421 METC, putative aminotransferase, probable beta-cys 100.0
1lc5_A364 COBD, L-threonine-O-3-phosphate decarboxylase; PLP 100.0
3aow_A448 Putative uncharacterized protein PH0207; protein-P 100.0
2zyj_A397 Alpha-aminodipate aminotransferase; alpha-aminoadi 100.0
3ele_A398 Amino transferase; RER070207001803, structural gen 100.0
1bs0_A384 Protein (8-amino-7-oxonanoate synthase); PLP-depen 100.0
3mc6_A497 Sphingosine-1-phosphate lyase; carboxy-lyase activ 100.0
2o1b_A404 Aminotransferase, class I; aminotrasferase; HET: P 100.0
2bwn_A401 5-aminolevulinate synthase; tetrapyrrole biosynthe 100.0
1d2f_A390 MALY protein; aminotransferase fold, large PLP-bin 100.0
2zc0_A407 Alanine glyoxylate transaminase; alanine:glyoxylat 100.0
2o0r_A411 RV0858C (N-succinyldiaminopimelate aminotransfera; 100.0
1svv_A359 Threonine aldolase; structural genomics, structura 100.0
3jtx_A396 Aminotransferase; NP_283882.1, structural genomics 100.0
2z67_A456 O-phosphoseryl-tRNA(SEC) selenium transferase; sel 100.0
2jis_A515 Cysteine sulfinic acid decarboxylase; pyridoxal ph 100.0
3fvs_A422 Kynurenine--oxoglutarate transaminase 1; alpha bet 100.0
2okj_A504 Glutamate decarboxylase 1; PLP-dependent decarboxy 100.0
1fg7_A356 Histidinol phosphate aminotransferase; HISC, histi 100.0
1wyu_A438 Glycine dehydrogenase (decarboxylating) subunit 1; 100.0
1yiz_A429 Kynurenine aminotransferase; glutamine transaminas 100.0
2gb3_A409 Aspartate aminotransferase; TM1698, structural gen 100.0
1vp4_A425 Aminotransferase, putative; structural genomics, j 100.0
2fyf_A398 PSAT, phosphoserine aminotransferase; PLP-dependen 100.0
2fnu_A375 Aminotransferase; protein-product complex, structu 100.0
3ezs_A376 Aminotransferase ASPB; NP_207418.1, structural gen 100.0
3qgu_A449 LL-diaminopimelate aminotransferase; L-lysine, pyr 100.0
3b46_A447 Aminotransferase BNA3; kynurenine aminotransferase 100.0
3op7_A375 Aminotransferase class I and II; PLP-dependent tra 100.0
3piu_A435 1-aminocyclopropane-1-carboxylate synthase; fruit 100.0
1rv3_A483 Serine hydroxymethyltransferase, cytosolic; one-ca 100.0
3fkd_A350 L-threonine-O-3-phosphate decarboxylase; structura 100.0
1js3_A486 DDC;, DOPA decarboxylase; carbidopa, parkinson'S d 100.0
1v72_A356 Aldolase; PLP-dependent enzyme, lyase; HET: PLP; 2 100.0
3e2y_A410 Kynurenine-oxoglutarate transaminase 3; alpha beta 100.0
1iay_A428 ACC synthase 2, 1-aminocyclopropane-1-carboxylate 100.0
3kki_A409 CAI-1 autoinducer synthase; quorum sensing, CQSA, 100.0
1wyu_B474 Glycine dehydrogenase subunit 2 (P-protein); alpha 99.98
3asa_A400 LL-diaminopimelate aminotransferase; PLP dependent 99.98
2x5f_A430 Aspartate_tyrosine_phenylalanine pyridoxal-5' phos 99.98
1pff_A331 Methionine gamma-lyase; homocysteine; 2.50A {Trich 99.98
3vp6_A511 Glutamate decarboxylase 1; catalytic loop SWAP, ly 99.98
3if2_A444 Aminotransferase; YP_265399.1, structura genomics, 99.98
3ei9_A432 LL-diaminopimelate aminotransferase; lysine biosyn 99.98
1uu1_A335 Histidinol-phosphate aminotransferase; histidine b 99.98
2vi8_A405 Serine hydroxymethyltransferase; SHMT, E53Q, FTHF, 99.97
3k40_A475 Aromatic-L-amino-acid decarboxylase; PLP dependent 99.97
3uwc_A374 Nucleotide-sugar aminotransferase; lipopolysacchar 99.97
2r2n_A425 Kynurenine/alpha-aminoadipate aminotransferase mit 99.97
1mdo_A393 ARNB aminotransferase; type 1 aminotransferase fol 99.97
1qgn_A445 Protein (cystathionine gamma-synthase); methionine 99.97
2rfv_A398 Methionine gamma-lyase; pyridoxal-5'-phosphate, PL 99.97
3tcm_A500 Alanine aminotransferase 2; pyridoxal phosphate (P 99.97
2cb1_A412 O-acetyl homoserine sulfhydrylase; PLP enzyme, lya 99.97
3g7q_A417 Valine-pyruvate aminotransferase; NP_462565.1, str 99.97
2fq6_A415 Cystathionine beta-lyase; protein-inhibitor comple 99.97
3frk_A373 QDTB; aminotransferase, sugar-modification, natura 99.97
1jg8_A347 L-ALLO-threonine aldolase; glycine biosynthesis, p 99.97
2x3l_A446 ORN/Lys/Arg decarboxylase family protein; lyase; H 99.97
2oga_A399 Transaminase; PLP-dependent enzyme, desosamine, de 99.97
3ez1_A423 Aminotransferase MOCR family; YP_604413.1, struct 99.97
4e1o_A481 HDC, histidine decarboxylase; lyase; HET: PLP PVH; 99.97
1gc0_A398 Methionine gamma-lyase; pyridoxal-5'-phosphate; HE 99.97
1b9h_A388 AHBA synthase, protein (3-amino-5-hydroxybenzoic a 99.97
3ruy_A392 Ornithine aminotransferase; structural genomics, c 99.97
2eh6_A375 Acoat, acetylornithine aminotransferase; ARGD, str 99.97
3rq1_A418 Aminotransferase class I and II; structural genomi 99.97
2dkj_A407 Serine hydroxymethyltransferase; PLP dependent enz 99.97
1vef_A395 Acetylornithine/acetyl-lysine aminotransferase; PL 99.97
3qhx_A392 Cystathionine gamma-synthase METB (CGS); structura 99.97
1e5e_A404 MGL, methionine gamma-lyase; methionine biosynthes 99.97
3dr4_A391 Putative perosamine synthetase; deoxysugar, pyrido 99.97
3ihj_A498 Alanine aminotransferase 2; helix, structural geno 99.97
3ppl_A427 Aspartate aminotransferase; dimer, PLP-dependent t 99.97
1n8p_A393 Cystathionine gamma-lyase; three open alpha/beta s 99.97
2c81_A418 Glutamine-2-deoxy-scyllo-inosose aminotransferase; 99.97
1cs1_A386 CGS, protein (cystathionine gamma-synthase); lyase 99.97
2po3_A424 4-dehydrase; external aldimine, PLP, aminotransfer 99.97
3d6k_A422 Putative aminotransferase; APC82464, corynebacteri 99.97
1o69_A394 Aminotransferase; structural genomics, unknown fun 99.97
3b8x_A390 WBDK, pyridoxamine 5-phosphate-dependent dehydrase 99.97
3cog_A403 Cystathionine gamma-lyase; CTH, PLP, propargylglyc 99.97
2ord_A397 Acoat, acetylornithine aminotransferase; TM1785, a 99.96
3acz_A389 Methionine gamma-lyase; L-methionine; HET: LLP; 1. 99.96
3ndn_A414 O-succinylhomoserine sulfhydrylase; seattle struct 99.96
1s0a_A429 Adenosylmethionine-8-amino-7-oxononanoate aminotra 99.96
1sff_A426 4-aminobutyrate aminotransferase; enzyme complexes 99.96
3t18_A413 Aminotransferase class I and II; PSI-biology, MCSG 99.96
3n0l_A417 Serine hydroxymethyltransferase; alpha beta class, 99.96
3nyt_A367 Aminotransferase WBPE; PLP binding, nucleotide-sug 99.96
4adb_A406 Succinylornithine transaminase; transferase, PLP e 99.96
3f6t_A533 Aspartate aminotransferase; YP_194538.1, STRU geno 99.96
3bwn_A391 AT1G70560, L-tryptophan aminotransferase; auxin sy 99.96
1ibj_A464 CBL, cystathionine beta-lyase; PLP-dependent enzym 99.96
2pb2_A420 Acetylornithine/succinyldiaminopimelate aminotran; 99.96
3gbx_A420 Serine hydroxymethyltransferase; structural genomi 99.96
3b1d_A392 Betac-S lyase; HET: PLP PLS EPE; 1.66A {Streptococ 99.93
3nx3_A395 Acoat, acetylornithine aminotransferase; csgid, st 99.96
1z7d_A433 Ornithine aminotransferase; structural genomics co 99.96
2ctz_A421 O-acetyl-L-homoserine sulfhydrylase; crystal, O-ac 99.96
4f4e_A420 Aromatic-amino-acid aminotransferase; ssgcid, stru 99.96
3fsl_A397 Aromatic-amino-acid aminotransferase; tyrosine ami 99.96
2aeu_A374 Hypothetical protein MJ0158; selenocysteine syntha 99.96
2oat_A439 Ornithine aminotransferase; 5-fluoromethylornithin 99.96
3ri6_A430 O-acetylhomoserine sulfhydrylase; PYR 5'-phosphate 99.95
2eo5_A419 419AA long hypothetical aminotransferase; PLP enzy 99.95
3bb8_A437 CDP-4-keto-6-deoxy-D-glucose-3-dehydrase; aspartat 99.95
1ajs_A412 Aspartate aminotransferase; PIG, in the presence o 99.95
2a7v_A490 Serine hydroxymethyltransferase; structural genomi 99.95
3ecd_A425 Serine hydroxymethyltransferase 2; ssgcid, decode, 99.95
3ju7_A377 Putative PLP-dependent aminotransferase; NP_978343 99.95
7aat_A401 Aspartate aminotransferase; transferase(aminotrans 99.95
1yaa_A412 Aspartate aminotransferase; HET: PLP; 2.05A {Sacch 99.95
2ay1_A394 Aroat, aromatic amino acid aminotransferase; HET: 99.95
3dxv_A439 Alpha-amino-epsilon-caprolactam racemase; fold-TYP 99.95
3h7f_A447 Serine hydroxymethyltransferase 1; cytoplasm, one- 99.95
3a8u_X449 Omega-amino acid--pyruvate aminotransferase; large 99.95
2q7w_A396 Aspartate aminotransferase; mechanism-based inhibi 99.95
1c4k_A 730 Protein (ornithine decarboxylase); lyase; HET: PLP 99.95
3meb_A448 Aspartate aminotransferase; pyridoxal PHOS transfe 99.95
1zod_A433 DGD, 2,2-dialkylglycine decarboxylase; pyridoxal, 99.95
1ax4_A467 Tryptophanase; tryptophan biosynthesis, tryptophan 99.95
2ez2_A456 Beta-tyrosinase, tyrosine phenol-lyase; PLP-depend 99.95
3i4j_A430 Aminotransferase, class III; structural GENOMICS,N 99.94
2cjg_A449 L-lysine-epsilon aminotransferase; internal aldimi 99.94
3nmy_A400 Xometc, cystathionine gamma-lyase-like protein; Cy 99.94
2zy4_A546 L-aspartate beta-decarboxylase; pyridoxal 5'-phosp 99.94
3n5m_A452 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 99.94
3gju_A460 Putative aminotransferase; pyridoxal phosphate, PL 99.94
3dod_A448 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 99.94
2vyc_A 755 Biodegradative arginine decarboxylase; pyridoxal p 99.94
2hox_A427 ALLIIN lyase 1; cysteine sulphoxide lyase, ALLIINA 99.94
4a6r_A459 Omega transaminase; transferase, PLP-binding enzym 99.94
3pj0_A359 LMO0305 protein; structural genomics, joint center 99.94
3lws_A357 Aromatic amino acid beta-eliminating lyase/threoni 99.93
3tfu_A457 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 99.93
4ffc_A453 4-aminobutyrate aminotransferase (GABT); structura 99.93
3k7y_A405 Aspartate aminotransferase; aminotrans pyridoxal p 99.93
4eu1_A409 Mitochondrial aspartate aminotransferase; ssgcid, 99.93
3oks_A451 4-aminobutyrate transaminase; ssgcid, transferase, 99.93
3hmu_A472 Aminotransferase, class III; structural genomics, 99.93
2oqx_A467 Tryptophanase; lyase, pyridoxal phosphate, tryptop 99.93
3l44_A434 Glutamate-1-semialdehyde 2,1-aminomutase 1; alpha 99.93
2epj_A434 Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzy 99.93
3i5t_A476 Aminotransferase; pyridoxal 5'-phosphate, PSI-2, N 99.92
3jzl_A409 Putative cystathionine beta-lyase involved in ALU 99.92
2cy8_A453 D-phgat, D-phenylglycine aminotransferase; structu 99.92
3k28_A429 Glutamate-1-semialdehyde 2,1-aminomutase 2; biosyn 99.92
1ohv_A472 4-aminobutyrate aminotransferase; PLP-dependent en 99.91
4h51_A420 Aspartate aminotransferase; ssgcid, structural gen 99.91
3i16_A427 Aluminum resistance protein; YP_878183.1, carbon-s 99.91
4e77_A429 Glutamate-1-semialdehyde 2,1-aminomutase; structur 99.91
2e7u_A424 Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzy 99.91
3fq8_A427 Glutamate-1-semialdehyde 2,1-aminomutase; drug res 99.91
3hvy_A427 Cystathionine beta-lyase family protein, YNBB B.S 99.91
3n75_A 715 LDC, lysine decarboxylase, inducible; pyridoxal-5' 99.88
3ht4_A431 Aluminum resistance protein; lyase, putative cysta 99.88
3bc8_A450 O-phosphoseryl-tRNA(SEC) selenium transferase; dis 99.86
2yky_A465 Beta-transaminase; transferase; HET: PLP SFE; 1.69 99.78
3hl2_A501 O-phosphoseryl-tRNA(SEC) selenium transferase; sel 99.85
4atq_A456 4-aminobutyrate transaminase; transferase; HET: PL 99.84
3ou5_A490 Serine hydroxymethyltransferase, mitochondrial; st 99.84
4ao9_A454 Beta-phenylalanine aminotransferase; HET: PLP; 1.5 99.82
4e3q_A473 Pyruvate transaminase; aminotransferase, transfera 99.78
4a0g_A831 Adenosylmethionine-8-amino-7-oxononanoate aminotra 99.69
>1kmj_A Selenocysteine lyase; persulfide perselenide NIFS pyridoxal phosphate, structural PSI, protein structure initiative; HET: PLP; 2.00A {Escherichia coli} SCOP: c.67.1.3 PDB: 1i29_A* 1jf9_A* 1kmk_A* 1c0n_A* Back     alignment and structure
Probab=100.00  E-value=8.9e-48  Score=377.15  Aligned_cols=399  Identities=46%  Similarity=0.805  Sum_probs=334.4

Q ss_pred             hhhcCCCCcccccccCCCCeEEecCCCCCCCcHHHHHHHHHHHHHhccCCCCCcchhhhHHHHHHHHHHHHHHHHcCCCC
Q 012718           49 HITRPDFPILHQEVYGSKKLVYLDNAATSQKPIAVLKALQNYYEAYNSNVHRGIHFLSAKATDEYELARKKVAAFINASD  128 (458)
Q Consensus        49 ~~~r~~f~~~~~~~~~~~~~i~l~~~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~la~~~g~~~  128 (458)
                      +.+|++||..+.... +++++|||+++.++.|+.+.+++.+++.....+++.+.+..++...+..+++++.+++++|.++
T Consensus         6 ~~~r~~f~~~~~~~~-g~~~i~l~~~~~~~~~~~v~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~la~~~~~~~   84 (406)
T 1kmj_A            6 DKVRADFPVLSREVN-GLPLAYLDSAASAQKPSQVIDAEAEFYRHGYAAVHRGIHTLSAQATEKMENVRKRASLFINARS   84 (406)
T ss_dssp             HHHHHTCGGGGCEET-TEECEECCTTTCCCCCHHHHHHHHHHHHHTCCCCSSCSSHHHHHHHHHHHHHHHHHHHHTTCSC
T ss_pred             HHHHHhCcccccccC-CCceEEecCCccCCCCHHHHHHHHHHHHhhcCCCCCCcchHHHHHHHHHHHHHHHHHHHcCCCC
Confidence            457889998743211 3468999999999999999999999998876666655555556677888999999999999832


Q ss_pred             CCcEEEeCChhHHHHHHHHHcCCCCCCCCCEEEEcCCCCccchHHHHHHHHHcCCeEEEEeCCCCCCCCHHHHHHhhcCC
Q 012718          129 SGEIVFTKNATEAINLVAYSWGLSNLKSGDEVILTVAEHHSAIVPWQLVAQKTGANLKFLNLNDDESPDLDKLKEMLSRK  208 (458)
Q Consensus       129 ~~~v~~t~g~t~a~~~~~~~l~~~~~~~g~~vl~~~~~~~s~~~~~~~~a~~~g~~~~~v~~~~~~~~d~~~l~~~l~~~  208 (458)
                      .++|++|+|+|+|+.+++.++....+++||+|+++.++|++....+..+++..|++++.++.++++.+|++++++.++++
T Consensus        85 ~~~v~~~~g~t~a~~~~~~~~~~~~~~~gd~vl~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~d~~~l~~~l~~~  164 (406)
T 1kmj_A           85 AEELVFVRGTTEGINLVANSWGNSNVRAGDNIIISQMEHHANIVPWQMLCARVGAELRVIPLNPDGTLQLETLPTLFDEK  164 (406)
T ss_dssp             GGGEEEESSHHHHHHHHHHHTHHHHCCTTCEEEEETTCCGGGTHHHHHHHHHHTCEEEEECBCTTSCBCGGGHHHHCCTT
T ss_pred             CCeEEEeCChhHHHHHHHHHhhhhcCCCCCEEEEecccchHHHHHHHHHHHhCCCEEEEEecCCCCCcCHHHHHHHhccC
Confidence            24999999999999999998721015789999999999999988888888888999999999888889999999999999


Q ss_pred             ceEEEEecccCcCcccccHHHHHHHHHhcCcEEEEeccccCCcccCCCCCCCCcEEEecccCCCCCCceeEEEEeccccc
Q 012718          209 TKLVVIHHISNMLASILPIEEIVHWSHDVGAKVLVDACQSVPHMVVDVQGLDADFLVASSHKMCGPTGIGFLFGKSDLLS  288 (458)
Q Consensus       209 ~~~v~~~~~~n~tG~~~~l~~i~~l~~~~~~~vivD~a~~~g~~~~~~~~~~~d~~~~s~~K~~gp~g~G~l~~~~~~~~  288 (458)
                      +++|++++++||||.+.|+++|.++|+++|+++|+|++|+.|..++++...++|++++|+||.+|+.|+|++++++++++
T Consensus       165 ~~~v~~~~~~nptG~~~~l~~i~~l~~~~~~~li~D~~~~~g~~~~~~~~~~~d~~~~s~~K~~g~~G~G~~~~~~~~~~  244 (406)
T 1kmj_A          165 TRLLAITHVSNVLGTENPLAEMITLAHQHGAKVLVDGAQAVMHHPVDVQALDCDFYVFSGHKLYGPTGIGILYVKEALLQ  244 (406)
T ss_dssp             EEEEEEESBCTTTCCBCCHHHHHHHHHHTTCEEEEECTTTTTTSCCCHHHHTCSEEEEEGGGTTSCTTCEEEEECHHHHH
T ss_pred             CeEEEEeCCCccccCcCCHHHHHHHHHHcCCEEEEEchhhcCCCCCcccccCCCEEEEEchhccCCCCcEEEEEeHHHHh
Confidence            99999999999999999999999999999999999999999887666555679999999999889989999999999888


Q ss_pred             cCCCccccCcceEeeecC-CCCCCCCCCccCCCCCCHHHHHHHHHHHHHHHHhCHHHHHHHHHHHHHHHHHHHhcCCCEE
Q 012718          289 AMPPFLGGGEMISDVFLD-HSTFADPPSRFEAGTPAIGEAIGLGAAIDYLSTIGMQKIHAYEMELAKYLYENLLSIPNIR  367 (458)
Q Consensus       289 ~l~~~~~g~~~~~~~~~~-~~~~~~~~~~~~~gt~~~~~~~~l~~al~~~~~~g~~~~~~~~~~l~~~l~~~L~~~~~~~  367 (458)
                      .+.+...+|+........ ...+...+.+++.|+++..+++++.++++++.+.+++++.++.+++++++.+.|+++++++
T Consensus       245 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~al~~~~~~~~~~~~~~~~~~~~~l~~~L~~~~~~~  324 (406)
T 1kmj_A          245 EMPPWEGGGSMIATVSLSEGTTWTKAPWRFEAGTPNTGGIIGLGAALEYVSALGLNNIAEYEQNLMHYALSQLESVPDLT  324 (406)
T ss_dssp             HCCCSSCSTTSEEEEETTTEEEECCTTGGGCCSSCCHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHTTSTTEE
T ss_pred             hcCCcccCCCceeecccccccccCCCchhccCCCCCHHHHHHHHHHHHHHHHcCHHHHHHHHHHHHHHHHHHHhcCCCeE
Confidence            888777666543322111 1123344567788999999999998899998877899999999999999999999988999


Q ss_pred             EeCCCCCCcCccccEEEEEeCCCChHHHHHHHhhhcCeEeccCCCCChhhHhhcCCCCeEEEeeCCCCCHHHHHHHHHHH
Q 012718          368 IYGPKPSEHVQRAALCSFNVENIHPTDIATLLDQQYGVATRSGHHCAQPLHRYLGVNASARASLHFYNTKEDVDEFIHAL  447 (458)
Q Consensus       368 ~~~~~~~~~~~~~~~v~~~~~~~~~~~~~~~l~~~~gi~~~~g~~~~~~~~~~~g~~~~lRis~~~~~t~~di~~l~~~l  447 (458)
                      +..+.     .++++++|.+++.+..++.+.|.++ ||.+++|..|..+....+|.++++|++++.+++++|++++++.|
T Consensus       325 ~~~~~-----~~~~~~~~~~~~~~~~~~~~~l~~~-gi~v~~g~~~~~~~~~~~g~~~~iRis~~~~~t~~~i~~~~~~l  398 (406)
T 1kmj_A          325 LYGPQ-----NRLGVIAFNLGKHHAYDVGSFLDNY-GIAVRTGHHCAMPLMAYYNVPAMCRASLAMYNTHEEVDRLVTGL  398 (406)
T ss_dssp             EESCT-----TCCSEEEEEETTCCHHHHHHHHHHT-TEECEEECTTCHHHHHHTTCSCEEEEECCTTCCHHHHHHHHHHH
T ss_pred             EecCC-----CcCCEEEEEECCCCHHHHHHHHhhC-CcEEEeccccchHHHHhcCCCCeEEEEeecCCCHHHHHHHHHHH
Confidence            87653     1277888888877788899999888 99999999888766555666789999999999999999999999


Q ss_pred             HHHHHhh
Q 012718          448 NETVSFF  454 (458)
Q Consensus       448 ~~~~~~~  454 (458)
                      +++++.+
T Consensus       399 ~~~~~~l  405 (406)
T 1kmj_A          399 QRIHRLL  405 (406)
T ss_dssp             HHHHHHH
T ss_pred             HHHHHhh
Confidence            9998764



>1t3i_A Probable cysteine desulfurase; PLP-binding enzyme, transferase; HET: 2OS PLP; 1.80A {Synechocystis SP} SCOP: c.67.1.3 Back     alignment and structure
>3cai_A Possible aminotransferase; RV3778C; 1.80A {Mycobacterium tuberculosis} Back     alignment and structure
>4hvk_A Probable cysteine desulfurase 2; transferase and ISCS, transferase; HET: PMP PG4; 1.43A {Archaeoglobus fulgidus} PDB: 4eb7_A* 4eb5_A* Back     alignment and structure
>3e9k_A Kynureninase; kynurenine-L-hydrolase, kynurenine hydrolase, pyridoxal-5'-phosphate, inhibitor complex, 3-hydroxy hippur hydroxyhippuric acid, PLP; HET: PLP 3XH; 1.70A {Homo sapiens} PDB: 2hzp_A* Back     alignment and structure
>1elu_A L-cysteine/L-cystine C-S lyase; FES cluster biosynthesis, pyridoxal 5'-phosphate, thiocystei aminoacrylate, enzyme-product complex; HET: PDA; 1.55A {Synechocystis SP} SCOP: c.67.1.3 PDB: 1elq_A* 1n2t_A* 1n31_A* Back     alignment and structure
>4eb5_A Probable cysteine desulfurase 2; scaffold, transferase-metal binding protein complex; HET: PLP EPE; 2.53A {Archaeoglobus fulgidus} PDB: 4eb7_A* Back     alignment and structure
>3lvm_A Cysteine desulfurase; structural genomics, montreal-kingston bacterial structural genomics initiative, BSGI, transferase; HET: PLP; 2.05A {Escherichia coli} PDB: 3lvk_A* 3lvl_B* 3lvj_A* 1p3w_B* Back     alignment and structure
>1eg5_A Aminotransferase; PLP-dependent enzymes, iron-sulfur-cluster synthesis, C-S BE transferase; HET: PLP; 2.00A {Thermotoga maritima} SCOP: c.67.1.3 PDB: 1ecx_A* Back     alignment and structure
>3e77_A Phosphoserine aminotransferase; SERC, PLP, structural genomi structural genomics consortium, SGC, amino-acid biosynthesi aminotransferase; HET: PLP; 2.50A {Homo sapiens} Back     alignment and structure
>3vax_A Putative uncharacterized protein DNDA; desulfurase, transferase; HET: PLP; 2.40A {Streptomyces lividans} Back     alignment and structure
>2z9v_A Aspartate aminotransferase; pyridoxamine, pyruvate; HET: PXM; 1.70A {Mesorhizobium loti} PDB: 2z9u_A* 2z9w_A* 2z9x_A* Back     alignment and structure
>3qm2_A Phosphoserine aminotransferase; structural genomics, center for structural genomics of infec diseases, csgid; 2.25A {Salmonella enterica subsp} PDB: 1bjn_A* 1bjo_A* 3qbo_A* Back     alignment and structure
>2dr1_A PH1308 protein, 386AA long hypothetical serine aminotransferase; PLP, structural genomics, NPPSFA; HET: PLP; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>3a9z_A Selenocysteine lyase; PLP, cytoplasm, pyridoxal phosphate, transferase; HET: PLP SLP; 1.55A {Rattus norvegicus} PDB: 3a9x_A* 3a9y_A* 3gzd_A* 3gzc_A* 2hdy_A* Back     alignment and structure
>1qz9_A Kynureninase; kynurenine, tryptophan, PLP, vitamin B6, pyridoxal-5'-phosph hydrolase; HET: PLP P3G; 1.85A {Pseudomonas fluorescens} SCOP: c.67.1.3 Back     alignment and structure
>2huf_A Alanine glyoxylate aminotransferase; alpha and beta protein, PLP-dependent transferase; HET: LLP; 1.75A {Aedes aegypti} PDB: 2hui_A* 2huu_A* Back     alignment and structure
>1vjo_A Alanine--glyoxylate aminotransferase; 17130350, ALR1004, STR genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: PLP; 1.70A {Nostoc SP} SCOP: c.67.1.3 Back     alignment and structure
>3m5u_A Phosphoserine aminotransferase; alpha-beta half sandwich, csgid, amino-acid biosynthesis, cytoplasm, pyridoxal phosphate; HET: MES; 2.15A {Campylobacter jejuni} SCOP: c.67.1.0 Back     alignment and structure
>3zrp_A Serine-pyruvate aminotransferase (AGXT); HET: PLP; 1.75A {Sulfolobus solfataricus} PDB: 3zrq_A* 3zrr_A* Back     alignment and structure
>3nnk_A Ureidoglycine-glyoxylate aminotransferase; PLP-dependent; HET: LLP; 2.58A {Klebsiella pneumoniae} Back     alignment and structure
>1iug_A Putative aspartate aminotransferase; wild type, pyridoxal-5'-phosphate form, riken structural genomics/proteomics initiative, RSGI; HET: LLP; 2.20A {Thermus thermophilus} SCOP: c.67.1.3 Back     alignment and structure
>3isl_A Purine catabolism protein PUCG; pyridoxalphosphate, PLP dependent enzymes, purine metabolism transaminases, aminotransferases; HET: PLP; 2.06A {Bacillus subtilis} Back     alignment and structure
>3ffr_A Phosphoserine aminotransferase SERC; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: LLP MSE P33; 1.75A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>2ch1_A 3-hydroxykynurenine transaminase; PLP-enzyme, kynurenine pathway, transferase; HET: LLP; 2.4A {Anopheles gambiae} SCOP: c.67.1.3 PDB: 2ch2_A* Back     alignment and structure
>3kgw_A Alanine-glyoxylate aminotransferase; AAH25799.1, putative aminotransferase, structural genomics, center for structural genomics, JCSG; HET: PLP; 1.65A {Mus musculus} SCOP: c.67.1.3 PDB: 3kgx_A 3imz_A* 3r9a_A* 1h0c_A* 1j04_A* Back     alignment and structure
>2yrr_A Aminotransferase, class V; structural genomics, NPPSFA, national PROJ protein structural and functional analyses; HET: PLP; 1.86A {Thermus thermophilus} PDB: 2yri_A* Back     alignment and structure
>2e7j_A SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-strand, lyase, structural genomics; HET: PLP; 2.40A {Archaeoglobus fulgidus} SCOP: c.67.1.9 PDB: 2e7i_A* Back     alignment and structure
>3f0h_A Aminotransferase; RER070207000802, structural genomics, JOIN for structural genomics, JCSG; HET: MSE LLP; 1.70A {Eubacterium rectale} Back     alignment and structure
>1m32_A 2-aminoethylphosphonate-pyruvate aminotransferase; PLP-dependent aminotransferase fold; HET: PLP; 2.20A {Salmonella typhimurium} SCOP: c.67.1.3 Back     alignment and structure
>2c0r_A PSAT, phosphoserine aminotransferase; pyridoxal-5'-phosphate, pyridine serine biosynthesis, amino-acid biosynthesis, pyridoxal phosphate; HET: PLP; 1.2A {Bacillus circulans} SCOP: c.67.1.4 PDB: 1bt4_A* 1w3u_A* Back     alignment and structure
>2bkw_A Alanine-glyoxylate aminotransferase 1; analine-glyoxylate aminotransferase, pyridoxal-5-phosphate, SAD, glycolate pathway; HET: LLP; 2.57A {Saccharomyces cerevisiae} SCOP: c.67.1.3 Back     alignment and structure
>1w23_A Phosphoserine aminotransferase; pyridoxal-5'-phosphate; HET: PGE PLP EPE; 1.08A {Bacillus alcalophilus} SCOP: c.67.1.4 PDB: 2bhx_A* 2bi1_A* 2bi2_A* 2bi3_A* 2bi5_A* 2bi9_A* 2bia_A* 2bie_A* 2big_A* Back     alignment and structure
>3ffh_A Histidinol-phosphate aminotransferase; APC88260, listeria in CLIP11262, structural genomics, PSI-2; 2.31A {Listeria innocua} SCOP: c.67.1.0 Back     alignment and structure
>3f9t_A TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L-tyrosine decarboxylase MFNA (EC 4.1.1.25), ST genomics; HET: PLP; 2.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>3euc_A Histidinol-phosphate aminotransferase 2; YP_297314.1, structur genomics, joint center for structural genomics, JCSG; HET: MSE; 2.05A {Ralstonia eutropha JMP134} SCOP: c.67.1.0 Back     alignment and structure
>3dyd_A Tyrosine aminotransferase; PLP, SGC, structural genomics, structural genomics consortium, disease mutation, phenylalani catabolism; HET: PLP; 2.30A {Homo sapiens} PDB: 3pdx_A* Back     alignment and structure
>3ly1_A Putative histidinol-phosphate aminotransferase; structural G joint center for structural genomics, JCSG; HET: MSE PLP CIT; 1.80A {Erwinia carotovora atroseptica} Back     alignment and structure
>3get_A Histidinol-phosphate aminotransferase; NP_281508.1, structural genomics, joint center for structural genomics; HET: LLP MSE; 2.01A {Campylobacter jejuni subsp} Back     alignment and structure
>3dzz_A Putative pyridoxal 5'-phosphate-dependent C-S LYA; putative PLP-dependent aminotransferase; HET: MSE LLP PG4; 1.61A {Lactobacillus delbrueckii subsp} SCOP: c.67.1.0 Back     alignment and structure
>4dq6_A Putative pyridoxal phosphate-dependent transferas; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: PLP; 1.50A {Clostridium difficile} PDB: 4dgt_A* Back     alignment and structure
>1gd9_A Aspartate aminotransferase; pyridoxal enzyme, temperature dependence O substrate recognition; HET: PLP; 1.80A {Pyrococcus horikoshii} SCOP: c.67.1.1 PDB: 1gde_A* 1dju_A* Back     alignment and structure
>3a2b_A Serine palmitoyltransferase; vitamin B6-dependent enzyme fold type I, acyltransferase, PY phosphate; HET: PLP; 2.30A {Sphingobacterium multivorum} Back     alignment and structure
>3g0t_A Putative aminotransferase; NP_905498.1, putative aspartate aminotransferase, structural genomics, joint center for structural genomics; HET: MSE LLP PE4; 1.75A {Porphyromonas gingivalis} Back     alignment and structure
>2w8t_A SPT, serine palmitoyltransferase; HET: LLP; 1.25A {Sphingomonas paucimobilis} PDB: 2w8u_A* 2w8w_A* 2xbn_A* 2w8j_A* 2w8v_A* 2jg2_A* 2jgt_A 2x8u_A* Back     alignment and structure
>1b5p_A Protein (aspartate aminotransferase); pyridoxal enzyme; HET: PLP; 1.80A {Thermus thermophilus} SCOP: c.67.1.1 PDB: 1gck_A* 1b5o_A* 5bj4_A* 1gc4_A* 1gc3_A* 1bkg_A* 5bj3_A* 1bjw_A* Back     alignment and structure
>2z61_A Probable aspartate aminotransferase 2; amino acid aminotransferase, kynurenine aminotransferase, MJ0684, cytoplasm; HET: LLP; 2.20A {Methanococcus jannaschii} Back     alignment and structure
>3nra_A Aspartate aminotransferase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: LLP; 2.15A {Rhodobacter sphaeroides} Back     alignment and structure
>1v2d_A Glutamine aminotransferase; PLP, riken structural genomics/proteomics initi RSGI, structural genomics; HET: PLP; 1.90A {Thermus thermophilus} SCOP: c.67.1.1 PDB: 1v2e_A* 1v2f_A* Back     alignment and structure
>3ftb_A Histidinol-phosphate aminotransferase; structural genomics, PSI, MCSG, protein structure initiative; 2.00A {Clostridium acetobutylicum} SCOP: c.67.1.0 Back     alignment and structure
>1j32_A Aspartate aminotransferase; HET: PLP; 2.10A {Phormidium lapideum} SCOP: c.67.1.1 Back     alignment and structure
>3hdo_A Histidinol-phosphate aminotransferase; PSI-II, histidinol-phosphate aminotrans structural genomics, protein structure initiative; 1.61A {Geobacter metallireducens gs-15} Back     alignment and structure
>3p1t_A Putative histidinol-phosphate aminotransferase; PLP-dependent transferase-like, structural genomics, joint C structural genomics, JCSG; HET: TLA; 2.60A {Burkholderia pseudomallei} Back     alignment and structure
>3fdb_A Beta C-S lyase, putative PLP-dependent beta-cystathionase; PLP-dependent transferase-like fold, structural genomics; HET: LLP; 1.99A {Corynebacterium diphtheriae} Back     alignment and structure
>1xi9_A Putative transaminase; alanine aminotransferase, southeast collaboratory for structural genomics, secsg; HET: PLP; 2.33A {Pyrococcus furiosus} SCOP: c.67.1.1 Back     alignment and structure
>1o4s_A Aspartate aminotransferase; TM1255, structural genomics, JCS protein structure initiative, joint center for structural G transferase; HET: PLP; 1.90A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>3ke3_A Putative serine-pyruvate aminotransferase; structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: LLP; 2.20A {Psychrobacter arcticus 273-4} Back     alignment and structure
>3hbx_A GAD 1, glutamate decarboxylase 1; calmodulin-binding, lyase, pyridoxal phosphate; HET: LLP; 2.67A {Arabidopsis thaliana} Back     alignment and structure
>1bw0_A TAT, protein (tyrosine aminotransferase); tyrosine catabolism, pyridoxal-5'-phosphate, PLP; HET: LLP; 2.50A {Trypanosoma cruzi} SCOP: c.67.1.1 Back     alignment and structure
>3tqx_A 2-amino-3-ketobutyrate coenzyme A ligase; energy metabolism, transferase; HET: PLP; 2.30A {Coxiella burnetii} Back     alignment and structure
>3h14_A Aminotransferase, classes I and II; YP_167802.1, SPO258 structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.90A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>1fc4_A 2-amino-3-ketobutyrate conenzyme A ligase; 2-amino-3-ketobutyrate COA ligase, pyridoxal phosphate, COEN transferase, structural genomics; HET: PLP; 2.00A {Escherichia coli} SCOP: c.67.1.4 Back     alignment and structure
>2dgk_A GAD-beta, GADB, glutamate decarboxylase beta; gadbd1-14, autoinhibition, substituted aldamine, lyase; HET: PLP; 1.90A {Escherichia coli} PDB: 2dgm_A* 1pmo_A* 2dgl_A* 1pmm_A* 3fz6_A* 3fz7_A 3fz8_A* 1xey_A* Back     alignment and structure
>1c7n_A Cystalysin; transferase, aminotransferase, pyridoxal phosphate; HET: PLP; 1.90A {Treponema denticola} SCOP: c.67.1.3 PDB: 1c7o_A* Back     alignment and structure
>3mad_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxal phosphate; HET: LLP; 2.00A {Symbiobacterium thermophilum} PDB: 3maf_A* 3mau_A* 3mbb_A* Back     alignment and structure
>2qma_A Diaminobutyrate-pyruvate transaminase and L-2,4- diaminobutyrate decarboxylase; structural genomics, APC91511.1, glutamate decarboxylase; HET: MSE; 1.81A {Vibrio parahaemolyticus} Back     alignment and structure
>1u08_A Hypothetical aminotransferase YBDL; alpha beta protein; HET: PLP; 2.35A {Escherichia coli} SCOP: c.67.1.1 Back     alignment and structure
>2dou_A Probable N-succinyldiaminopimelate aminotransfera; PLP-dependent enzyme, structural genomics, NPPSFA; HET: EPE; 2.30A {Thermus thermophilus} Back     alignment and structure
>3cq5_A Histidinol-phosphate aminotransferase; PLP, PMP, amino-acid biosynthesis, histidine biosynthesis, pyridoxal phosphate; HET: PMP; 1.80A {Corynebacterium glutamicum} PDB: 3cq6_A* 3cq4_A Back     alignment and structure
>2x5d_A Probable aminotransferase; HET: LLP PLP; 2.25A {Pseudomonas aeruginosa} Back     alignment and structure
>3l8a_A METC, putative aminotransferase, probable beta-cystathi; beta-cystathionase, lyase; HET: PLP; 1.54A {Streptococcus mutans} Back     alignment and structure
>1lc5_A COBD, L-threonine-O-3-phosphate decarboxylase; PLP-dependent decarboxylase cobalamin, lyase; 1.46A {Salmonella enterica} SCOP: c.67.1.1 PDB: 1lc7_A* 1lc8_A* 1lkc_A* Back     alignment and structure
>3aow_A Putative uncharacterized protein PH0207; protein-PLP-AKG triple complex, schiff-base linkage, kynuren aminotransferase; HET: PLP AKG; 1.56A {Pyrococcus horikoshii} PDB: 3aov_A* 3ath_A* 3av7_A* 1x0m_A 1wst_A* Back     alignment and structure
>2zyj_A Alpha-aminodipate aminotransferase; alpha-aminoadipate aminotransferase; HET: PGU; 1.67A {Thermus thermophilus} PDB: 2egy_A* 2dtv_A* 2zg5_A* 2zp7_A* 2z1y_A* 3cbf_A* Back     alignment and structure
>3ele_A Amino transferase; RER070207001803, structural genomics, JOI for structural genomics, JCSG; HET: MSE PLP; 2.10A {Eubacterium rectale} Back     alignment and structure
>1bs0_A Protein (8-amino-7-oxonanoate synthase); PLP-dependent acyl-COA synthase, biotin biosynthesis, 8-AMIN oxonanoate synthase; 1.65A {Escherichia coli} SCOP: c.67.1.4 PDB: 2g6w_A* 1dje_A* 1dj9_A* Back     alignment and structure
>3mc6_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxyl phosphate; HET: LLP; 3.15A {Saccharomyces cerevisiae} Back     alignment and structure
>2o1b_A Aminotransferase, class I; aminotrasferase; HET: PLP; 1.95A {Staphylococcus aureus} Back     alignment and structure
>2bwn_A 5-aminolevulinate synthase; tetrapyrrole biosynthesis, heme biosynthesis, pyridoxal PHOS dependent, transferase, acyltransferase; HET: LLP; 2.1A {Rhodobacter capsulatus} SCOP: c.67.1.4 PDB: 2bwo_A* 2bwp_A* Back     alignment and structure
>1d2f_A MALY protein; aminotransferase fold, large PLP-binding domain, small C-TER domain, open alpha-beta structure., transferase; HET: PLP; 2.50A {Escherichia coli} SCOP: c.67.1.3 Back     alignment and structure
>2zc0_A Alanine glyoxylate transaminase; alanine:glyoxylate aminotransferase, archaea, thermococcus L transferase; HET: PMP; 2.30A {Thermococcus litoralis} Back     alignment and structure
>2o0r_A RV0858C (N-succinyldiaminopimelate aminotransfera; PLP-binding enzyme, lysine biosynthesis, aminotransferase, S genomics; HET: LLP; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1svv_A Threonine aldolase; structural genomics, structural genomics of pathogenic proto SGPP, protein structure initiative, PSI; 2.10A {Leishmania major} SCOP: c.67.1.1 Back     alignment and structure
>3jtx_A Aminotransferase; NP_283882.1, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; HET: LLP MES; 1.91A {Neisseria meningitidis Z2491} Back     alignment and structure
>2z67_A O-phosphoseryl-tRNA(SEC) selenium transferase; selenocysteine biosynthesis, seven-stranded BETE-strand, PYR 5'-phosphate; HET: PLP; 2.50A {Methanococcus maripaludis} SCOP: c.67.1.9 Back     alignment and structure
>2jis_A Cysteine sulfinic acid decarboxylase; pyridoxal phosphate, alternative splicing, pyridoxal phosphate (PLP), structural genomics consortium (SGC); HET: PLP; 1.6A {Homo sapiens} Back     alignment and structure
>3fvs_A Kynurenine--oxoglutarate transaminase 1; alpha beta protein, PLP dependent protein, aminotransferase, pyridoxal phosphate, transferase; HET: LLP; 1.50A {Homo sapiens} SCOP: c.67.1.1 PDB: 3fvu_A* 3fvx_A* 1w7l_A* 1w7m_A* 1w7n_A* Back     alignment and structure
>2okj_A Glutamate decarboxylase 1; PLP-dependent decarboxylase, lyase; HET: LLP PLZ; 2.30A {Homo sapiens} PDB: 2okk_A* Back     alignment and structure
>1fg7_A Histidinol phosphate aminotransferase; HISC, histidine biosynthesis, pyridoxal PH montreal-kingston bacterial structural genomics initiative; HET: PMP; 1.50A {Escherichia coli} SCOP: c.67.1.1 PDB: 1fg3_A* 1gew_A* 1gex_A* 1gey_A* 1iji_A* Back     alignment and structure
>1wyu_A Glycine dehydrogenase (decarboxylating) subunit 1; alpha(2)beta(2) tetramer, riken structural genomics/proteomi initiative, RSGI; HET: PLP; 2.10A {Thermus thermophilus} SCOP: c.67.1.7 PDB: 1wyt_A* 1wyv_A* Back     alignment and structure
>1yiz_A Kynurenine aminotransferase; glutamine transaminase; kynurenic acid, mosquito, PLP-enzyme, pyridoxal phosphate, PLP; HET: LLP; 1.55A {Aedes aegypti} SCOP: c.67.1.1 PDB: 1yiy_A* 2r5c_A* 2r5e_A* Back     alignment and structure
>2gb3_A Aspartate aminotransferase; TM1698, structural genomics, PSI structure initiative, joint center for structural genomics; HET: LLP; 2.50A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>1vp4_A Aminotransferase, putative; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE PLP; 1.82A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>2fyf_A PSAT, phosphoserine aminotransferase; PLP-dependent enzyme, dimer, structural genomics; HET: PLP; 1.50A {Mycobacterium tuberculosis} PDB: 3vom_A* Back     alignment and structure
>2fnu_A Aminotransferase; protein-product complex, structural genomics, montreal-kings bacterial structural genomics initiative, BSGI; HET: PMP UD1; 1.50A {Helicobacter pylori} SCOP: c.67.1.4 PDB: 2fni_A* 2fn6_A* Back     alignment and structure
>3ezs_A Aminotransferase ASPB; NP_207418.1, structural genomics, JOI for structural genomics, JCSG; HET: MSE; 2.19A {Helicobacter pylori 26695} SCOP: c.67.1.0 Back     alignment and structure
>3qgu_A LL-diaminopimelate aminotransferase; L-lysine, pyridoxal-5' phosphate, chamydomonas reinhardtii; HET: GOL; 1.55A {Chlamydomonas reinhardtii} Back     alignment and structure
>3b46_A Aminotransferase BNA3; kynurenine aminotransferase, LLP, PLP, cytoplasm, mitochondrion, pyridoxal phosphate; HET: LLP; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3op7_A Aminotransferase class I and II; PLP-dependent transferase, structural genomics, joint center structural genomics, JCSG; HET: LLP UNL; 1.70A {Streptococcus suis 89} PDB: 3p6k_A* Back     alignment and structure
>3piu_A 1-aminocyclopropane-1-carboxylate synthase; fruit ripening, ethylene biosynthesis, lyase, pyridoxal 5'-P binding; HET: LLP PLR; 1.35A {Malus domestica} SCOP: c.67.1.4 PDB: 1m4n_A* 1m7y_A* 1ynu_A* 1b8g_A* Back     alignment and structure
>1rv3_A Serine hydroxymethyltransferase, cytosolic; one-carbon metabolism; HET: GLY PLP; 2.40A {Oryctolagus cuniculus} SCOP: c.67.1.4 PDB: 1rv4_A* 1rvu_A* 1rvy_A* 1ls3_A* 1cj0_A* 1bj4_A* 1eji_A* Back     alignment and structure
>3fkd_A L-threonine-O-3-phosphate decarboxylase; structural genomic, , structural genomics, PSI-2, protein structure initiative; 2.50A {Porphyromonas gingivalis} Back     alignment and structure
>1js3_A DDC;, DOPA decarboxylase; carbidopa, parkinson'S disease, vitamin; HET: PLP 142; 2.25A {Sus scrofa} SCOP: c.67.1.6 PDB: 1js6_A* 3rch_A* 3rbl_A 3rbf_A* Back     alignment and structure
>1v72_A Aldolase; PLP-dependent enzyme, lyase; HET: PLP; 2.05A {Pseudomonas putida} SCOP: c.67.1.1 Back     alignment and structure
>3e2y_A Kynurenine-oxoglutarate transaminase 3; alpha beta protein, PLP dependent protein, aminotransferase, pyridoxal phosphate, transferase; HET: GLN PMP; 2.26A {Mus musculus} SCOP: c.67.1.0 PDB: 2zjg_A* 3e2f_A* 3e2z_A* Back     alignment and structure
>1iay_A ACC synthase 2, 1-aminocyclopropane-1-carboxylate synthase 2; protein-cofactor-inhibitor complex, V6-dependent enzyme, LYA; HET: PLP AVG; 2.70A {Solanum lycopersicum} SCOP: c.67.1.4 PDB: 1iax_A* Back     alignment and structure
>3kki_A CAI-1 autoinducer synthase; quorum sensing, CQSA, P virulence, acyltransferase, aminotransferase, pyridoxal PHO transferase; HET: PLP; 1.80A {Vibrio cholerae} PDB: 3hqt_A* 2wk9_A* 2wk8_A* 2wka_A* 2wk7_A Back     alignment and structure
>1wyu_B Glycine dehydrogenase subunit 2 (P-protein); alpha(2)beta(2) tetramer, riken structural genomics/proteomi initiative, RSGI; HET: PLP; 2.10A {Thermus thermophilus} SCOP: c.67.1.7 PDB: 1wyt_B* 1wyv_B* Back     alignment and structure
>3asa_A LL-diaminopimelate aminotransferase; PLP dependent aminotransferase; 2.05A {Chlamydia trachomatis} PDB: 3asb_A* Back     alignment and structure
>2x5f_A Aspartate_tyrosine_phenylalanine pyridoxal-5' phosphate-dependent aminotransferase...; HET: PLP EPE; 1.80A {Staphylococcus aureus} Back     alignment and structure
>1pff_A Methionine gamma-lyase; homocysteine; 2.50A {Trichomonas vaginalis} SCOP: c.67.1.3 Back     alignment and structure
>3vp6_A Glutamate decarboxylase 1; catalytic loop SWAP, lyase; HET: LLP HLD; 2.10A {Homo sapiens} PDB: 2okj_A* 2okk_A* Back     alignment and structure
>3if2_A Aminotransferase; YP_265399.1, structura genomics, joint center for structural genomics, JCSG, prote structure initiative, PSI-2; HET: PLP; 2.50A {Psychrobacter arcticus 273-4} Back     alignment and structure
>3ei9_A LL-diaminopimelate aminotransferase; lysine biosynthesis, pyridoxal 5' phosphat external aldimine, chloroplast, pyridox phosphate; HET: PL6; 1.55A {Arabidopsis thaliana} PDB: 3ei8_A* 3eib_A* 3ei6_A* 2z1z_A* 3ei5_A* 2z20_A* 3ei7_A 3eia_A* Back     alignment and structure
>1uu1_A Histidinol-phosphate aminotransferase; histidine biosynthesis, pyridoxal phosphate, complete proteome; HET: PMP HSA; 2.38A {Thermotoga maritima} SCOP: c.67.1.1 PDB: 1uu0_A 1h1c_A* 1uu2_A* 2f8j_A* Back     alignment and structure
>2vi8_A Serine hydroxymethyltransferase; SHMT, E53Q, FTHF, enzyme memory, pyridoxal phosphate, one-carbon metabolism, PLP-dependent enzymes; HET: PLP; 1.67A {Bacillus stearothermophilus} PDB: 2vi9_A* 2via_A* 2vib_A* 1kkj_A* 1kkp_A* 1kl1_A* 1kl2_A* 1yjs_A* 2w7f_A* 2w7d_A* 2w7e_A* 2w7g_A* 2w7h_A* 1yjz_A* 1yjy_A* 2vgu_A* 2vgs_A* 2vgt_A* 2vgv_A* 2vgw_A* ... Back     alignment and structure
>3k40_A Aromatic-L-amino-acid decarboxylase; PLP dependent protein, alpha beta protein, alternative splicing, catecholamine biosynthesis, lyase; HET: LLP; 1.75A {Drosophila melanogaster} SCOP: c.67.1.6 Back     alignment and structure
>3uwc_A Nucleotide-sugar aminotransferase; lipopolysaccharide biosynthesis; HET: MSE PMP; 1.80A {Coxiella burnetii} Back     alignment and structure
>2r2n_A Kynurenine/alpha-aminoadipate aminotransferase mitochondrial; alpha & beta protein, PLP-dependent transferase, aminotransf mitochondrion; HET: PMP KYN; 1.95A {Homo sapiens} PDB: 2qlr_A* 3dc1_A* 3ue8_A* 2vgz_A* 2xh1_A* Back     alignment and structure
>1mdo_A ARNB aminotransferase; type 1 aminotransferase fold; HET: MSE PMP; 1.70A {Salmonella typhimurium} SCOP: c.67.1.4 PDB: 1mdx_A* 1mdz_A* Back     alignment and structure
>1qgn_A Protein (cystathionine gamma-synthase); methionine biosynthesis, pyridoxal 5'-phosphate, gamma-famil; HET: PLP; 2.90A {Nicotiana tabacum} SCOP: c.67.1.3 PDB: 1i41_A* 1i48_A* 1i43_A* Back     alignment and structure
>2rfv_A Methionine gamma-lyase; pyridoxal-5'-phosphate, PLP-dependent enzyme; HET: LLP; 1.35A {Citrobacter freundii} PDB: 1y4i_A* 3jwa_A* 3jw9_A* 3jwb_A* 3mkj_A* Back     alignment and structure
>3tcm_A Alanine aminotransferase 2; pyridoxal phosphate (PLP)-binding; HET: DCS; 2.71A {Hordeum vulgare} Back     alignment and structure
>2cb1_A O-acetyl homoserine sulfhydrylase; PLP enzyme, lyase, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: LLP; 2.0A {Thermus thermophilus} Back     alignment and structure
>3g7q_A Valine-pyruvate aminotransferase; NP_462565.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 1.80A {Salmonella typhimurium} Back     alignment and structure
>2fq6_A Cystathionine beta-lyase; protein-inhibitor complex, PLP cofactor covalently bound to inhibitor; HET: P3F; 1.78A {Escherichia coli} SCOP: c.67.1.3 PDB: 2gqn_A* 1cl1_A* 1cl2_A* Back     alignment and structure
>3frk_A QDTB; aminotransferase, sugar-modification, natural porduct; HET: TQP; 2.15A {Thermoanaerobacteriumthermosaccharolyticum} Back     alignment and structure
>1jg8_A L-ALLO-threonine aldolase; glycine biosynthesis, pyridoxal-5'- phosphate, calcium binding site, structural genomics, PSI; HET: LLP; 1.80A {Thermotoga maritima} SCOP: c.67.1.1 PDB: 1lw4_A* 1lw5_A* 1m6s_A* 2fm1_A* Back     alignment and structure
>2x3l_A ORN/Lys/Arg decarboxylase family protein; lyase; HET: LLP; 2.00A {Staphylococcus aureus} Back     alignment and structure
>2oga_A Transaminase; PLP-dependent enzyme, desosamine, deoxysugars, antibiotics, hydrolase; HET: PGU; 2.05A {Streptomyces venezuelae} PDB: 2oge_A* Back     alignment and structure
>3ez1_A Aminotransferase MOCR family; YP_604413.1, struct genomics, joint center for structural genomics, JCSG; 2.60A {Deinococcus geothermalis dsm 11300} Back     alignment and structure
>4e1o_A HDC, histidine decarboxylase; lyase; HET: PLP PVH; 1.80A {Homo sapiens} Back     alignment and structure
>1gc0_A Methionine gamma-lyase; pyridoxal-5'-phosphate; HET: LLP; 1.70A {Pseudomonas putida} SCOP: c.67.1.3 PDB: 1gc2_A* 1pg8_A* 1ukj_A* 2o7c_A* Back     alignment and structure
>1b9h_A AHBA synthase, protein (3-amino-5-hydroxybenzoic acid synthase); rifamycin biosynthesis (RIFD gene); HET: PLP; 2.00A {Amycolatopsis mediterranei} SCOP: c.67.1.4 PDB: 1b9i_A* Back     alignment and structure
>3ruy_A Ornithine aminotransferase; structural genomics, csgid, center for structural genomics O infectious diseases, alpha and beta protein; HET: LLP; 2.65A {Bacillus anthracis} SCOP: c.67.1.0 Back     alignment and structure
>2eh6_A Acoat, acetylornithine aminotransferase; ARGD, structural genomics, NPPSFA, national project on prote structural and functional analyses; HET: PLP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>3rq1_A Aminotransferase class I and II; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta structure, cytosol; HET: AKG GOL; 2.20A {Veillonella parvula} Back     alignment and structure
>2dkj_A Serine hydroxymethyltransferase; PLP dependent enzyme, structural genomics; HET: PLP; 1.15A {Thermus thermophilus} Back     alignment and structure
>1vef_A Acetylornithine/acetyl-lysine aminotransferase; PLP, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: PLP; 1.35A {Thermus thermophilus} SCOP: c.67.1.4 PDB: 1wkg_A* 1wkh_A* Back     alignment and structure
>3qhx_A Cystathionine gamma-synthase METB (CGS); structural genomics, seattle structural genomics center for infectious disease, ssgcid, CGS_LIKE; HET: LLP EPE; 1.65A {Mycobacterium ulcerans} SCOP: c.67.1.0 PDB: 3qi6_A* Back     alignment and structure
>1e5e_A MGL, methionine gamma-lyase; methionine biosynthesis, PLP-dependent enzymes, C-S gamma lyase; HET: PPJ; 2.18A {Trichomonas vaginalis} SCOP: c.67.1.3 PDB: 1e5f_A* Back     alignment and structure
>3dr4_A Putative perosamine synthetase; deoxysugar, pyridoxal phosphate, aspartate aminotransferase, O-antigen; HET: G4M; 1.60A {Caulobacter crescentus} PDB: 3dr7_A* 3bn1_A* Back     alignment and structure
>3ihj_A Alanine aminotransferase 2; helix, structural genomics, structural genomics consortium, pyridoxal phosphate; HET: PLP; 2.30A {Homo sapiens} Back     alignment and structure
>3ppl_A Aspartate aminotransferase; dimer, PLP-dependent transferase-like fold structural genomics, joint center for structural genomics; HET: MSE PLP UNL; 1.25A {Corynebacterium glutamicum} Back     alignment and structure
>1n8p_A Cystathionine gamma-lyase; three open alpha/beta structures; HET: PLP; 2.60A {Saccharomyces cerevisiae} SCOP: c.67.1.3 Back     alignment and structure
>2c81_A Glutamine-2-deoxy-scyllo-inosose aminotransferase; SMAT, butirosin, aminoglycoside antibiotics; HET: PMP; 1.7A {Bacillus circulans} PDB: 2c7t_A* Back     alignment and structure
>1cs1_A CGS, protein (cystathionine gamma-synthase); lyase, LLP-dependent enzymes, methionine biosynthesis; HET: LLP DHD; 1.50A {Escherichia coli} SCOP: c.67.1.3 Back     alignment and structure
>2po3_A 4-dehydrase; external aldimine, PLP, aminotransferase, TDP-sugar; HET: T4K; 2.10A {Streptomyces venezuelae} Back     alignment and structure
>3d6k_A Putative aminotransferase; APC82464, corynebacterium diphthe structural genomics, PSI-2, protein structure initiative; 2.00A {Corynebacterium diphtheriae} Back     alignment and structure
>1o69_A Aminotransferase; structural genomics, unknown function; HET: X04; 1.84A {Campylobacter jejuni} SCOP: c.67.1.4 PDB: 1o62_A 1o61_A* Back     alignment and structure
>3b8x_A WBDK, pyridoxamine 5-phosphate-dependent dehydrase; aspartate aminotransferase, colitose, perosamine, O-antigen, pyridoxal phosphate,; HET: G4M; 1.70A {Escherichia coli} PDB: 2gms_A* 2gmu_A* 2r0t_A* 3gr9_A* Back     alignment and structure
>3cog_A Cystathionine gamma-lyase; CTH, PLP, propargylglycine, SGC, inhibitor, structural genom stockholm, structural genomics consortium; HET: PLP; 2.00A {Homo sapiens} PDB: 2nmp_A* 3elp_B Back     alignment and structure
>2ord_A Acoat, acetylornithine aminotransferase; TM1785, acetylornithine aminotransferase (EC 2.6.1.11) (ACOA structural genomics; HET: MSE PLP; 1.40A {Thermotoga maritima MSB8} PDB: 2e54_A* Back     alignment and structure
>3acz_A Methionine gamma-lyase; L-methionine; HET: LLP; 1.97A {Entamoeba histolytica} PDB: 3aej_A* 3ael_A* 3aem_A* 3aen_A* 3aeo_A* 3aep_A* Back     alignment and structure
>3ndn_A O-succinylhomoserine sulfhydrylase; seattle structural genomics center for infectious disease, S mycobacterium, PLP, schiff base; HET: LLP; 1.85A {Mycobacterium tuberculosis} Back     alignment and structure
>1s0a_A Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; fold type I, subclass II, homodimer; HET: LLP; 1.71A {Escherichia coli} SCOP: c.67.1.4 PDB: 1qj5_A* 1mlz_A* 1qj3_A* 1mly_A* 1s06_A* 1s08_A* 1s09_A* 1s07_A* 1mgv_A* 1dty_A* Back     alignment and structure
>1sff_A 4-aminobutyrate aminotransferase; enzyme complexes; HET: IK2; 1.90A {Escherichia coli} SCOP: c.67.1.4 PDB: 1sf2_A* 1szk_A* 1szu_A* 1szs_A* Back     alignment and structure
>3n0l_A Serine hydroxymethyltransferase; alpha beta class, 3-layer(ABA) sandwich, CSGI transferase, structural genomics; HET: MSE; 1.80A {Campylobacter jejuni} SCOP: c.67.1.0 Back     alignment and structure
>3nyt_A Aminotransferase WBPE; PLP binding, nucleotide-sugar binding; HET: ULP; 1.30A {Pseudomonas aeruginosa} PDB: 3nys_A* 3nyu_A* 3nu8_A* 3nu7_A* 3nub_A* Back     alignment and structure
>4adb_A Succinylornithine transaminase; transferase, PLP enzymes, aminotransferase; HET: PLP; 2.20A {Escherichia coli} PDB: 4adc_A* 4add_A* 4ade_A Back     alignment and structure
>3f6t_A Aspartate aminotransferase; YP_194538.1, STRU genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: LLP; 2.15A {Lactobacillus acidophilus ncfm} Back     alignment and structure
>3bwn_A AT1G70560, L-tryptophan aminotransferase; auxin synthesis, pyridoxal-5'- phosphate, indole-3-pyruvate; HET: LLP PMP PHE; 2.25A {Arabidopsis thaliana} PDB: 3bwo_A* Back     alignment and structure
>1ibj_A CBL, cystathionine beta-lyase; PLP-dependent enzyme, methionine biosynthesis, transsulfurat lyase; HET: PLP; 2.30A {Arabidopsis thaliana} SCOP: c.67.1.3 Back     alignment and structure
>2pb2_A Acetylornithine/succinyldiaminopimelate aminotran; ARGD, pyridoxal 5'-phosphate, arginine metabolism, lysine biosynthesis, gabaculine; HET: PLP; 1.91A {Salmonella typhimurium} PDB: 2pb0_A* Back     alignment and structure
>3gbx_A Serine hydroxymethyltransferase; structural genomics, IDP01011, serine hydroxymethyltransfera salmonella typhimurium.; HET: MSE; 1.80A {Salmonella typhimurium} SCOP: c.67.1.4 PDB: 1dfo_A* 3g8m_A* 1eqb_A* Back     alignment and structure
>3b1d_A Betac-S lyase; HET: PLP PLS EPE; 1.66A {Streptococcus anginosus} PDB: 3b1c_A* 3b1e_A* Back     alignment and structure
>3nx3_A Acoat, acetylornithine aminotransferase; csgid, structural genomics, center for structural genomics O infectious diseases; 1.80A {Campylobacter jejuni subsp} Back     alignment and structure
>1z7d_A Ornithine aminotransferase; structural genomics consortium, SGC, malaria; 2.10A {Plasmodium yoelii yoelii} SCOP: c.67.1.4 PDB: 3lg0_A 3ntj_A Back     alignment and structure
>2ctz_A O-acetyl-L-homoserine sulfhydrylase; crystal, O-acetyl homoserine sulfhydrase, structural genomic structural genomics/proteomics initiative; HET: PLP; 2.60A {Thermus thermophilus} SCOP: c.67.1.3 Back     alignment and structure
>4f4e_A Aromatic-amino-acid aminotransferase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: LLP; 1.80A {Burkholderia pseudomallei} PDB: 4eff_A* Back     alignment and structure
>3fsl_A Aromatic-amino-acid aminotransferase; tyrosine aminotransferase, pyridoxal phosphate, internal ALD schiff base, amino-acid biosynthesis; HET: PLR; 2.35A {Escherichia coli k-12} SCOP: c.67.1.1 PDB: 3tat_A* Back     alignment and structure
>2aeu_A Hypothetical protein MJ0158; selenocysteine synthase, PLP, pyridoxal phosphate, HOMO- oligomerization, unknown function; 1.70A {Methanocaldococcus jannaschii} SCOP: c.67.1.8 PDB: 2aev_A* Back     alignment and structure
>2oat_A Ornithine aminotransferase; 5-fluoromethylornithine, PLP-dependent ENZ pyridoxal phosphate; HET: PFM; 1.95A {Homo sapiens} SCOP: c.67.1.4 PDB: 1oat_A* 2byj_A* 2byl_A* 1gbn_A* 2can_A* Back     alignment and structure
>3ri6_A O-acetylhomoserine sulfhydrylase; PYR 5'-phosphate, gamma-elimination, direct sulfhydrylation, CY metabolism, protein thiocarboxylate, TR; 2.20A {Wolinella succinogenes} Back     alignment and structure
>2eo5_A 419AA long hypothetical aminotransferase; PLP enzyme, structural genomics, NPPSFA, N project on protein structural and functional analyses; HET: PLP; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>1ajs_A Aspartate aminotransferase; PIG, in the presence of ligand 2-methylaspartate; HET: LLP PLA; 1.60A {Sus scrofa} SCOP: c.67.1.1 PDB: 1ajr_A* 3ii0_A* 1aat_A 2cst_A* Back     alignment and structure
>2a7v_A Serine hydroxymethyltransferase; structural genomics, structural genomics consortium, SGC; 2.04A {Homo sapiens} PDB: 3ou5_A Back     alignment and structure
>3ecd_A Serine hydroxymethyltransferase 2; ssgcid, decode, bupsa00008A, one-carbon metabolism, pyridoxa phosphate, structural genomics; 1.60A {Burkholderia pseudomallei} Back     alignment and structure
>3ju7_A Putative PLP-dependent aminotransferase; NP_978343.1, struct genomics, joint center for structural genomics, JCSG; HET: LLP PGE; 2.19A {Bacillus cereus atcc 10987} Back     alignment and structure
>7aat_A Aspartate aminotransferase; transferase(aminotransferase); HET: PLP; 1.90A {Gallus gallus} SCOP: c.67.1.1 PDB: 1ivr_A* 1map_A* 1maq_A* 1oxo_A* 1oxp_A* 1ama_A* 1tas_A* 1tat_A* 1tar_A* 8aat_A* 9aat_A* 1aka_A* 1akb_A* 1akc_A* 3pd6_A* 3hlm_A* 3pdb_A* Back     alignment and structure
>1yaa_A Aspartate aminotransferase; HET: PLP; 2.05A {Saccharomyces cerevisiae} SCOP: c.67.1.1 Back     alignment and structure
>2ay1_A Aroat, aromatic amino acid aminotransferase; HET: PLP AHC; 2.20A {Paracoccus denitrificans} SCOP: c.67.1.1 PDB: 1ay5_A* 1ay4_A* 1ay8_A* 2ay2_A* 2ay3_A* 2ay4_A* 2ay5_A* 2ay6_A* 2ay7_A* 2ay8_A* 2ay9_A* Back     alignment and structure
>3dxv_A Alpha-amino-epsilon-caprolactam racemase; fold-TYPE1, pyridoxal-5'-phosphate dependent racemase, pyrid phosphate, isomerase; HET: PLP; 2.21A {Achromobacter obae} PDB: 2zuk_A* 3dxw_A* Back     alignment and structure
>3h7f_A Serine hydroxymethyltransferase 1; cytoplasm, one-carbon metabolism, pyridoxal phosphate, structural genomics; HET: LLP; 1.50A {Mycobacterium tuberculosis} Back     alignment and structure
>3a8u_X Omega-amino acid--pyruvate aminotransferase; large pleated sheet, transaminase, pyridox phosphate; HET: PLP; 1.40A {Pseudomonas putida} Back     alignment and structure
>2q7w_A Aspartate aminotransferase; mechanism-based inhibitor, PLP, sadta, PH dependence; HET: KST PSZ PMP GOL; 1.40A {Escherichia coli} SCOP: c.67.1.1 PDB: 2qa3_A* 2qb2_A* 2qb3_A* 2qbt_A* 3qn6_A* 3pa9_A* 1aaw_A* 1amq_A* 1ams_A* 1arg_A* 1amr_A* 1art_A* 1asa_A* 1asd_A* 1ase_A* 1asl_A* 1asm_A* 1asn_A* 1c9c_A* 1cq6_A* ... Back     alignment and structure
>1c4k_A Protein (ornithine decarboxylase); lyase; HET: PLP GTP; 2.70A {Lactobacillus SP} SCOP: c.23.1.4 c.67.1.5 d.125.1.1 PDB: 1ord_A* Back     alignment and structure
>3meb_A Aspartate aminotransferase; pyridoxal PHOS transferase, structural genomics, seattle structural genomi for infectious disease, ssgcid; HET: PLP; 1.90A {Giardia lamblia} Back     alignment and structure
>1zod_A DGD, 2,2-dialkylglycine decarboxylase; pyridoxal, cesium, lyase; HET: MES PLP; 1.80A {Burkholderia cepacia} SCOP: c.67.1.4 PDB: 1dka_A* 1m0o_A* 1m0p_A* 1m0n_A* 1zc9_A* 1zob_A* 1m0q_A* 2dkb_A* 1dgd_A* 1dge_A* 1d7u_A* 1d7s_A* 1d7r_A* 1d7v_A* 1z3z_A* Back     alignment and structure
>1ax4_A Tryptophanase; tryptophan biosynthesis, tryptophan indole-lyase, pyridoxal 5'-phosphate, monovalent cation binding site; HET: LLP; 2.10A {Proteus vulgaris} SCOP: c.67.1.2 Back     alignment and structure
>2ez2_A Beta-tyrosinase, tyrosine phenol-lyase; PLP-dependent enzyme, pyridoxal-5'-phosphate, domain lyase; 1.85A {Citrobacter freundii} PDB: 2ez1_A 2vlf_A* 2vlh_A* 2yct_A* 1tpl_A 2tpl_A* 2ycn_A* 2yhk_A* 2ycp_A* 1c7g_A* Back     alignment and structure
>3i4j_A Aminotransferase, class III; structural GENOMICS,NYSGXRC, target 11246C, deino radiodurans, pyridoxal phosphate, transfe PSI-2; 1.70A {Deinococcus radiodurans} Back     alignment and structure
>2cjg_A L-lysine-epsilon aminotransferase; internal aldimine, pyridoxal phosphate, PLP, RV3290C, lysine amino transferase; HET: PMP; 1.95A {Mycobacterium tuberculosis} PDB: 2cjd_A* 2cin_A* 2cjh_A* 2jjg_A* 2jje_A* 2jjh_A* 2jjf_A Back     alignment and structure
>3nmy_A Xometc, cystathionine gamma-lyase-like protein; Cys-Met metabolism PLP-dependent enzyme family, CYST gamma lyase, pyridoxal-phosphate; HET: PLP; 2.07A {Xanthomonas oryzae PV} SCOP: c.67.1.0 PDB: 3e6g_A* 3nnp_A* Back     alignment and structure
>2zy4_A L-aspartate beta-decarboxylase; pyridoxal 5'-phosphate, aminotransferase, lyase; HET: PLP; 2.00A {Alcaligenes faecalis subsp} PDB: 2zy3_A* 2zy5_A* 3fdd_A* 2zy2_A* Back     alignment and structure
>3n5m_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; aminotransferase, csgid; 2.05A {Bacillus anthracis} Back     alignment and structure
>3gju_A Putative aminotransferase; pyridoxal phosphate, PLP-dependent transferase-like fold, ST genomics, joint center for structural genomics, JCSG; HET: MSE LLP PLP; 1.55A {Mesorhizobium loti} PDB: 3fcr_A* Back     alignment and structure
>3dod_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; aminotransferase, biotin biosynthesis, pyridoxal phosphate, adenosyl-L-methionine; HET: PLP; 1.90A {Bacillus subtilis} SCOP: c.67.1.0 PDB: 3drd_A 3du4_A* Back     alignment and structure
>2vyc_A Biodegradative arginine decarboxylase; pyridoxal phosphate, PLP-dependent E lyase, acid resistance; HET: LLP; 2.4A {Escherichia coli} Back     alignment and structure
>2hox_A ALLIIN lyase 1; cysteine sulphoxide lyase, ALLIINASE; HET: NAG FUC BMA P1T; 1.40A {Allium sativum} SCOP: c.67.1.1 PDB: 2hor_A* 1lk9_A* Back     alignment and structure
>4a6r_A Omega transaminase; transferase, PLP-binding enzyme, transaminase fold type I; HET: TA8; 1.35A {Chromobacterium violaceum} PDB: 4a6t_A* 4a6u_A 4a72_A* 4ah3_A* Back     alignment and structure
>3pj0_A LMO0305 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology, lyase; HET: LLP MSE; 1.80A {Listeria monocytogenes} Back     alignment and structure
>3lws_A Aromatic amino acid beta-eliminating lyase/threonine aldolase; structural genomics, joint center for structural genomics, JCSG; HET: LLP MSE; 2.00A {Exiguobacterium sibiricum} Back     alignment and structure
>3tfu_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; transferase, transferase-transferase inhibitor complex; HET: PL8; 1.94A {Mycobacterium tuberculosis} PDB: 3tft_A* 3bv0_A* 3lv2_A* Back     alignment and structure
>4ffc_A 4-aminobutyrate aminotransferase (GABT); structural genomics, niaid, national institute of allergy AN infectious diseases; HET: LLP; 1.80A {Mycobacterium abscessus} Back     alignment and structure
>3k7y_A Aspartate aminotransferase; aminotrans pyridoxal phosphate; HET: PLP; 2.80A {Plasmodium falciparum} SCOP: c.67.1.0 Back     alignment and structure
>4eu1_A Mitochondrial aspartate aminotransferase; ssgcid, structural genomics, SEA structural genomics center for infectious disease; HET: LLP; 2.30A {Trypanosoma brucei} Back     alignment and structure
>3oks_A 4-aminobutyrate transaminase; ssgcid, transferase, seattle structural genomics center for infectious disease; HET: LLP; 1.80A {Mycobacterium smegmatis} PDB: 3r4t_A* 3q8n_A Back     alignment and structure
>3hmu_A Aminotransferase, class III; structural genomics, pyridoxal phosphate, PSI-2, protein structure initiative; 2.10A {Silicibacter pomeroyi} Back     alignment and structure
>2oqx_A Tryptophanase; lyase, pyridoxal phosphate, tryptophan catabolism; HET: CME EPE; 1.90A {Escherichia coli} SCOP: c.67.1.2 PDB: 2c44_A 2v1p_A* 2v0y_A* Back     alignment and structure
>3l44_A Glutamate-1-semialdehyde 2,1-aminomutase 1; alpha beta class, PLP-dependent transferase-like, bacillus A csgid, porphyrin biosynthesis; HET: LLP; 2.05A {Bacillus anthracis} SCOP: c.67.1.0 Back     alignment and structure
>2epj_A Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzyme, GSA, structural genomics, NPPSFA; HET: PMP; 1.70A {Aeropyrum pernix} PDB: 2zsl_A* 2zsm_A* Back     alignment and structure
>3i5t_A Aminotransferase; pyridoxal 5'-phosphate, PSI-2, NYSGXRC, ST genomics, protein structure initiative; HET: PLP; 2.00A {Rhodobacter sphaeroides 2} Back     alignment and structure
>3jzl_A Putative cystathionine beta-lyase involved in ALU resistance; putative cystathionine beta-lyase involved in aluminum resis structural genomics; HET: LLP; 1.91A {Listeria monocytogenes str} PDB: 3fd0_A* Back     alignment and structure
>2cy8_A D-phgat, D-phenylglycine aminotransferase; structural genomics, NPPSFA, national PROJ protein structural and functional analyses; 2.30A {Pseudomonas stutzeri} Back     alignment and structure
>3k28_A Glutamate-1-semialdehyde 2,1-aminomutase 2; biosynthesis of cofactors, prosthetic groups, and carriers, csgid, cytoplasm, isomerase; HET: MSE PLP; 1.95A {Bacillus anthracis str} SCOP: c.67.1.4 PDB: 3bs8_A* Back     alignment and structure
>1ohv_A 4-aminobutyrate aminotransferase; PLP-dependent enzyme, 4- AMIN acid, antiepileptic drug target; HET: PLP; 2.3A {Sus scrofa} SCOP: c.67.1.4 PDB: 1ohw_A* 1ohy_A* Back     alignment and structure
>4h51_A Aspartate aminotransferase; ssgcid, structural genomics, seattle struc genomics center for infectious disease, aspartate aminotran transferase; HET: LLP; 1.85A {Leishmania major} Back     alignment and structure
>3i16_A Aluminum resistance protein; YP_878183.1, carbon-sulfur lyase involved in aluminum resist structural genomics; HET: MSE TLA PLP; 2.00A {Clostridium novyi} PDB: 3gwp_A* Back     alignment and structure
>4e77_A Glutamate-1-semialdehyde 2,1-aminomutase; structural genomics, center for structural genomics of infec diseases, csgid, porphyrin biosynthesis; 2.00A {Yersinia pestis} Back     alignment and structure
>2e7u_A Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzyme, GSA, structural genomics, NPPSFA; HET: PMP; 1.90A {Thermus thermophilus} Back     alignment and structure
>3fq8_A Glutamate-1-semialdehyde 2,1-aminomutase; drug resistance, microev0lution, integrated approach, chlorophyll biosynthesis; HET: PMP; 2.00A {Synechococcus elongatus pcc 6301} SCOP: c.67.1.4 PDB: 2hp1_A* 2hoz_A* 2hoy_A* 2hp2_A* 3fq7_A* 3usf_A* 2gsa_A* 3gsb_A* 4gsa_A* 3fqa_A* 2cfb_A* Back     alignment and structure
>3hvy_A Cystathionine beta-lyase family protein, YNBB B.S ortholog; NP_348457.1, putative cystathionine beta-lyase involved in A resistance; HET: LLP MSE; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>3n75_A LDC, lysine decarboxylase, inducible; pyridoxal-5'-phosphate dependent decarboxylase, acid stress stringent response; HET: LLP G4P P6G; 2.00A {Escherichia coli} PDB: 3q16_A* Back     alignment and structure
>3ht4_A Aluminum resistance protein; lyase, putative cystathionine BEAT-lyase, aluminium resistance protein, Q81A77_baccr, NESG, BCR213; 2.90A {Bacillus cereus atcc 14579} Back     alignment and structure
>3bc8_A O-phosphoseryl-tRNA(SEC) selenium transferase; disorder-order transition, phosphate-loop, pyridoxal phospha selenocysteine synthase (SECS, sepsecs); HET: LLP; 1.65A {Mus musculus} SCOP: c.67.1.9 PDB: 3bca_A* 3bcb_A* Back     alignment and structure
>2yky_A Beta-transaminase; transferase; HET: PLP SFE; 1.69A {Mesorhizobium SP} PDB: 2ykv_A* 2yku_A* 2ykx_A* Back     alignment and structure
>3hl2_A O-phosphoseryl-tRNA(SEC) selenium transferase; selenocysteine, sepsecs, protein-RNA complex, alternative splicing, cytoplasm, protein biosynthesis, pyridoxal phosphate, selenium; HET: PLR SEP; 2.81A {Homo sapiens} Back     alignment and structure
>4atq_A 4-aminobutyrate transaminase; transferase; HET: PLP; 2.75A {Arthrobacter aurescens} PDB: 4atp_A* Back     alignment and structure
>3ou5_A Serine hydroxymethyltransferase, mitochondrial; structural genomics, STRU genomics consortium, SGC; 2.04A {Homo sapiens} Back     alignment and structure
>4ao9_A Beta-phenylalanine aminotransferase; HET: PLP; 1.50A {Variovorax paradoxus} PDB: 4aoa_A* Back     alignment and structure
>4e3q_A Pyruvate transaminase; aminotransferase, transferase; HET: PMP; 1.90A {Vibrio fluvialis} PDB: 4e3r_A* 3nui_A Back     alignment and structure
>4a0g_A Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; BIO3-BIO1, biotin synthesis; HET: PLP; 2.50A {Arabidopsis thaliana} PDB: 4a0h_A* 4a0r_A* 4a0f_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 458
d1t3ia_408 c.67.1.3 (A:) Probable cysteine desulfurase SufS { 1e-121
d1jf9a_405 c.67.1.3 (A:) NifS-like protein/selenocysteine lya 1e-118
d1p3wa_391 c.67.1.3 (A:) Cysteine desulfurase IscS {Escherich 8e-85
d1eg5a_376 c.67.1.3 (A:) NifS-like protein/selenocysteine lya 1e-73
d1qz9a_404 c.67.1.3 (A:) Kynureninase {Pseudomonas fluorescen 6e-63
d1elua_381 c.67.1.3 (A:) Cystine C-S lyase C-des {Synechocyst 4e-43
d1vjoa_377 c.67.1.3 (A:) Alanine-glyoxylate aminotransferase 9e-34
d1bjna_360 c.67.1.4 (A:) Phosphoserine aminotransferase, PSAT 3e-33
d2ch1a1388 c.67.1.3 (A:2-389) 3-hydroxykynurenine transaminas 1e-31
d1w23a_360 c.67.1.4 (A:) Phosphoserine aminotransferase, PSAT 2e-31
d2c0ra1361 c.67.1.4 (A:2-362) Phosphoserine aminotransferase, 5e-30
d2bkwa1382 c.67.1.3 (A:3-384) Alanine-glyoxylate aminotransfe 5e-30
d1h0ca_388 c.67.1.3 (A:) Alanine-glyoxylate aminotransferase 3e-27
d1m32a_361 c.67.1.3 (A:) 2-aminoethylphosphonate transaminase 3e-27
d1c4ka2462 c.67.1.5 (A:108-569) Ornithine decarboxylase major 9e-26
d2e7ja1364 c.67.1.9 (A:8-371) Selenocysteinyl-tRNA synthase ( 6e-23
d1pmma_450 c.67.1.6 (A:) Glutamate decarboxylase beta, GadB { 1e-20
d3bc8a1445 c.67.1.9 (A:23-467) Selenocysteinyl-tRNA synthase 5e-18
d2z67a1434 c.67.1.9 (A:1-434) Selenocysteinyl-tRNA synthase ( 2e-17
d1svva_340 c.67.1.1 (A:) Low-specificity threonine aldolase { 3e-15
d1wyua1437 c.67.1.7 (A:1-437) Glycine dehydrogenase (decarbox 1e-11
d1js3a_476 c.67.1.6 (A:) DOPA decarboxylase {Pig (Sus scrofa) 2e-10
d2aeua1366 c.67.1.8 (A:9-374) Hypothetical protein MJ0158 {Ar 4e-08
d1v72a1345 c.67.1.1 (A:6-350) Phenylserine aldolase PSALD {Ps 4e-07
d1mdoa_376 c.67.1.4 (A:) Aminotransferase ArnB {Salmonella ty 2e-06
d1j32a_388 c.67.1.1 (A:) Aspartate aminotransferase, AAT {Pho 3e-06
d1gdea_388 c.67.1.1 (A:) Aromatic aminoacid aminotransferase, 1e-05
d1bs0a_383 c.67.1.4 (A:) PLP-dependent acyl-CoA synthase (8-a 6e-05
d1ax4a_465 c.67.1.2 (A:) Tryptophan indol-lyase (tryptophanas 3e-04
d1fc4a_401 c.67.1.4 (A:) 2-amino-3-ketobutyrate CoA ligase {E 0.001
d2hoxa1425 c.67.1.1 (A:1-425) Alliinase {Garlic (Allium sativ 0.002
d1b5pa_382 c.67.1.1 (A:) Aspartate aminotransferase, AAT {The 0.002
d2bwna1396 c.67.1.4 (A:2-397) 5-aminolevulinate synthase {Rho 0.004
>d1t3ia_ c.67.1.3 (A:) Probable cysteine desulfurase SufS {Synechocystis sp. PCC 6803 [TaxId: 1148]} Length = 408 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: PLP-dependent transferase-like
superfamily: PLP-dependent transferases
family: Cystathionine synthase-like
domain: Probable cysteine desulfurase SufS
species: Synechocystis sp. PCC 6803 [TaxId: 1148]
 Score =  357 bits (917), Expect = e-121
 Identities = 253/404 (62%), Positives = 309/404 (76%), Gaps = 3/404 (0%)

Query: 52  RPDFPILHQEVYGSKKLVYLDNAATSQKPIAVLKALQNYYEAYNSNVHRGIHFLSAKATD 111
           R DFPIL+QE+ G   LVYLDNAATSQKP AVL+ L +YYE  N+NVHRG H LS +ATD
Sbjct: 8   RQDFPILNQEING-HPLVYLDNAATSQKPRAVLEKLMHYYENDNANVHRGAHQLSVRATD 66

Query: 112 EYELARKKVAAFINASDSGEIVFTKNATEAINLVAYSWGLSNLKSGDEVILTVAEHHSAI 171
            YE  R KVA FINA    EIV+T+NATEAINLVAYSWG++NLK+GDE+I TV EHHS +
Sbjct: 67  AYEAVRNKVAKFINARSPREIVYTRNATEAINLVAYSWGMNNLKAGDEIITTVMEHHSNL 126

Query: 172 VPWQLVAQKTGANLKFLNLNDDESPDLDKLKEMLSRKTKLVVIHHISNMLASILPIEEIV 231
           VPWQ+VA KTGA LKF+ L++ ES DL+  K +LS KTKLV + HISN L  + P EEI 
Sbjct: 127 VPWQMVAAKTGAVLKFVQLDEQESFDLEHFKTLLSEKTKLVTVVHISNTLGCVNPAEEIA 186

Query: 232 HWSHDVGAKVLVDACQSVPHMVVDVQGLDADFLVASSHKMCGPTGIGFLFGKSDLLSAMP 291
             +H  GAKVLVDACQS PH  +DVQ +D D+LVAS HKMC PTGIGFL+GK ++L AMP
Sbjct: 187 QLAHQAGAKVLVDACQSAPHYPLDVQLIDCDWLVASGHKMCAPTGIGFLYGKEEILEAMP 246

Query: 292 PFLGGGEMISDVFLDHSTFADPPSRFEAGTPAIGEAIGLGAAIDYLSTIGMQKIHAYEME 351
           PF GGGEMI++VF DH T  + P +FEAGTPAI EAI LGAA+DYL+ +GM+ IH YE+E
Sbjct: 247 PFFGGGEMIAEVFFDHFTTGELPHKFEAGTPAIAEAIALGAAVDYLTDLGMENIHNYEVE 306

Query: 352 LAKYLYENLLSIPNIRIYGPKPSEHVQRAALCSFNVENIHPTDIATLLDQQYGVATRSGH 411
           L  YL++ L  IP +R+YGP P +H  RAAL SFNV  +H +D+AT++D Q G+A RSGH
Sbjct: 307 LTHYLWQGLGQIPQLRLYGPNP-KHGDRAALASFNVAGLHASDVATMVD-QDGIAIRSGH 364

Query: 412 HCAQPLHRYLGVNASARASLHFYNTKEDVDEFIHALNETVSFFN 455
           HC QPLHR    + SARASL+FYNTKE++D F+ +L  T+ FF+
Sbjct: 365 HCTQPLHRLFDASGSARASLYFYNTKEEIDLFLQSLQATIRFFS 408


>d1jf9a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Escherichia coli [TaxId: 562]} Length = 405 Back     information, alignment and structure
>d1p3wa_ c.67.1.3 (A:) Cysteine desulfurase IscS {Escherichia coli [TaxId: 562]} Length = 391 Back     information, alignment and structure
>d1eg5a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Thermotoga maritima [TaxId: 2336]} Length = 376 Back     information, alignment and structure
>d1qz9a_ c.67.1.3 (A:) Kynureninase {Pseudomonas fluorescens [TaxId: 294]} Length = 404 Back     information, alignment and structure
>d1elua_ c.67.1.3 (A:) Cystine C-S lyase C-des {Synechocystis sp. [TaxId: 1143]} Length = 381 Back     information, alignment and structure
>d1vjoa_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Cyanobacteria (Nostoc sp. pcc 7120) [TaxId: 103690]} Length = 377 Back     information, alignment and structure
>d1bjna_ c.67.1.4 (A:) Phosphoserine aminotransferase, PSAT {Escherichia coli [TaxId: 562]} Length = 360 Back     information, alignment and structure
>d2ch1a1 c.67.1.3 (A:2-389) 3-hydroxykynurenine transaminase {Malaria mosquito (Anopheles gambiae) [TaxId: 7165]} Length = 388 Back     information, alignment and structure
>d1w23a_ c.67.1.4 (A:) Phosphoserine aminotransferase, PSAT {Bacillus alcalophilus [TaxId: 1445]} Length = 360 Back     information, alignment and structure
>d2c0ra1 c.67.1.4 (A:2-362) Phosphoserine aminotransferase, PSAT {Bacillus circulans, subsp. alkalophilus [TaxId: 1397]} Length = 361 Back     information, alignment and structure
>d2bkwa1 c.67.1.3 (A:3-384) Alanine-glyoxylate aminotransferase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 382 Back     information, alignment and structure
>d1h0ca_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1m32a_ c.67.1.3 (A:) 2-aminoethylphosphonate transaminase {Salmonella typhimurium [TaxId: 90371]} Length = 361 Back     information, alignment and structure
>d1c4ka2 c.67.1.5 (A:108-569) Ornithine decarboxylase major domain {Lactobacillus sp., strain 30a [TaxId: 1591]} Length = 462 Back     information, alignment and structure
>d2e7ja1 c.67.1.9 (A:8-371) Selenocysteinyl-tRNA synthase (SepSecS) {Archaeoglobus fulgidus [TaxId: 2234]} Length = 364 Back     information, alignment and structure
>d1pmma_ c.67.1.6 (A:) Glutamate decarboxylase beta, GadB {Escherichia coli [TaxId: 562]} Length = 450 Back     information, alignment and structure
>d3bc8a1 c.67.1.9 (A:23-467) Selenocysteinyl-tRNA synthase (SepSecS) {Mouse (Mus musculus) [TaxId: 10090]} Length = 445 Back     information, alignment and structure
>d2z67a1 c.67.1.9 (A:1-434) Selenocysteinyl-tRNA synthase (SepSecS) {Methanococcus maripaludis [TaxId: 39152]} Length = 434 Back     information, alignment and structure
>d1svva_ c.67.1.1 (A:) Low-specificity threonine aldolase {Leishmania major [TaxId: 5664]} Length = 340 Back     information, alignment and structure
>d1wyua1 c.67.1.7 (A:1-437) Glycine dehydrogenase (decarboxylating) subunit 1 {Thermus thermophilus [TaxId: 274]} Length = 437 Back     information, alignment and structure
>d1js3a_ c.67.1.6 (A:) DOPA decarboxylase {Pig (Sus scrofa) [TaxId: 9823]} Length = 476 Back     information, alignment and structure
>d2aeua1 c.67.1.8 (A:9-374) Hypothetical protein MJ0158 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 366 Back     information, alignment and structure
>d1v72a1 c.67.1.1 (A:6-350) Phenylserine aldolase PSALD {Pseudomonas putida [TaxId: 303]} Length = 345 Back     information, alignment and structure
>d1mdoa_ c.67.1.4 (A:) Aminotransferase ArnB {Salmonella typhimurium [TaxId: 90371]} Length = 376 Back     information, alignment and structure
>d1j32a_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Phormidium lapideum [TaxId: 32060]} Length = 388 Back     information, alignment and structure
>d1gdea_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 388 Back     information, alignment and structure
>d1bs0a_ c.67.1.4 (A:) PLP-dependent acyl-CoA synthase (8-amino-7-oxonanoate synthase, AONS) {Escherichia coli [TaxId: 562]} Length = 383 Back     information, alignment and structure
>d1ax4a_ c.67.1.2 (A:) Tryptophan indol-lyase (tryptophanase) {Proteus vulgaris [TaxId: 585]} Length = 465 Back     information, alignment and structure
>d1fc4a_ c.67.1.4 (A:) 2-amino-3-ketobutyrate CoA ligase {Escherichia coli [TaxId: 562]} Length = 401 Back     information, alignment and structure
>d2hoxa1 c.67.1.1 (A:1-425) Alliinase {Garlic (Allium sativum) [TaxId: 4682]} Length = 425 Back     information, alignment and structure
>d1b5pa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Thermus thermophilus [TaxId: 274]} Length = 382 Back     information, alignment and structure
>d2bwna1 c.67.1.4 (A:2-397) 5-aminolevulinate synthase {Rhodobacter capsulatus [TaxId: 1061]} Length = 396 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query458
d1t3ia_408 Probable cysteine desulfurase SufS {Synechocystis 100.0
d1jf9a_405 NifS-like protein/selenocysteine lyase {Escherichi 100.0
d1elua_381 Cystine C-S lyase C-des {Synechocystis sp. [TaxId: 100.0
d1p3wa_391 Cysteine desulfurase IscS {Escherichia coli [TaxId 100.0
d1eg5a_376 NifS-like protein/selenocysteine lyase {Thermotoga 100.0
d1qz9a_404 Kynureninase {Pseudomonas fluorescens [TaxId: 294] 100.0
d1h0ca_388 Alanine-glyoxylate aminotransferase {Human (Homo s 100.0
d1j32a_388 Aspartate aminotransferase, AAT {Phormidium lapide 100.0
d2ch1a1388 3-hydroxykynurenine transaminase {Malaria mosquito 100.0
d1m32a_361 2-aminoethylphosphonate transaminase {Salmonella t 100.0
d2bkwa1382 Alanine-glyoxylate aminotransferase {Baker's yeast 100.0
d1vjoa_377 Alanine-glyoxylate aminotransferase {Cyanobacteria 100.0
d1gdea_388 Aromatic aminoacid aminotransferase, AroAT {Archae 100.0
d1b5pa_382 Aspartate aminotransferase, AAT {Thermus thermophi 100.0
d1v2da_368 Glutamine aminotransferase {Thermus thermophilus [ 100.0
d1iuga_348 Subgroup IV putative aspartate aminotransferase {T 100.0
d1bw0a_412 Tyrosine aminotransferase (TAT) {Trypanosoma cruzi 100.0
d2e7ja1364 Selenocysteinyl-tRNA synthase (SepSecS) {Archaeogl 100.0
d1xi9a_395 Putative alanine aminotransferase {Pyrococcus furi 100.0
d1pmma_450 Glutamate decarboxylase beta, GadB {Escherichia co 100.0
d2r5ea1418 Kynurenine--oxoglutarate transaminase I {Yellowfev 99.98
d1c7na_394 Cystalysin {Treponema denticola [TaxId: 158]} 99.98
d1o4sa_375 Aspartate aminotransferase, AAT {Thermotoga mariti 99.97
d1lc5a_355 L-threonine-O-3-phosphate decarboxylase CobD {Salm 99.97
d1d2fa_361 Modulator in mal gene expression, MalY {Escherichi 99.97
d1fg7a_354 Histidinol-phosphate aminotransferase HisC {Escher 99.97
d2gb3a1389 AAT homologue TM1698 {Thermotoga maritima [TaxId: 99.97
d1vp4a_420 Putative aminotransferase TM1131 {Thermotoga marit 99.97
d1w7la_418 Kynurenine--oxoglutarate transaminase I {Human (Ho 99.97
d2f8ja1334 Histidinol-phosphate aminotransferase HisC {Thermo 99.97
d1wsta1403 Multiple substrate aminotransferase, MSAT {Thermoc 99.97
d1iaya_428 1-aminocyclopropane-1-carboxylate synthase (ACC sy 99.97
d1m7ya_431 1-aminocyclopropane-1-carboxylate synthase (ACC sy 99.97
d1u08a_382 Putative methionine aminotransferase YdbL {Escheri 99.97
d1js3a_476 DOPA decarboxylase {Pig (Sus scrofa) [TaxId: 9823] 99.96
d1bs0a_383 PLP-dependent acyl-CoA synthase (8-amino-7-oxonano 99.96
d1fc4a_401 2-amino-3-ketobutyrate CoA ligase {Escherichia col 99.95
d2c0ra1361 Phosphoserine aminotransferase, PSAT {Bacillus cir 99.95
d1w23a_360 Phosphoserine aminotransferase, PSAT {Bacillus alc 99.95
d2bwna1396 5-aminolevulinate synthase {Rhodobacter capsulatus 99.95
d1bjna_360 Phosphoserine aminotransferase, PSAT {Escherichia 99.95
d1mdoa_376 Aminotransferase ArnB {Salmonella typhimurium [Tax 99.94
d1gc0a_392 Methionine gamma-lyase, MGL {Pseudomonas putida [T 99.93
d1y4ia1397 Methionine gamma-lyase, MGL {Citrobacter freundii 99.93
d2z67a1434 Selenocysteinyl-tRNA synthase (SepSecS) {Methanoco 99.92
d7aata_401 Aspartate aminotransferase, AAT {Chicken (Gallus g 99.92
d1c4ka2462 Ornithine decarboxylase major domain {Lactobacillu 99.92
d3bc8a1445 Selenocysteinyl-tRNA synthase (SepSecS) {Mouse (Mu 99.92
d1cs1a_384 Cystathionine gamma-synthase, CGS {Escherichia col 99.92
d1qgna_398 Cystathionine gamma-synthase, CGS {Common tobacco 99.91
d1cl1a_391 Cystathionine beta-lyase, CBL {Escherichia coli [T 99.91
d2aeua1366 Hypothetical protein MJ0158 {Archaeon Methanococcu 99.91
d1v72a1345 Phenylserine aldolase PSALD {Pseudomonas putida [T 99.91
d2hoxa1425 Alliinase {Garlic (Allium sativum) [TaxId: 4682]} 99.91
d1ibja_380 Cystathionine beta-lyase, CBL {Thale cress (Arabid 99.91
d1ajsa_412 Aspartate aminotransferase, AAT {Pig (Sus scrofa), 99.9
d1pffa_331 Methionine gamma-lyase, MGL {Trichomonas vaginalis 99.9
d1e5ea_394 Methionine gamma-lyase, MGL {Trichomonas vaginalis 99.9
d3tata_397 Aromatic aminoacid aminotransferase, AroAT {Escher 99.9
d2q7wa1396 Aspartate aminotransferase, AAT {Escherichia coli 99.9
d1yaaa_412 Aspartate aminotransferase, AAT {Baker's yeast (Sa 99.9
d1b9ha_384 3-amino-5-hydroxybenzoic acid synthase (AHBA synth 99.9
d1m6sa_343 Low-specificity threonine aldolase {Thermotoga mar 99.89
d2ctza1421 O-acetyl-L-homoserine sulfhydrylase {Thermus therm 99.89
d2fnua1371 Spore coat polysaccharide biosynthesis protein C { 99.89
d1svva_340 Low-specificity threonine aldolase {Leishmania maj 99.87
d1dfoa_416 Serine hydroxymethyltransferase {Escherichia coli 99.87
d1o69a_374 Aminotransferase homolog WlaK (PglE, Cj1121c) {Cam 99.87
d1kl1a_405 Serine hydroxymethyltransferase {Bacillus stearoth 99.87
d2ay1a_394 Aromatic aminoacid aminotransferase, AroAT {Paraco 99.87
d1n8pa_393 Cystathionine gamma-lyase (CYS3) {Baker's yeast (S 99.86
d1vefa1387 Acetylornithine/acetyl-lysine aminotransferase Arg 99.85
d1wyua1437 Glycine dehydrogenase (decarboxylating) subunit 1 99.85
d1z7da1404 Ornithine aminotransferase {Plasmodium yoelii yoel 99.83
d2byla1404 Ornithine aminotransferase {Human (Homo sapiens) [ 99.83
d1sffa_425 4-aminobutyrate aminotransferase, GABA-aminotransf 99.83
d2a7va1463 Serine hydroxymethyltransferase {Human (Homo sapie 99.82
d1rv3a_470 Serine hydroxymethyltransferase {Rabbit (Oryctolag 99.82
d1c7ga_456 Tyrosine phenol-lyase {Erwinia herbicola [TaxId: 5 99.8
d2gsaa_427 Glutamate-1-semialdehyde aminomutase (aminotransfe 99.77
d1wyub1471 Glycine dehydrogenase subunit 2 (P-protein) {Therm 99.76
d1s0aa_429 Adenosylmethionine-8-amino-7-oxononanoate aminotra 99.75
d1ax4a_465 Tryptophan indol-lyase (tryptophanase) {Proteus vu 99.75
d2v1pa1467 Tryptophan indol-lyase (tryptophanase) {Escherichi 99.74
d1zoda1431 Dialkylglycine decarboxylase {Pseudomonas cepacia 99.71
d1ohwa_461 4-aminobutyrate aminotransferase, GABA-aminotransf 99.7
>d1t3ia_ c.67.1.3 (A:) Probable cysteine desulfurase SufS {Synechocystis sp. PCC 6803 [TaxId: 1148]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: PLP-dependent transferase-like
superfamily: PLP-dependent transferases
family: Cystathionine synthase-like
domain: Probable cysteine desulfurase SufS
species: Synechocystis sp. PCC 6803 [TaxId: 1148]
Probab=100.00  E-value=1.3e-58  Score=450.67  Aligned_cols=406  Identities=63%  Similarity=1.027  Sum_probs=368.6

Q ss_pred             chhhhhcCCCCcccccccCCCCeEEecCCCCCCCcHHHHHHHHHHHHHhccCCCCCcchhhhHHHHHHHHHHHHHHHHcC
Q 012718           46 SLGHITRPDFPILHQEVYGSKKLVYLDNAATSQKPIAVLKALQNYYEAYNSNVHRGIHFLSAKATDEYELARKKVAAFIN  125 (458)
Q Consensus        46 ~~~~~~r~~f~~~~~~~~~~~~~i~l~~~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~la~~~g  125 (458)
                      ++++.+|++||.+.+..+ ++++||||+++.+++|+.+++++.++++..+.|++++.+..+....+.++++|+.+|+++|
T Consensus         2 ~~~a~iR~~FP~l~~~~~-~~~~iYld~a~~~~~p~~v~~~~~~~~~~~~~n~~s~~~~~~~~~~~~~e~aR~~ia~llg   80 (408)
T d1t3ia_           2 SLAATVRQDFPILNQEIN-GHPLVYLDNAATSQKPRAVLEKLMHYYENDNANVHRGAHQLSVRATDAYEAVRNKVAKFIN   80 (408)
T ss_dssp             CHHHHHGGGCGGGSCEET-TEECEECBTTTCCCCCHHHHHHHHHHHHHTCCCC--CCSHHHHHHHHHHHHHHHHHHHHTT
T ss_pred             chHHHHHHhCcccccccC-CCCeEEeeCccccCCCHHHHHHHHHHHHhcCCCCCchhhHHHHHHHHHHHHHHHHHHHHhC
Confidence            456789999999976544 5678999999999999999999999999988888888888888888999999999999999


Q ss_pred             CCCCCcEEEeCChhHHHHHHHHHcCCCCCCCCCEEEEcCCCCccchHHHHHHHHHcCCeEEEEeCCCCCCCCHHHHHHhh
Q 012718          126 ASDSGEIVFTKNATEAINLVAYSWGLSNLKSGDEVILTVAEHHSAIVPWQLVAQKTGANLKFLNLNDDESPDLDKLKEML  205 (458)
Q Consensus       126 ~~~~~~v~~t~g~t~a~~~~~~~l~~~~~~~g~~vl~~~~~~~s~~~~~~~~a~~~g~~~~~v~~~~~~~~d~~~l~~~l  205 (458)
                      +++++.+++++++|+++++++.++....+++|++|++++.+|+++..+|...+++.|++++.+|.+.++..+.+.+++.+
T Consensus        81 a~~~~~i~~~~~tt~~~n~~~~~~~~~~~~~g~~il~s~~e~~s~~~~~~~~~~~~g~~v~~~~~~~~~~~~~~~l~~~~  160 (408)
T d1t3ia_          81 ARSPREIVYTRNATEAINLVAYSWGMNNLKAGDEIITTVMEHHSNLVPWQMVAAKTGAVLKFVQLDEQESFDLEHFKTLL  160 (408)
T ss_dssp             CSCGGGEEEESSHHHHHHHHHHHTHHHHCCTTCEEEEETTCCGGGTHHHHHHHHHHCCEEEEECBCTTSSBCHHHHHHHC
T ss_pred             CCCcccEEeecchHHHHHHHHhhccccccCCCCEEEeecccchhhhhhhhhhhhccCceEeeeeccccccccHHHhhhcc
Confidence            98766899999999999999877432247899999999999999999999999999999999999989999999999999


Q ss_pred             cCCceEEEEecccCcCcccccHHHHHHHHHhcCcEEEEeccccCCcccCCCCCCCCcEEEecccCCCCCCceeEEEEecc
Q 012718          206 SRKTKLVVIHHISNMLASILPIEEIVHWSHDVGAKVLVDACQSVPHMVVDVQGLDADFLVASSHKMCGPTGIGFLFGKSD  285 (458)
Q Consensus       206 ~~~~~~v~~~~~~n~tG~~~~l~~i~~l~~~~~~~vivD~a~~~g~~~~~~~~~~~d~~~~s~~K~~gp~g~G~l~~~~~  285 (458)
                      ++++++|++++.+|.||.+.|+++|.++||++|+++++|++|++|..++|+.++++|++++|+||++||.|+|+++++++
T Consensus       161 ~~~t~lv~i~~~~~~tG~~~p~~~i~~~~~~~g~~~ivDa~q~~g~~~id~~~~~~D~~~~s~hK~~gp~G~g~l~v~~~  240 (408)
T d1t3ia_         161 SEKTKLVTVVHISNTLGCVNPAEEIAQLAHQAGAKVLVDACQSAPHYPLDVQLIDCDWLVASGHKMCAPTGIGFLYGKEE  240 (408)
T ss_dssp             CTTEEEEEEESBCTTTCBBCCHHHHHHHHHHTTCEEEEECTTTTTTSCCCHHHHTCSEEEEEGGGTTSCTTCEEEEECHH
T ss_pred             CCCceEEEEecccccccccCcHHHHhhhhhccCceeeeccceecccccccccccCCceEEeccccccCCCCccccccchh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccccCCCccccCcceEeeecCCCCCCCCCCccCCCCCCHHHHHHHHHHHHHHHHhCHHHHHHHHHHHHHHHHHHHhcCCC
Q 012718          286 LLSAMPPFLGGGEMISDVFLDHSTFADPPSRFEAGTPAIGEAIGLGAAIDYLSTIGMQKIHAYEMELAKYLYENLLSIPN  365 (458)
Q Consensus       286 ~~~~l~~~~~g~~~~~~~~~~~~~~~~~~~~~~~gt~~~~~~~~l~~al~~~~~~g~~~~~~~~~~l~~~l~~~L~~~~~  365 (458)
                      ....+++...||............+...+.+|+.||+++..++++..+++++.+.|++++.++..++.+++.+.+.+.++
T Consensus       241 ~~~~~~p~~~g~~~~~~~~~~~~~~~~~~~r~e~Gt~~~~~~~~l~~al~~~~~~g~~~i~~~~~~l~~~l~~~~~~~~~  320 (408)
T d1t3ia_         241 ILEAMPPFFGGGEMIAEVFFDHFTTGELPHKFEAGTPAIAEAIALGAAVDYLTDLGMENIHNYEVELTHYLWQGLGQIPQ  320 (408)
T ss_dssp             HHHHSCCCSCSTTSEEEECSSCEEECCTTGGGCCSSCCHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHTCTT
T ss_pred             hhhcCCceecCCcccccccccccccCCchhhhcCCcHHHHHHHHHHHHHHHHHHcCHHHHHHHHHHHHhHHhhhhccCcc
Confidence            98888888888877665555555667778899999999999999999999999999999999999999999999999999


Q ss_pred             EEEeCCCCCCcCccccEEEEEeCCCChHHHHHHHhhhcCeEeccCCCCChhhHhhcCCCCeEEEeeCCCCCHHHHHHHHH
Q 012718          366 IRIYGPKPSEHVQRAALCSFNVENIHPTDIATLLDQQYGVATRSGHHCAQPLHRYLGVNASARASLHFYNTKEDVDEFIH  445 (458)
Q Consensus       366 ~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~~~l~~~~gi~~~~g~~~~~~~~~~~g~~~~lRis~~~~~t~~di~~l~~  445 (458)
                      +.+..+.+. ...+.++++|.+++.+..++.+.|.++ ||.++.|++|..+.+..++.++++|||+++|||.+|||++++
T Consensus       321 ~~~~~~~~~-~~~~~~iv~f~~~~~~~~~v~~~L~~~-gI~v~~G~~c~~~~~~~~~~~g~vRiS~~~ynt~~did~li~  398 (408)
T d1t3ia_         321 LRLYGPNPK-HGDRAALASFNVAGLHASDVATMVDQD-GIAIRSGHHCTQPLHRLFDASGSARASLYFYNTKEEIDLFLQ  398 (408)
T ss_dssp             EEEESCCGG-GSCBCSEEEEEETTBCHHHHHHHHHTT-TEECBCSCTTCHHHHHHTTCCCCEEEECCTTCCHHHHHHHHH
T ss_pred             ccccCCCcc-ccCcceEEEEEeCCCCHHHHHHHHhhC-CcEEecCcccccHHHHhhcCCccEEEECCCCCCHHHHHHHHH
Confidence            999876542 135678999999999999999999887 999999999999988888889999999999999999999999


Q ss_pred             HHHHHHHhh
Q 012718          446 ALNETVSFF  454 (458)
Q Consensus       446 ~l~~~~~~~  454 (458)
                      .|+++++.+
T Consensus       399 ~L~~~~~~f  407 (408)
T d1t3ia_         399 SLQATIRFF  407 (408)
T ss_dssp             HHHHHHHHT
T ss_pred             HHHHHHHHh
Confidence            999999865



>d1jf9a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1elua_ c.67.1.3 (A:) Cystine C-S lyase C-des {Synechocystis sp. [TaxId: 1143]} Back     information, alignment and structure
>d1p3wa_ c.67.1.3 (A:) Cysteine desulfurase IscS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1eg5a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qz9a_ c.67.1.3 (A:) Kynureninase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1h0ca_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j32a_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d2ch1a1 c.67.1.3 (A:2-389) 3-hydroxykynurenine transaminase {Malaria mosquito (Anopheles gambiae) [TaxId: 7165]} Back     information, alignment and structure
>d1m32a_ c.67.1.3 (A:) 2-aminoethylphosphonate transaminase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2bkwa1 c.67.1.3 (A:3-384) Alanine-glyoxylate aminotransferase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vjoa_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Cyanobacteria (Nostoc sp. pcc 7120) [TaxId: 103690]} Back     information, alignment and structure
>d1gdea_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1b5pa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1v2da_ c.67.1.1 (A:) Glutamine aminotransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1iuga_ c.67.1.3 (A:) Subgroup IV putative aspartate aminotransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1bw0a_ c.67.1.1 (A:) Tyrosine aminotransferase (TAT) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2e7ja1 c.67.1.9 (A:8-371) Selenocysteinyl-tRNA synthase (SepSecS) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1xi9a_ c.67.1.1 (A:) Putative alanine aminotransferase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1pmma_ c.67.1.6 (A:) Glutamate decarboxylase beta, GadB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2r5ea1 c.67.1.1 (A:12-429) Kynurenine--oxoglutarate transaminase I {Yellowfever mosquito (Aedes aegypti) [TaxId: 7159]} Back     information, alignment and structure
>d1c7na_ c.67.1.3 (A:) Cystalysin {Treponema denticola [TaxId: 158]} Back     information, alignment and structure
>d1o4sa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1lc5a_ c.67.1.1 (A:) L-threonine-O-3-phosphate decarboxylase CobD {Salmonella enterica [TaxId: 28901]} Back     information, alignment and structure
>d1d2fa_ c.67.1.3 (A:) Modulator in mal gene expression, MalY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fg7a_ c.67.1.1 (A:) Histidinol-phosphate aminotransferase HisC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gb3a1 c.67.1.1 (A:4-392) AAT homologue TM1698 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vp4a_ c.67.1.1 (A:) Putative aminotransferase TM1131 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1w7la_ c.67.1.1 (A:) Kynurenine--oxoglutarate transaminase I {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f8ja1 c.67.1.1 (A:1-334) Histidinol-phosphate aminotransferase HisC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wsta1 c.67.1.1 (A:13-415) Multiple substrate aminotransferase, MSAT {Thermococcus profundus [TaxId: 49899]} Back     information, alignment and structure
>d1iaya_ c.67.1.4 (A:) 1-aminocyclopropane-1-carboxylate synthase (ACC synthase) {Tomato (Lycopersicon esculentum) [TaxId: 4081]} Back     information, alignment and structure
>d1m7ya_ c.67.1.4 (A:) 1-aminocyclopropane-1-carboxylate synthase (ACC synthase) {Apple (Malus domestica) [TaxId: 3750]} Back     information, alignment and structure
>d1u08a_ c.67.1.1 (A:) Putative methionine aminotransferase YdbL {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1js3a_ c.67.1.6 (A:) DOPA decarboxylase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1bs0a_ c.67.1.4 (A:) PLP-dependent acyl-CoA synthase (8-amino-7-oxonanoate synthase, AONS) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fc4a_ c.67.1.4 (A:) 2-amino-3-ketobutyrate CoA ligase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2c0ra1 c.67.1.4 (A:2-362) Phosphoserine aminotransferase, PSAT {Bacillus circulans, subsp. alkalophilus [TaxId: 1397]} Back     information, alignment and structure
>d1w23a_ c.67.1.4 (A:) Phosphoserine aminotransferase, PSAT {Bacillus alcalophilus [TaxId: 1445]} Back     information, alignment and structure
>d2bwna1 c.67.1.4 (A:2-397) 5-aminolevulinate synthase {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1bjna_ c.67.1.4 (A:) Phosphoserine aminotransferase, PSAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mdoa_ c.67.1.4 (A:) Aminotransferase ArnB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1gc0a_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1y4ia1 c.67.1.3 (A:2-398) Methionine gamma-lyase, MGL {Citrobacter freundii [TaxId: 546]} Back     information, alignment and structure
>d2z67a1 c.67.1.9 (A:1-434) Selenocysteinyl-tRNA synthase (SepSecS) {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d7aata_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Chicken (Gallus gallus), mitochondria [TaxId: 9031]} Back     information, alignment and structure
>d1c4ka2 c.67.1.5 (A:108-569) Ornithine decarboxylase major domain {Lactobacillus sp., strain 30a [TaxId: 1591]} Back     information, alignment and structure
>d3bc8a1 c.67.1.9 (A:23-467) Selenocysteinyl-tRNA synthase (SepSecS) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cs1a_ c.67.1.3 (A:) Cystathionine gamma-synthase, CGS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qgna_ c.67.1.3 (A:) Cystathionine gamma-synthase, CGS {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1cl1a_ c.67.1.3 (A:) Cystathionine beta-lyase, CBL {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2aeua1 c.67.1.8 (A:9-374) Hypothetical protein MJ0158 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1v72a1 c.67.1.1 (A:6-350) Phenylserine aldolase PSALD {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2hoxa1 c.67.1.1 (A:1-425) Alliinase {Garlic (Allium sativum) [TaxId: 4682]} Back     information, alignment and structure
>d1ibja_ c.67.1.3 (A:) Cystathionine beta-lyase, CBL {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ajsa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Pig (Sus scrofa), cytosolic form [TaxId: 9823]} Back     information, alignment and structure
>d1pffa_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Trichomonas vaginalis, MGL2 [TaxId: 5722]} Back     information, alignment and structure
>d1e5ea_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Trichomonas vaginalis, MGL1 [TaxId: 5722]} Back     information, alignment and structure
>d3tata_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2q7wa1 c.67.1.1 (A:1-396) Aspartate aminotransferase, AAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yaaa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Baker's yeast (Saccharomyces cerevisiae), cytosolic form [TaxId: 4932]} Back     information, alignment and structure
>d1b9ha_ c.67.1.4 (A:) 3-amino-5-hydroxybenzoic acid synthase (AHBA synthase) {Amycolatopsis mediterranei [TaxId: 33910]} Back     information, alignment and structure
>d1m6sa_ c.67.1.1 (A:) Low-specificity threonine aldolase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2ctza1 c.67.1.3 (A:1-421) O-acetyl-L-homoserine sulfhydrylase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2fnua1 c.67.1.4 (A:2-372) Spore coat polysaccharide biosynthesis protein C {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1svva_ c.67.1.1 (A:) Low-specificity threonine aldolase {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1dfoa_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o69a_ c.67.1.4 (A:) Aminotransferase homolog WlaK (PglE, Cj1121c) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1kl1a_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2ay1a_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1n8pa_ c.67.1.3 (A:) Cystathionine gamma-lyase (CYS3) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vefa1 c.67.1.4 (A:9-395) Acetylornithine/acetyl-lysine aminotransferase ArgD {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wyua1 c.67.1.7 (A:1-437) Glycine dehydrogenase (decarboxylating) subunit 1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1z7da1 c.67.1.4 (A:7-410) Ornithine aminotransferase {Plasmodium yoelii yoelii [TaxId: 73239]} Back     information, alignment and structure
>d2byla1 c.67.1.4 (A:36-439) Ornithine aminotransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sffa_ c.67.1.4 (A:) 4-aminobutyrate aminotransferase, GABA-aminotransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a7va1 c.67.1.4 (A:26-488) Serine hydroxymethyltransferase {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Back     information, alignment and structure
>d1rv3a_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1c7ga_ c.67.1.2 (A:) Tyrosine phenol-lyase {Erwinia herbicola [TaxId: 549]} Back     information, alignment and structure
>d2gsaa_ c.67.1.4 (A:) Glutamate-1-semialdehyde aminomutase (aminotransferase) {Synechococcus sp., strain GR6 [TaxId: 1131]} Back     information, alignment and structure
>d1wyub1 c.67.1.7 (B:2-472) Glycine dehydrogenase subunit 2 (P-protein) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1s0aa_ c.67.1.4 (A:) Adenosylmethionine-8-amino-7-oxononanoate aminotransferase, BioA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ax4a_ c.67.1.2 (A:) Tryptophan indol-lyase (tryptophanase) {Proteus vulgaris [TaxId: 585]} Back     information, alignment and structure
>d2v1pa1 c.67.1.2 (A:5-471) Tryptophan indol-lyase (tryptophanase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zoda1 c.67.1.4 (A:3-433) Dialkylglycine decarboxylase {Pseudomonas cepacia [TaxId: 292]} Back     information, alignment and structure
>d1ohwa_ c.67.1.4 (A:) 4-aminobutyrate aminotransferase, GABA-aminotransferase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure