Citrus Sinensis ID: 012815

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450------
MNPSAARVSRDSSSVCVCLFHSNSRPSSFLGINNNTISFNKTNTNTLLLNTATNPGTINRTRVYRKNSTGVEACLSPAKSLRQILELPGVHQGPACFDALSAKLVEKSGFSFCFTSGFSISAARLALPDTGFISYGEMVDQGQLITQAVSIPVIGDGDNGYGNAMNVKRTVKGYIKAGFAGIILEDQVSPKGCGHTRGRKVVSREEAVMRIKAAVDARKESGSDIVIVARTDSRQALSLEESLRRSRAFADAGADVLFIDALASKEEMKAFCEISPLVPKMANMLEGGGKTPILNPLELEELGFKLVAYPLSLIGVSVRAMQDALTAIKGGRIPSPGSMPSFQEIKETLGFNTYYEEEKRYATSMRRLSSENGGSRDAFSGIWSRTLRVKITGRDGFEKLDVRIPAGFLDGITNVVPALGGVNLKELLNDAAEEVGGKLLLDFTDTVGDRIQVFLE
ccccccEEccccccEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccEEccccccHHHHHHHHHHcccEEEEccHHHHHHHccccccccccHHHHHHHHHHHHHcccccEEEEcccccccHHHHHHHHHHHHHHccEEEEEcccccccccccccccccccHHHHHHHHHHHHHHHHHccccEEEEEcccccccccHHHHHHHHHHHHHccccEEEccccccHHHHHHHHHHcccccEEEEEcccccccccccHHHHHHccccEEEEcHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHccHHHHHHHHHHHccccccccccccccccccccccccEEEEEEEcccccccccccccccccccccHHccccccccHHHHHHHHHHccccEEEEEcccccccEEEEEEc
ccccHcEEcccccEEEEEEEccccccccccEcccccEEcccccEEEEcccccccccccccEEEEccccccccccccHHHHHHHHHHcccccEEccHHcHHHHHHHHHccccEEEEcHHHHHHHHccccccccccHHHHHHHHHHHHHHccccEEEEcccccccHHHHHHHHHHHHHHcccEEEEEcEcccccccccccccEccHHHHHHHHHHHHHHcccccccEEEEEEcHHHHHHHHHHHHHHHHHHHHHcccEEcHHHHHcHHHHHHHHHHHccccEEEEccccccccccccHHHHHHccccEEEEcHHHHHHHHHHHHHHHHHHHccccccHccHccHHHHHHHHcccHHHHHHHHHHHHHHHHcccccccccccccccEEEEEEEEEcccccEEEcEEccccHHHHHHHHHHHHHHHcHHHHHHccccccccEEEEEcccccccEEEEEEc
mnpsaarvsrdsssVCVClfhsnsrpssflginnntisfnkTNTNTLLlntatnpgtinrtrvyrknstgveaclspaKSLRQIlelpgvhqgpaCFDALSAKLVeksgfsfcftsgfsisaarlalpdtgfisygemvdqgqlitqavsipvigdgdngygnamNVKRTVKGYIKAGFagiiledqvspkgcghtrgrkvvsREEAVMRIKAAVDARKESGSDIVIVARTDSRQALSLEESLRRSRAFADAGADVLFIDALASKEEMKAFCEISPLVPKMANmlegggktpilnpleleELGFKLVAYPLSLIGVSVRAMQDALTAikggripspgsmpsFQEIKETLGFNTYYEEEKRYATSMRRlssenggsrdafsgiWSRTLRVKItgrdgfekldvripagfldgitnvvpalggvnLKELLNDAAEEVGGKLLLDFTDTVGDRIQVFLE
mnpsaarvsrdsssVCVCLFHSnsrpssflgiNNNTISFNKTNTNTLLlntatnpgtinrtrvyrKNSTGVEACLSPAKSLRQILELPGVHQGPACFDALSAKLVEKSGFSFCFTSGFSISAARLALPDTGFISYGEMVDQGQLITQAVSIPVIGDGDNGYGNAMNVKRTVKGYIKAGFAGIiledqvspkgcghtrgrkvvsreeaVMRIKAavdarkesgsdivivartdsrqalslEESLRRSRAFADAGADVLFIDALASKEEMKAFCEISPLVPKMANMLEGGGKTPILNPLELEELGFKLVAYPLSLIGVSVRAMQDALTAIKggripspgsmpSFQEIKETLGFNTYYEEEKRYATSmrrlssenggsrdafsgiwsrtlrvkitgrdgfekLDVRIPAGFLDGITNVVPALGGVNLKELLNDAAEEVGGKLLLDFTDTVGDRIQVFLE
MNPsaarvsrdsssvcvcLFHSNSRPSSFLGINNNTISFnktntntlllntatnPGTINRTRVYRKNSTGVEACLSPAKSLRQILELPGVHQGPACFDALSAKLVEKsgfsfcftsgfsisAARLALPDTGFISYGEMVDQGQLITQAVSIPVIGDGDNGYGNAMNVKRTVKGYIKAGFAGIILEDQVSPKGCGHTRGRKVVSREEAVMRIKAAVDARKESGSDIVIVARTDSRQALSLEESLRRSRAFADAGADVLFIDALASKEEMKAFCEISPLVPKMANMLEGGGKTPILNPLELEELGFKLVAYPLSLIGVSVRAMQDALTAIKGGRIPSPGSMPSFQEIKETLGFNTYYEEEKRYATSMRRLSSENGGSRDAFSGIWSRTLRVKITGRDGFEKLDVRIPAGFLDGITNVVPALGGVNLKELLNDAAEEVGGKLLLDFTDTVGDRIQVFLE
**************VCVCLFHSNSRPSSFLGINNNTISFNKTNTNTLLLNTATNPGTINRTRVYRKNSTGVEACLSPAKSLRQILELPGVHQGPACFDALSAKLVEKSGFSFCFTSGFSISAARLALPDTGFISYGEMVDQGQLITQAVSIPVIGDGDNGYGNAMNVKRTVKGYIKAGFAGIILEDQVSPKGCGHTRGRKVV****AVMRIKA***********IVIVA******************AFADAGADVLFIDALASKEEMKAFCEISPLVPKMANMLEGGGKTPILNPLELEELGFKLVAYPLSLIGVSVRAMQDALTAIKG***************KETLGFNTYYE*********************AFSGIWSRTLRVKITGRDGFEKLDVRIPAGFLDGITNVVPALGGVNLKELLNDAAEEVGGKLLLDFTDTVGDRIQVF**
***********SSSVCVCLF***************************************************************ILELPGVHQGPACFDALSAKLVEKSGFSFCFTSGFSISAARLALPDTGFISYGEMVDQGQLITQAVSIPVIGDGDNGYGNAMNVKRTVKGYIKAGFAGIILEDQVSPKGCGHTRGRKVVSREEAVMRIKAAVDARKESGSDIVIVARTDSRQALSLEESLRRSRAFADAGADVLFIDALASKEEMKAFCEISPLVPKMANMLEGGGKTPILNPLELEELGFKLVAYPLSLIGVSVRAMQDALTAIK**********PSFQEIKETLGFNTYYEEEKR****************************VKITGRDGFEKLDVRIPAGFLDGITNVVPALGGVNLKELLND****VGGKLLLDFTDTVGDRIQVFLE
*************SVCVCLFHSNSRPSSFLGINNNTISFNKTNTNTLLLNTATNPGTINRTRVYRKNSTGVEACLSPAKSLRQILELPGVHQGPACFDALSAKLVEKSGFSFCFTSGFSISAARLALPDTGFISYGEMVDQGQLITQAVSIPVIGDGDNGYGNAMNVKRTVKGYIKAGFAGIILEDQVSPKGCGHTRGRKVVSREEAVMRIKAAVDARKESGSDIVIVARTDSRQALSLEESLRRSRAFADAGADVLFIDALASKEEMKAFCEISPLVPKMANMLEGGGKTPILNPLELEELGFKLVAYPLSLIGVSVRAMQDALTAIKGGRIPSPGSMPSFQEIKETLGFNTYYEEEKRYATSMRRLSSENGGSRDAFSGIWSRTLRVKITGRDGFEKLDVRIPAGFLDGITNVVPALGGVNLKELLNDAAEEVGGKLLLDFTDTVGDRIQVFLE
*******VSRDSSSVCVCLFHSNSRPSSFLGINNNTISFNKTNTNTLLLNTATNPGTINRTRVYRKN*******LSPAKSLRQILELPGVHQGPACFDALSAKLVEKSGFSFCFTSGFSISAARLALPDTGFISYGEMVDQGQLITQAVSIPVIGDGDNGYGNAMNVKRTVKGYIKAGFAGIILEDQVSPKGCGHTRGRKVVSREEAVMRIKAAVDARKESGSDIVIVARTDSRQALSLEESLRRSRAFADAGADVLFIDALASKEEMKAFCEISPLVPKMANMLEGGGKTPILNPLELEELGFKLVAYPLSLIGVSVRAMQDALTAIKGGRIPSPGSMPSFQEIKETLGFNTYYEEEKRYATSMRRLSSENGGSRDAFSGIWSRTLRVKITGRDGFEKLDVRIPAGFLDGITNVVPALGGVNLKELLNDAAEEVGGKLLLDFTDTVGDRIQVFLE
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNPSAARVSRDSSSVCVCLFHSNSRPSSFLGINNNTISFNKTNTNTLLLNTATNPGTINRTRVYRKNSTGVEACLSPAKSLRQILELPGVHQGPACFDALSAKLVEKSGFSFCFTSGFSISAARLALPDTGFISYGEMVDQGQLITQAVSIPVIGDGDNGYGNAMNVKRTVKGYIKAGFAGIILEDQVSPKGCGHTRGRKVVSREEAVMRIKAAVDARKESGSDIVIVARTDSRQALSLEESLRRSRAFADAGADVLFIDALASKEEMKAFCEISPLVPKMANMLEGGGKTPILNPLELEELGFKLVAYPLSLIGVSVRAMQDALTAIKGGRIPSPGSMPSFQEIKETLGFNTYYEEEKRYATSMRRLSSENGGSRDAFSGIWSRTLRVKITGRDGFEKLDVRIPAGFLDGITNVVPALGGVNLKELLNDAAEEVGGKLLLDFTDTVGDRIQVFLE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query456 2.2.26 [Sep-21-2011]
Q0QLE4289 2,3-dimethylmalate lyase N/A no 0.625 0.986 0.419 2e-58
P11435295 Carboxyvinyl-carboxyphosp yes no 0.620 0.959 0.387 1e-51
O49290339 Carboxyvinyl-carboxyphosp no no 0.605 0.814 0.389 7e-50
Q05957318 Petal death protein OS=Di N/A no 0.605 0.867 0.400 5e-46
Q9YFM7308 Methylisocitrate lyase OS yes no 0.642 0.951 0.350 8e-44
Q9Z9T7300 Methylisocitrate lyase OS yes no 0.616 0.936 0.337 4e-41
P54528301 Methylisocitrate lyase OS yes no 0.616 0.933 0.324 8e-41
Q8NSL2307 Probable methylisocitrate yes no 0.574 0.853 0.360 3e-39
Q8NSH8305 Probable methylisocitrate no no 0.541 0.809 0.370 5e-39
P77541296 Methylisocitrate lyase OS N/A no 0.609 0.939 0.343 1e-36
>sp|Q0QLE4|DML_EUBBA 2,3-dimethylmalate lyase OS=Eubacterium barkeri GN=Dml PE=1 SV=1 Back     alignment and function desciption
 Score =  227 bits (578), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 122/291 (41%), Positives = 177/291 (60%), Gaps = 6/291 (2%)

Query: 75  LSPAKSLRQILELPGVHQGPACFDALSAKLVEKSGFSFCFTSGFSISAARLALPDTGFIS 134
           ++ A  +R++L    +   P   DA++AK++ + GF   + +G+  SA+ L  PD G ++
Sbjct: 1   MNTAAKMRELLSTKKMVVAPGAHDAMTAKVIGRLGFDAVYMTGYGQSASHLGQPDVGLLT 60

Query: 135 YGEMVDQGQLITQAVSIPVIGDGDNGYGNAMNVKRTVKGYIKAGFAGIILEDQVSPKGCG 194
             EMV +   I +A  +PVI D D G+GNA+NV RTV+ Y KAG A I LEDQV PK CG
Sbjct: 61  MTEMVARANAIVEAAGVPVIADADTGFGNAVNVMRTVREYEKAGVAVIQLEDQVMPKKCG 120

Query: 195 HTRGRKVVSREEAVMRIKAAVDARKESGSDIVIVARTDSRQALSLEESLRRSRAFADAGA 254
           H  GR++VS+EE V +IKAAVD R     D +I+ARTD+R    ++E+L R  A+ +AGA
Sbjct: 121 HMVGREIVSKEEMVGKIKAAVDTR--VNPDFMIMARTDARTTKGIDEALERGLAYKEAGA 178

Query: 255 DVLFIDALASKEEMKAFCEISPLVPKMANMLEGGGKTPILNPLELEELGFKLVAYPLSLI 314
           D++FI++   +EEMK   E  P    +ANM+E GG+TP+L   ELE LG+ +  YP + I
Sbjct: 179 DIIFIESPEGEEEMKRINETIPGY-TLANMVE-GGRTPLLKNAELEALGYNITIYPTASI 236

Query: 315 GVSVRAMQDALTAIKGGRIPS--PGSMPSFQEIKETLGFNTYYEEEKRYAT 363
            V+ +AM D  TA+K     +    +M +F E  + +G     E E  YAT
Sbjct: 237 YVATKAMVDLWTALKNDDTTAGVMDTMVTFSEFNDLMGLEKIREVEHNYAT 287
Catalyzes the formation of proponate and pyruvate from (2R,3S)-2,3-dimethylmalate. Has no activity toward dimethylmaleate, malate, citramalate, isocitrate and citrate.
Eubacterium barkeri (taxid: 1528)
EC: 4EC: .EC: 1EC: .EC: 3EC: .EC: 3EC: 2
>sp|P11435|CPPM_STRHY Carboxyvinyl-carboxyphosphonate phosphorylmutase OS=Streptomyces hygroscopicus GN=bcpA PE=1 SV=3 Back     alignment and function description
>sp|O49290|CPPM_ARATH Carboxyvinyl-carboxyphosphonate phosphorylmutase, chloroplastic OS=Arabidopsis thaliana GN=At1g77060 PE=1 SV=2 Back     alignment and function description
>sp|Q05957|PDP_DIACA Petal death protein OS=Dianthus caryophyllus GN=PDP PE=1 SV=1 Back     alignment and function description
>sp|Q9YFM7|PRPB_AERPE Methylisocitrate lyase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=prpB PE=3 SV=2 Back     alignment and function description
>sp|Q9Z9T7|PRPB_BACHD Methylisocitrate lyase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=prpB PE=3 SV=1 Back     alignment and function description
>sp|P54528|PRPB_BACSU Methylisocitrate lyase OS=Bacillus subtilis (strain 168) GN=prpB PE=3 SV=1 Back     alignment and function description
>sp|Q8NSL2|PRPB2_CORGL Probable methylisocitrate lyase 2 OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=prpB2 PE=3 SV=1 Back     alignment and function description
>sp|Q8NSH8|PRPB1_CORGL Probable methylisocitrate lyase 1 OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=prpB1 PE=3 SV=1 Back     alignment and function description
>sp|P77541|PRPB_ECOLI Methylisocitrate lyase OS=Escherichia coli (strain K12) GN=prpB PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query456
449468764496 PREDICTED: 2,3-dimethylmalate lyase-like 0.835 0.768 0.761 0.0
224065022504 predicted protein [Populus trichocarpa] 0.927 0.839 0.710 0.0
217074714437 unknown [Medicago truncatula] gi|3884969 0.828 0.864 0.820 0.0
356527461466 PREDICTED: 2,3-dimethylmalate lyase-like 0.842 0.824 0.746 0.0
225433752505 PREDICTED: 2,3-dimethylmalate lyase [Vit 0.835 0.754 0.75 0.0
297745157449 unnamed protein product [Vitis vinifera] 0.835 0.848 0.75 0.0
357501473467 Isocitrate lyase [Medicago truncatula] g 0.828 0.809 0.760 1e-180
124360683478 Isocitrate lyase and phosphorylmutase [M 0.828 0.790 0.742 1e-179
356569107382 PREDICTED: 2,3-dimethylmalate lyase-like 0.837 1.0 0.772 1e-177
356569109424 PREDICTED: 2,3-dimethylmalate lyase-like 0.837 0.900 0.698 1e-172
>gi|449468764|ref|XP_004152091.1| PREDICTED: 2,3-dimethylmalate lyase-like [Cucumis sativus] Back     alignment and taxonomy information
 Score =  656 bits (1693), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/420 (76%), Positives = 365/420 (86%), Gaps = 39/420 (9%)

Query: 76  SPAKSLRQILELPGVHQGPACFDALSAKLVEKSGFSFCFTSGFSISAARLALPDTGFISY 135
           SPAK+LR+ILE+PGVHQGPACFDALSAKLVE++GF +CFTSGFSISAARLALPDTG++SY
Sbjct: 77  SPAKALRRILEMPGVHQGPACFDALSAKLVERAGFLYCFTSGFSISAARLALPDTGYMSY 136

Query: 136 GEMVDQGQLITQAVSIPVIGDGDNGYGNAMNVKRTVKGYIKAGFAGIILEDQVSPKGCGH 195
           GEM+DQGQLITQ+VSIPVIGDGDNGYGNAMNVKRTVKGYI+AGFAGIILEDQVSPK CGH
Sbjct: 137 GEMLDQGQLITQSVSIPVIGDGDNGYGNAMNVKRTVKGYIRAGFAGIILEDQVSPKACGH 196

Query: 196 TRGRKVVSREEAVMRIKAAVDARKESGSDIVIVARTDSRQALSLEESLRRSRAFADAGAD 255
           T+GRKVVSREEAV+RIKAAVDARKESGSDIVIVARTDSRQA+SL ESLRR+RAFADAGAD
Sbjct: 197 TQGRKVVSREEAVLRIKAAVDARKESGSDIVIVARTDSRQAVSLSESLRRARAFADAGAD 256

Query: 256 VLFIDALASKEEMKAFCEISPLVPKMANMLEGGGKTPILNPLELEELGFKLVAYPLSLIG 315
           VLFIDALASK+EM+AFC+ISP VPKMANMLEGGGKTPILNPLELEE+GFK+VAYPLSL+G
Sbjct: 257 VLFIDALASKDEMEAFCKISPKVPKMANMLEGGGKTPILNPLELEEMGFKIVAYPLSLVG 316

Query: 316 VSVRAMQDALTAIKGGRIPSPGSMPSFQEIKETLGFNTYYEEEKRYATSM---------- 365
           VS+RAMQDAL AIKGGR+PSPG++P+F E+KE LGFN+YYEEE++YA+++          
Sbjct: 317 VSIRAMQDALLAIKGGRLPSPGTLPTFAEMKELLGFNSYYEEERKYASAVSQPSIKVDSS 376

Query: 366 -----RRL------------------------SSENGGSRDAFSGIWSRTLRVKITGRDG 396
                RR+                        S ++ GSR  FSGIWSR LRVKITGRDG
Sbjct: 377 ITSLQRRVEDDKEKGQGSQGPAVEVITPEIYRSYDDDGSRGPFSGIWSRRLRVKITGRDG 436

Query: 397 FEKLDVRIPAGFLDGITNVVPALGGVNLKELLNDAAEEVGGKLLLDFTDTVGDRIQVFLE 456
           FE+LDVRIPAGFL+G+TN+VPALGGVN+KEL++DAA EVGGK LLDF D +GDRI+VFLE
Sbjct: 437 FERLDVRIPAGFLEGLTNIVPALGGVNIKELMDDAAGEVGGKQLLDFVDGMGDRIEVFLE 496

Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224065022|ref|XP_002301634.1| predicted protein [Populus trichocarpa] gi|222843360|gb|EEE80907.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|217074714|gb|ACJ85717.1| unknown [Medicago truncatula] gi|388496916|gb|AFK36524.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|356527461|ref|XP_003532329.1| PREDICTED: 2,3-dimethylmalate lyase-like [Glycine max] Back     alignment and taxonomy information
>gi|225433752|ref|XP_002267641.1| PREDICTED: 2,3-dimethylmalate lyase [Vitis vinifera] Back     alignment and taxonomy information
>gi|297745157|emb|CBI39149.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|357501473|ref|XP_003621025.1| Isocitrate lyase [Medicago truncatula] gi|355496040|gb|AES77243.1| Isocitrate lyase [Medicago truncatula] Back     alignment and taxonomy information
>gi|124360683|gb|ABN08672.1| Isocitrate lyase and phosphorylmutase [Medicago truncatula] Back     alignment and taxonomy information
>gi|356569107|ref|XP_003552747.1| PREDICTED: 2,3-dimethylmalate lyase-like isoform 1 [Glycine max] Back     alignment and taxonomy information
>gi|356569109|ref|XP_003552748.1| PREDICTED: 2,3-dimethylmalate lyase-like isoform 2 [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query456
TAIR|locus:2041006479 AT2G43180 [Arabidopsis thalian 0.686 0.653 0.687 8.9e-143
UNIPROTKB|Q0QLE4289 Dml "2,3-dimethylmalate lyase" 0.625 0.986 0.405 1.9e-51
ASPGD|ASPL0000059587454 AN9369 [Emericella nidulans (t 0.563 0.566 0.416 8.5e-49
TAIR|locus:2025272339 AT1G77060 [Arabidopsis thalian 0.618 0.831 0.368 7.3e-43
TAIR|locus:2027022336 AT1G21440 [Arabidopsis thalian 0.620 0.842 0.37 3.2e-42
TIGR_CMR|BA_2350302 BA_2350 "carboxyvinyl-carboxyp 0.620 0.937 0.341 4.8e-39
TIGR_CMR|SPO_1470287 SPO_1470 "isocitrate lyase fam 0.581 0.923 0.335 2.4e-37
UNIPROTKB|P77541296 prpB "2-methylisocitrate lyase 0.609 0.939 0.341 2.2e-34
TIGR_CMR|CPS_2822296 CPS_2822 "putative methylisoci 0.611 0.942 0.336 2.2e-34
TIGR_CMR|SO_0345292 SO_0345 "methylisocitrate lyas 0.559 0.873 0.342 5.2e-33
TAIR|locus:2041006 AT2G43180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1067 (380.7 bits), Expect = 8.9e-143, Sum P(2) = 8.9e-143
 Identities = 220/320 (68%), Positives = 253/320 (79%)

Query:    56 GTINRTRVYRKNSTGVEACLSPAKSLRQILELPGVHQGPACFDALSAKLVEKXXXXXXXX 115
             G +N T V    S   +   SPAK LR I++ PGV QGP CFDALSAKL+E+        
Sbjct:    52 GAVNST-VVSDESGNAKLPSSPAKKLRNIMQSPGVLQGPCCFDALSAKLIERAGFPYCIT 110

Query:   116 XXXXXXAARLALPDTGFISYGEMVDQGQLITQAVSIPVIGDGDNGYGNAMNVKRTVKGYI 175
                   A+RL LPD G ISYGEMVDQGQ ITQ+VSIPVIGDG NGYGNAMNVKRTVKGYI
Sbjct:   111 SGFSISASRLGLPDKGLISYGEMVDQGQQITQSVSIPVIGDGGNGYGNAMNVKRTVKGYI 170

Query:   176 KAGFAGIILEDQVSPKGCGHTRG-RKVVSREEAVMRIKAAVDARKESGSDIVIVARTDSR 234
             KAGFAGII+ D+V    C +T+  R+VVSREEAVMR+KAAVDAR+E  SDIVIVA+TDSR
Sbjct:   171 KAGFAGIIINDEVC---CENTKSERRVVSREEAVMRVKAAVDARRECDSDIVIVAQTDSR 227

Query:   235 QALSLEESLRRSRAFADAGADVLFIDALASKEEMKAFCEISPLVPKMANMLEGGGKTPIL 294
             +A+SLEESL R+RAF DAGADVL +D+L S+EEMKAFC + PLVPK+ANMLE GGK PIL
Sbjct:   228 EAISLEESLIRARAFTDAGADVLSVDSLVSREEMKAFCNVYPLVPKLANMLESGGKIPIL 287

Query:   295 NPLELEELGFKLVAYPLSLIGVSVRAMQDALTAIKGGRIPSPGSMPSFQEIKETLGFNTY 354
             NPLELEE+G+KLVAYP+SLIGVS++AMQDAL AIKGGRIP PGSM S +EI E LGF+TY
Sbjct:   288 NPLELEEIGYKLVAYPISLIGVSIQAMQDALLAIKGGRIPPPGSMASLEEIGEILGFDTY 347

Query:   355 YEEEKRYATSM--RRLSSEN 372
              EEEKRYATS   R +SS +
Sbjct:   348 EEEEKRYATSSSDREVSSSS 367
GO:0003824 "catalytic activity" evidence=IEA
GO:0008152 "metabolic process" evidence=IEA
GO:0009507 "chloroplast" evidence=ISM;IDA
UNIPROTKB|Q0QLE4 Dml "2,3-dimethylmalate lyase" [Eubacterium barkeri (taxid:1528)] Back     alignment and assigned GO terms
ASPGD|ASPL0000059587 AN9369 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
TAIR|locus:2025272 AT1G77060 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2027022 AT1G21440 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TIGR_CMR|BA_2350 BA_2350 "carboxyvinyl-carboxyphosphonate phosphorylmutase" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_1470 SPO_1470 "isocitrate lyase family protein" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
UNIPROTKB|P77541 prpB "2-methylisocitrate lyase" [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_2822 CPS_2822 "putative methylisocitrate lyase" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
TIGR_CMR|SO_0345 SO_0345 "methylisocitrate lyase" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer4.1.3LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
gw1.II.2858.1
annotation not avaliable (389 aa)
(Populus trichocarpa)
Predicted Functional Partners:
eugene3.111190001
hypothetical protein (398 aa)
•     • 0.428
estExt_Genewise1_v1.C_LG_XVI2794
citrate synthase (EC-2.3.3.1) (509 aa)
•     • 0.414
estExt_Genewise1_v1.C_LG_XIV2957
citrate synthase (EC-2.3.3.1) (512 aa)
•     • 0.408

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query456
cd00377243 cd00377, ICL_PEPM, Members of the ICL/PEPM enzyme 2e-96
COG2513289 COG2513, PrpB, PEP phosphonomutase and related enz 3e-83
TIGR02317285 TIGR02317, prpB, methylisocitrate lyase 2e-71
TIGR02319294 TIGR02319, CPEP_Pphonmut, carboxyvinyl-carboxyphos 5e-61
PRK11320292 PRK11320, prpB, 2-methylisocitrate lyase; Provisio 7e-58
pfam13714238 pfam13714, PEP_mutase, Phosphoenolpyruvate phospho 9e-53
TIGR02320285 TIGR02320, PEP_mutase, phosphoenolpyruvate phospho 7e-28
TIGR02321290 TIGR02321, Pphn_pyruv_hyd, phosphonopyruvate hydro 1e-27
COG2224433 COG2224, AceA, Isocitrate lyase [Energy production 8e-17
TIGR01346527 TIGR01346, isocit_lyase, isocitrate lyase 1e-15
pfam00463526 pfam00463, ICL, Isocitrate lyase family 7e-14
PLN02892570 PLN02892, PLN02892, isocitrate lyase 2e-12
PRK15063428 PRK15063, PRK15063, isocitrate lyase; Provisional 1e-11
PRK06498531 PRK06498, PRK06498, isocitrate lyase; Provisional 5e-11
>gnl|CDD|119340 cd00377, ICL_PEPM, Members of the ICL/PEPM enzyme family catalyze either P-C or C-C bond formation/cleavage Back     alignment and domain information 
 Score =  289 bits (742), Expect = 2e-96
 Identities = 112/249 (44%), Positives = 160/249 (64%), Gaps = 8/249 (3%)

Query: 81  LRQILELPGVHQGPACFDALSAKLVEKSGFSFCFTSGFSISAARLALPDTGFISYGEMVD 140
           LR +LE  G    P  +DALSA+L E++GF   +TSG  ++A+   LPD G ++  E++ 
Sbjct: 1   LRALLESGGPLVLPGAWDALSARLAERAGFKAIYTSGAGVAASL-GLPDGGLLTLDEVLA 59

Query: 141 QGQLITQAVSIPVIGDGDNGYGNAMNVKRTVKGYIKAGFAGIILEDQVSPKGCGHTRGRK 200
             + I +AV +PVI D D GYGNA+NV RTV+   +AG AGI +EDQV PK CGH  G+ 
Sbjct: 60  AVRRIARAVDLPVIADADTGYGNALNVARTVRELEEAGAAGIHIEDQVGPKKCGHHGGKV 119

Query: 201 VVSREEAVMRIKAAVDARKESGSDIVIVARTDSRQA--LSLEESLRRSRAFADAGADVLF 258
           +V  EE V +IKAA DAR +   D VI+ARTD+  A    L+E++ R++A+A+AGAD +F
Sbjct: 120 LVPIEEFVAKIKAARDARDDL-PDFVIIARTDALLAGEEGLDEAIERAKAYAEAGADGIF 178

Query: 259 IDALASKEEMKAFCEISPLVPKMANMLEGGGKTPILNPLELEELGFKLVAYPLSLIGVSV 318
           ++ L   EE++AF E +P VP   NM  GG    +L   EL ELG + V+Y L+L+  + 
Sbjct: 179 VEGLKDPEEIRAFAE-APDVPLNVNMTPGGN---LLTVAELAELGVRRVSYGLALLRAAA 234

Query: 319 RAMQDALTA 327
           +AM++A   
Sbjct: 235 KAMREAARE 243

Known members are phosphoenolpyruvate mutase (PEPM), phosphonopyruvate hydrolase (PPH), carboxyPEP mutase (CPEP mutase), oxaloacetate hydrolase (OAH), isocitrate lyase (ICL), and 2-methylisocitrate lyase (MICL). Isocitrate lyase (ICL) catalyzes the conversion of isocitrate to succinate and glyoxylate, the first committed step in the glyoxylate pathway. This carbon-conserving pathway is present in most prokaryotes, lower eukaryotes and plants, but has not been observed in vertebrates. PEP mutase (PEPM) turns phosphoenolpyruvate (PEP) into phosphonopyruvate (P-pyr), an important intermediate in the formation of organophosphonates, which function as antibiotics or play a role in pathogenesis or signaling. P-pyr can be hydrolyzed by phosphonopyruvate hydrolase (PPH) to from pyruvate and phosphate. Oxaloacetate acetylhydrolase (OAH) catalyzes the hydrolytic cleavage of oxaloacetate to form acetate and oxalate, an important pathway to produce oxalate in filamentous fungi. 2-methylisocitrate lyase (MICL) cleaves 2-methylisocitrate to pyruvate and succinate, part of the methylcitrate cycle for the alpha-oxidation of propionate. Length = 243
>gnl|CDD|225311 COG2513, PrpB, PEP phosphonomutase and related enzymes [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|131370 TIGR02317, prpB, methylisocitrate lyase Back     alignment and domain information
>gnl|CDD|131372 TIGR02319, CPEP_Pphonmut, carboxyvinyl-carboxyphosphonate phosphorylmutase Back     alignment and domain information
>gnl|CDD|183086 PRK11320, prpB, 2-methylisocitrate lyase; Provisional Back     alignment and domain information
>gnl|CDD|222337 pfam13714, PEP_mutase, Phosphoenolpyruvate phosphomutase Back     alignment and domain information
>gnl|CDD|233820 TIGR02320, PEP_mutase, phosphoenolpyruvate phosphomutase Back     alignment and domain information
>gnl|CDD|131374 TIGR02321, Pphn_pyruv_hyd, phosphonopyruvate hydrolase Back     alignment and domain information
>gnl|CDD|225134 COG2224, AceA, Isocitrate lyase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|233364 TIGR01346, isocit_lyase, isocitrate lyase Back     alignment and domain information
>gnl|CDD|201244 pfam00463, ICL, Isocitrate lyase family Back     alignment and domain information
>gnl|CDD|215482 PLN02892, PLN02892, isocitrate lyase Back     alignment and domain information
>gnl|CDD|237893 PRK15063, PRK15063, isocitrate lyase; Provisional Back     alignment and domain information
>gnl|CDD|180592 PRK06498, PRK06498, isocitrate lyase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 456
PRK11320292 prpB 2-methylisocitrate lyase; Provisional 100.0
TIGR02317285 prpB methylisocitrate lyase. Members of this famil 100.0
COG2513289 PrpB PEP phosphonomutase and related enzymes [Carb 100.0
TIGR02319294 CPEP_Pphonmut carboxyvinyl-carboxyphosphonate phos 100.0
TIGR02321290 Pphn_pyruv_hyd phosphonopyruvate hydrolase. This f 100.0
PRK15063428 isocitrate lyase; Provisional 100.0
TIGR02320285 PEP_mutase phosphoenolpyruvate phosphomutase. A cl 100.0
PF13714238 PEP_mutase: Phosphoenolpyruvate phosphomutase; PDB 100.0
cd00377243 ICL_PEPM Members of the ICL/PEPM enzyme family cat 100.0
TIGR01346527 isocit_lyase isocitrate lyase. Isocitrate lyase an 100.0
COG2224433 AceA Isocitrate lyase [Energy production and conve 100.0
KOG1260492 consensus Isocitrate lyase [Energy production and 100.0
PLN02892570 isocitrate lyase 100.0
PF00463526 ICL: Isocitrate lyase family; InterPro: IPR000918 100.0
cd06556240 ICL_KPHMT Members of the ICL/PEPM_KPHMT enzyme sup 100.0
PRK06498531 isocitrate lyase; Provisional 100.0
cd06557254 KPHMT-like Ketopantoate hydroxymethyltransferase ( 100.0
PRK00311264 panB 3-methyl-2-oxobutanoate hydroxymethyltransfer 100.0
TIGR00222263 panB 3-methyl-2-oxobutanoate hydroxymethyltransfer 99.98
PLN02424332 ketopantoate hydroxymethyltransferase 99.97
PF02548261 Pantoate_transf: Ketopantoate hydroxymethyltransfe 99.93
COG0413268 PanB Ketopantoate hydroxymethyltransferase [Coenzy 99.92
KOG2949306 consensus Ketopantoate hydroxymethyltransferase [C 99.74
PF09370268 TIM-br_sig_trns: TIM-barrel signal transduction pr 98.01
PRK08185283 hypothetical protein; Provisional 98.01
cd00958235 DhnA Class I fructose-1,6-bisphosphate (FBP) aldol 98.01
TIGR01037300 pyrD_sub1_fam dihydroorotate dehydrogenase (subfam 97.93
TIGR00343287 pyridoxal 5'-phosphate synthase, synthase subunit 97.9
TIGR01859282 fruc_bis_ald_ fructose-1,6-bisphosphate aldolase, 97.89
PRK06801286 hypothetical protein; Provisional 97.88
TIGR01949258 AroFGH_arch predicted phospho-2-dehydro-3-deoxyhep 97.83
cd04727283 pdxS PdxS is a subunit of the pyridoxal 5'-phospha 97.8
PRK04180293 pyridoxal biosynthesis lyase PdxS; Provisional 97.8
PRK07259301 dihydroorotate dehydrogenase 1B; Reviewed 97.75
cd02810289 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) 97.74
cd00952309 CHBPH_aldolase Trans-o-hydroxybenzylidenepyruvate 97.69
PRK07998283 gatY putative fructose-1,6-bisphosphate aldolase; 97.67
PRK06806281 fructose-bisphosphate aldolase; Provisional 97.61
PRK12738286 kbaY tagatose-bisphosphate aldolase; Reviewed 97.61
cd00954288 NAL N-Acetylneuraminic acid aldolase, also called 97.6
PRK09195284 gatY tagatose-bisphosphate aldolase; Reviewed 97.58
cd04732234 HisA HisA. Phosphoribosylformimino-5-aminoimidazol 97.56
PRK00748233 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 97.52
PRK07315293 fructose-bisphosphate aldolase; Provisional 97.52
cd00947276 TBP_aldolase_IIB Tagatose-1,6-bisphosphate (TBP) a 97.52
TIGR02313294 HpaI-NOT-DapA 2,4-dihydroxyhept-2-ene-1,7-dioic ac 97.51
PRK12857284 fructose-1,6-bisphosphate aldolase; Reviewed 97.51
cd04740296 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) c 97.51
PRK08610286 fructose-bisphosphate aldolase; Reviewed 97.5
PRK12737284 gatY tagatose-bisphosphate aldolase; Reviewed 97.49
cd00945201 Aldolase_Class_I Class I aldolases. The class I al 97.48
TIGR01858282 tag_bisphos_ald class II aldolase, tagatose bispho 97.48
TIGR00737319 nifR3_yhdG putative TIM-barrel protein, nifR3 fami 97.47
TIGR00007230 phosphoribosylformimino-5-aminoimidazole carboxami 97.45
TIGR00742318 yjbN tRNA dihydrouridine synthase A. Members of th 97.45
PRK13585241 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 97.45
TIGR00167288 cbbA ketose-bisphosphate aldolases. fructose-bisph 97.39
TIGR00683290 nanA N-acetylneuraminate lyase. N-acetylneuraminat 97.39
PLN02417280 dihydrodipicolinate synthase 97.37
PRK04147293 N-acetylneuraminate lyase; Provisional 97.36
cd00945201 Aldolase_Class_I Class I aldolases. The class I al 97.35
PRK13398266 3-deoxy-7-phosphoheptulonate synthase; Provisional 97.35
PRK07709285 fructose-bisphosphate aldolase; Provisional 97.33
cd00408281 DHDPS-like Dihydrodipicolinate synthase family. A 97.31
PRK03170292 dihydrodipicolinate synthase; Provisional 97.31
cd04731243 HisF The cyclase subunit of imidazoleglycerol phos 97.3
cd00953279 KDG_aldolase KDG (2-keto-3-deoxygluconate) aldolas 97.29
cd00951289 KDGDH 5-dehydro-4-deoxyglucarate dehydratase, also 97.29
TIGR00674285 dapA dihydrodipicolinate synthase. Dihydrodipicoli 97.26
cd00950284 DHDPS Dihydrodipicolinate synthase (DHDPS) is a ke 97.25
COG0329299 DapA Dihydrodipicolinate synthase/N-acetylneuramin 97.24
TIGR03249296 KdgD 5-dehydro-4-deoxyglucarate dehydratase. 5-deh 97.19
PRK08673335 3-deoxy-7-phosphoheptulonate synthase; Reviewed 97.19
PRK05286344 dihydroorotate dehydrogenase 2; Reviewed 97.14
PRK10415321 tRNA-dihydrouridine synthase B; Provisional 97.11
PRK07565334 dihydroorotate dehydrogenase 2; Reviewed 97.1
TIGR03572232 WbuZ glycosyl amidation-associated protein WbuZ. T 97.1
PF00701289 DHDPS: Dihydrodipicolinate synthetase family; Inte 97.09
PRK13399347 fructose-1,6-bisphosphate aldolase; Provisional 97.08
PRK03620303 5-dehydro-4-deoxyglucarate dehydratase; Provisiona 97.07
cd00331217 IGPS Indole-3-glycerol phosphate synthase (IGPS); 97.04
PRK11815333 tRNA-dihydrouridine synthase A; Provisional 97.0
COG0042323 tRNA-dihydrouridine synthase [Translation, ribosom 97.0
cd04739325 DHOD_like Dihydroorotate dehydrogenase (DHOD) like 97.0
TIGR01361260 DAHP_synth_Bsub phospho-2-dehydro-3-deoxyheptonate 96.96
PRK12595360 bifunctional 3-deoxy-7-phosphoheptulonate synthase 96.95
TIGR00736231 nifR3_rel_arch TIM-barrel protein, putative. Membe 96.94
PRK05835307 fructose-bisphosphate aldolase; Provisional 96.92
cd04738327 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) cl 96.92
cd04740296 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) c 96.89
PF01116287 F_bP_aldolase: Fructose-bisphosphate aldolase clas 96.89
cd02801231 DUS_like_FMN Dihydrouridine synthase-like (DUS-lik 96.88
PRK10550312 tRNA-dihydrouridine synthase C; Provisional 96.87
PRK00278260 trpC indole-3-glycerol-phosphate synthase; Reviewe 96.84
PRK13397250 3-deoxy-7-phosphoheptulonate synthase; Provisional 96.84
PRK07084321 fructose-bisphosphate aldolase; Provisional 96.83
PF05690247 ThiG: Thiazole biosynthesis protein ThiG; InterPro 96.82
PRK13396352 3-deoxy-7-phosphoheptulonate synthase; Provisional 96.81
PRK05198264 2-dehydro-3-deoxyphosphooctonate aldolase; Provisi 96.8
CHL00162267 thiG thiamin biosynthesis protein G; Validated 96.79
PF01207309 Dus: Dihydrouridine synthase (Dus); InterPro: IPR0 96.76
cd02930353 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-bindin 96.75
cd02803327 OYE_like_FMN_family Old yellow enzyme (OYE)-like F 96.68
cd02810289 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) 96.67
cd02940299 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FM 96.62
PRK12457281 2-dehydro-3-deoxyphosphooctonate aldolase; Provisi 96.62
TIGR01362258 KDO8P_synth 3-deoxy-8-phosphooctulonate synthase. 96.53
PRK02083253 imidazole glycerol phosphate synthase subunit HisF 96.53
PRK14024241 phosphoribosyl isomerase A; Provisional 96.51
PRK00208250 thiG thiazole synthase; Reviewed 96.51
PRK05437352 isopentenyl pyrophosphate isomerase; Provisional 96.48
cd02809299 alpha_hydroxyacid_oxid_FMN Family of homologous FM 96.45
TIGR02151333 IPP_isom_2 isopentenyl-diphosphate delta-isomerase 96.43
TIGR00735254 hisF imidazoleglycerol phosphate synthase, cyclase 96.42
PRK09196347 fructose-1,6-bisphosphate aldolase; Reviewed 96.41
cd02932336 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN 96.36
cd02911233 arch_FMN Archeal FMN-binding domain. This family o 96.35
cd08205367 RuBisCO_IV_RLP Ribulose bisphosphate carboxylase l 96.35
cd04728248 ThiG Thiazole synthase (ThiG) is the tetrameric en 96.33
cd02940299 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FM 96.31
cd08210364 RLP_RrRLP Ribulose bisphosphate carboxylase like p 96.3
PRK07259301 dihydroorotate dehydrogenase 1B; Reviewed 96.27
TIGR01521347 FruBisAldo_II_B fructose-bisphosphate aldolase, cl 96.26
cd00453340 FTBP_aldolase_II Fructose/tagarose-bisphosphate al 96.26
PLN03033290 2-dehydro-3-deoxyphosphooctonate aldolase; Provisi 96.18
PRK10128267 2-keto-3-deoxy-L-rhamnonate aldolase; Provisional 96.14
PLN02424332 ketopantoate hydroxymethyltransferase 96.13
cd02801231 DUS_like_FMN Dihydrouridine synthase-like (DUS-lik 96.13
cd04734343 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN 96.1
PRK08318420 dihydropyrimidine dehydrogenase subunit B; Validat 96.06
cd04741294 DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) c 96.04
PLN02591250 tryptophan synthase 96.03
PRK09197350 fructose-bisphosphate aldolase; Provisional 96.01
cd04730236 NPD_like 2-Nitropropane dioxygenase (NPD), one of 95.94
cd00946345 FBP_aldolase_IIA Class II Type A, Fructose-1,6-bis 95.89
TIGR00262256 trpA tryptophan synthase, alpha subunit. Tryptopha 95.88
PRK01130221 N-acetylmannosamine-6-phosphate 2-epimerase; Provi 95.83
cd02811326 IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl di 95.8
PF02548261 Pantoate_transf: Ketopantoate hydroxymethyltransfe 95.78
PRK08318420 dihydropyrimidine dehydrogenase subunit B; Validat 95.76
TIGR00737319 nifR3_yhdG putative TIM-barrel protein, nifR3 fami 95.67
cd04733338 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN 95.67
cd00564196 TMP_TenI Thiamine monophosphate synthase (TMP synt 95.65
TIGR01037300 pyrD_sub1_fam dihydroorotate dehydrogenase (subfam 95.62
PRK01033258 imidazole glycerol phosphate synthase subunit HisF 95.6
cd03174265 DRE_TIM_metallolyase DRE-TIM metallolyase superfam 95.55
TIGR00222263 panB 3-methyl-2-oxobutanoate hydroxymethyltransfer 95.44
PRK07226267 fructose-bisphosphate aldolase; Provisional 95.39
PRK04302223 triosephosphate isomerase; Provisional 95.35
TIGR03151307 enACPred_II putative enoyl-(acyl-carrier-protein) 95.32
PRK12331448 oxaloacetate decarboxylase; Provisional 95.3
PF01791236 DeoC: DeoC/LacD family aldolase; InterPro: IPR0029 95.27
TIGR01520357 FruBisAldo_II_A fructose-bisphosphate aldolase, cl 95.27
COG5564276 Predicted TIM-barrel enzyme, possibly a dioxygenas 95.26
cd04722200 TIM_phosphate_binding TIM barrel proteins share a 95.2
PRK10558256 alpha-dehydro-beta-deoxy-D-glucarate aldolase; Pro 95.17
PRK13111258 trpA tryptophan synthase subunit alpha; Provisiona 95.15
PRK00043212 thiE thiamine-phosphate pyrophosphorylase; Reviewe 95.1
CHL00200263 trpA tryptophan synthase alpha subunit; Provisiona 95.1
cd02931382 ER_like_FMN Enoate reductase (ER)-like FMN-binding 95.01
TIGR00736231 nifR3_rel_arch TIM-barrel protein, putative. Membe 94.92
cd04729219 NanE N-acetylmannosamine-6-phosphate epimerase (Na 94.91
PF03932201 CutC: CutC family; InterPro: IPR005627 Copper tran 94.9
cd04728248 ThiG Thiazole synthase (ThiG) is the tetrameric en 94.88
PRK14042 596 pyruvate carboxylase subunit B; Provisional 94.86
TIGR00126211 deoC deoxyribose-phosphate aldolase. Deoxyribose-p 94.82
cd04723233 HisA_HisF Phosphoribosylformimino-5-aminoimidazole 94.81
PF04131192 NanE: Putative N-acetylmannosamine-6-phosphate epi 94.78
PRK09282 592 pyruvate carboxylase subunit B; Validated 94.78
cd06557254 KPHMT-like Ketopantoate hydroxymethyltransferase ( 94.72
PRK09250348 fructose-bisphosphate aldolase; Provisional 94.71
PLN028581378 fructose-bisphosphate aldolase 94.63
cd06556240 ICL_KPHMT Members of the ICL/PEPM_KPHMT enzyme sup 94.63
cd03316357 MR_like Mandelate racemase (MR)-like subfamily of 94.41
TIGR01740213 pyrF orotidine 5'-phosphate decarboxylase, subfami 94.41
PRK15452 443 putative protease; Provisional 94.4
PRK06512221 thiamine-phosphate pyrophosphorylase; Provisional 94.39
cd02933338 OYE_like_FMN Old yellow enzyme (OYE)-like FMN bind 94.28
KOG2335358 consensus tRNA-dihydrouridine synthase [Translatio 94.28
PRK12581 468 oxaloacetate decarboxylase; Provisional 94.28
COG0826347 Collagenase and related proteases [Posttranslation 94.24
TIGR01302450 IMP_dehydrog inosine-5'-monophosphate dehydrogenas 94.2
PRK14041 467 oxaloacetate decarboxylase; Provisional 94.19
cd03315265 MLE_like Muconate lactonizing enzyme (MLE) like su 94.18
cd00381325 IMPDH IMPDH: The catalytic domain of the inosine m 94.17
PRK00311264 panB 3-methyl-2-oxobutanoate hydroxymethyltransfer 94.15
PF04131192 NanE: Putative N-acetylmannosamine-6-phosphate epi 94.15
PRK12330 499 oxaloacetate decarboxylase; Provisional 94.1
TIGR00693196 thiE thiamine-phosphate pyrophosphorylase. This mo 94.09
PF05690247 ThiG: Thiazole biosynthesis protein ThiG; InterPro 94.08
KOG1260492 consensus Isocitrate lyase [Energy production and 93.99
cd02809299 alpha_hydroxyacid_oxid_FMN Family of homologous FM 93.98
COG2022262 ThiG Uncharacterized enzyme of thiazole biosynthes 93.98
cd02803327 OYE_like_FMN_family Old yellow enzyme (OYE)-like F 93.97
cd04735353 OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN 93.95
PRK13587234 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 93.93
PRK14017382 galactonate dehydratase; Provisional 93.9
cd04739325 DHOD_like Dihydroorotate dehydrogenase (DHOD) like 93.87
cd04724242 Tryptophan_synthase_alpha Ttryptophan synthase (TR 93.85
cd04741294 DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) c 93.85
TIGR01163210 rpe ribulose-phosphate 3-epimerase. This family co 93.82
TIGR01769205 GGGP geranylgeranylglyceryl phosphate synthase. Th 93.8
PRK07028430 bifunctional hexulose-6-phosphate synthase/ribonuc 93.76
TIGR01304369 IMP_DH_rel_2 IMP dehydrogenase family protein. Thi 93.75
PRK00208250 thiG thiazole synthase; Reviewed 93.74
TIGR00259257 thylakoid_BtpA membrane complex biogenesis protein 93.71
PF03437254 BtpA: BtpA family; InterPro: IPR005137 Photosystem 93.67
cd02911233 arch_FMN Archeal FMN-binding domain. This family o 93.63
COG0352211 ThiE Thiamine monophosphate synthase [Coenzyme met 93.6
PRK07695201 transcriptional regulator TenI; Provisional 93.6
PRK11840326 bifunctional sulfur carrier protein/thiazole synth 93.59
PRK13125244 trpA tryptophan synthase subunit alpha; Provisiona 93.58
TIGR01108 582 oadA oxaloacetate decarboxylase alpha subunit. Thi 93.55
cd04733338 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN 93.51
PRK10415321 tRNA-dihydrouridine synthase B; Provisional 93.5
TIGR03239249 GarL 2-dehydro-3-deoxyglucarate aldolase. In E. co 93.49
COG0826347 Collagenase and related proteases [Posttranslation 93.45
PF00682237 HMGL-like: HMGL-like of this family is not conserv 93.44
PRK05286344 dihydroorotate dehydrogenase 2; Reviewed 93.43
PRK12999 1146 pyruvate carboxylase; Reviewed 93.42
COG0434263 SgcQ Predicted TIM-barrel enzyme [General function 93.42
cd00959203 DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of 93.36
cd00381325 IMPDH IMPDH: The catalytic domain of the inosine m 93.25
cd03321355 mandelate_racemase Mandelate racemase (MR) catalyz 93.19
PRK05848273 nicotinate-nucleotide pyrophosphorylase; Provision 93.19
PRK07565334 dihydroorotate dehydrogenase 2; Reviewed 93.13
PRK13523337 NADPH dehydrogenase NamA; Provisional 93.1
COG0413268 PanB Ketopantoate hydroxymethyltransferase [Coenzy 93.1
PRK06852304 aldolase; Validated 93.08
PRK08649368 inosine 5-monophosphate dehydrogenase; Validated 93.04
PRK02615347 thiamine-phosphate pyrophosphorylase; Provisional 93.04
PRK09490 1229 metH B12-dependent methionine synthase; Provisiona 92.9
TIGR01305343 GMP_reduct_1 guanosine monophosphate reductase, eu 92.88
PLN02274505 inosine-5'-monophosphate dehydrogenase 92.78
PRK05692287 hydroxymethylglutaryl-CoA lyase; Provisional 92.75
PRK07807479 inosine 5-monophosphate dehydrogenase; Validated 92.74
cd03327341 MR_like_2 Mandelate racemase (MR)-like subfamily o 92.7
PRK14040 593 oxaloacetate decarboxylase; Provisional 92.7
cd02932336 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN 92.7
PRK08255765 salicylyl-CoA 5-hydroxylase; Reviewed 92.59
TIGR01303475 IMP_DH_rel_1 IMP dehydrogenase family protein. Thi 92.58
TIGR02127261 pyrF_sub2 orotidine 5'-phosphate decarboxylase, su 92.57
PRK11572248 copper homeostasis protein CutC; Provisional 92.55
PRK11572248 copper homeostasis protein CutC; Provisional 92.5
cd03325352 D-galactonate_dehydratase D-galactonate dehydratas 92.49
cd04729219 NanE N-acetylmannosamine-6-phosphate epimerase (Na 92.49
PF01207309 Dus: Dihydrouridine synthase (Dus); InterPro: IPR0 92.44
cd03329368 MR_like_4 Mandelate racemase (MR)-like subfamily o 92.36
PF01729169 QRPTase_C: Quinolinate phosphoribosyl transferase, 92.34
cd04824320 eu_ALAD_PBGS_cysteine_rich Porphobilinogen synthas 92.27
PRK01130221 N-acetylmannosamine-6-phosphate 2-epimerase; Provi 92.2
TIGR02082 1178 metH 5-methyltetrahydrofolate--homocysteine methyl 92.18
PLN02495385 oxidoreductase, acting on the CH-CH group of donor 92.12
COG0157280 NadC Nicotinate-nucleotide pyrophosphorylase [Coen 92.08
PF00490324 ALAD: Delta-aminolevulinic acid dehydratase; Inter 92.08
PRK08195337 4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic ac 92.06
PF00478352 IMPDH: IMP dehydrogenase / GMP reductase domain; I 92.0
PRK08227264 autoinducer 2 aldolase; Validated 91.97
PRK11858378 aksA trans-homoaconitate synthase; Reviewed 91.83
cd03319316 L-Ala-DL-Glu_epimerase L-Ala-D/L-Glu epimerase cat 91.82
cd03328352 MR_like_3 Mandelate racemase (MR)-like subfamily o 91.81
COG2876286 AroA 3-deoxy-D-arabino-heptulosonate 7-phosphate ( 91.77
cd03323395 D-glucarate_dehydratase D-Glucarate dehydratase (G 91.7
PRK06843404 inosine 5-monophosphate dehydrogenase; Validated 91.67
cd04736361 MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-bin 91.64
TIGR02151333 IPP_isom_2 isopentenyl-diphosphate delta-isomerase 91.62
PRK10550312 tRNA-dihydrouridine synthase C; Provisional 91.61
PF03932201 CutC: CutC family; InterPro: IPR005627 Copper tran 91.59
cd04725216 OMP_decarboxylase_like Orotidine 5'-phosphate deca 91.59
cd04724242 Tryptophan_synthase_alpha Ttryptophan synthase (TR 91.55
TIGR03151307 enACPred_II putative enoyl-(acyl-carrier-protein) 91.54
TIGR00035229 asp_race aspartate racemase. 91.52
PLN02489335 homocysteine S-methyltransferase 91.52
PRK00125278 pyrF orotidine 5'-phosphate decarboxylase; Reviewe 91.52
cd04747361 OYE_like_5_FMN Old yellow enzyme (OYE)-related FMN 91.48
cd04738327 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) cl 91.46
TIGR01306321 GMP_reduct_2 guanosine monophosphate reductase, ba 91.43
PRK11613282 folP dihydropteroate synthase; Provisional 91.37
PLN02334229 ribulose-phosphate 3-epimerase 91.34
TIGR03247441 glucar-dehydr glucarate dehydratase. Glucarate deh 91.29
cd02811326 IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl di 91.24
PTZ00314495 inosine-5'-monophosphate dehydrogenase; Provisiona 91.18
PRK13523337 NADPH dehydrogenase NamA; Provisional 91.16
COG2022262 ThiG Uncharacterized enzyme of thiazole biosynthes 91.12
TIGR01302450 IMP_dehydrog inosine-5'-monophosphate dehydrogenas 91.1
PF13714238 PEP_mutase: Phosphoenolpyruvate phosphomutase; PDB 91.09
cd07948262 DRE_TIM_HCS Saccharomyces cerevisiae homocitrate s 91.09
TIGR03128206 RuMP_HxlA 3-hexulose-6-phosphate synthase. at the 91.06
cd03326385 MR_like_1 Mandelate racemase (MR)-like subfamily o 91.04
PF02581180 TMP-TENI: Thiamine monophosphate synthase/TENI; In 91.03
TIGR00640132 acid_CoA_mut_C methylmalonyl-CoA mutase C-terminal 91.03
cd04737351 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding d 91.01
PLN02746347 hydroxymethylglutaryl-CoA lyase 90.86
PRK15452 443 putative protease; Provisional 90.83
cd07937275 DRE_TIM_PC_TC_5S Pyruvate carboxylase and Transcar 90.75
TIGR02311249 HpaI 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldola 90.74
cd00331217 IGPS Indole-3-glycerol phosphate synthase (IGPS); 90.73
cd03332383 LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-bindin 90.71
PRK09485304 mmuM homocysteine methyltransferase; Provisional 90.53
PRK10128267 2-keto-3-deoxy-L-rhamnonate aldolase; Provisional 90.48
TIGR02660365 nifV_homocitr homocitrate synthase NifV. This fami 90.48
PRK05437352 isopentenyl pyrophosphate isomerase; Provisional 90.46
TIGR01496257 DHPS dihydropteroate synthase. This model represen 90.43
PRK08385278 nicotinate-nucleotide pyrophosphorylase; Provision 90.42
PF00478352 IMPDH: IMP dehydrogenase / GMP reductase domain; I 90.38
TIGR03239249 GarL 2-dehydro-3-deoxyglucarate aldolase. In E. co 90.28
TIGR01305343 GMP_reduct_1 guanosine monophosphate reductase, eu 90.26
cd07945280 DRE_TIM_CMS Leptospira interrogans citramalate syn 90.23
cd00564196 TMP_TenI Thiamine monophosphate synthase (TMP synt 90.18
cd04726202 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxyl 89.92
PRK10558256 alpha-dehydro-beta-deoxy-D-glucarate aldolase; Pro 89.91
cd03322361 rpsA The starvation sensing protein RpsA from E.co 89.83
PRK07107502 inosine 5-monophosphate dehydrogenase; Validated 89.81
PRK02506310 dihydroorotate dehydrogenase 1A; Reviewed 89.62
PRK06096284 molybdenum transport protein ModD; Provisional 89.62
PRK09283323 delta-aminolevulinic acid dehydratase; Validated 89.56
TIGR02708367 L_lactate_ox L-lactate oxidase. Members of this pr 89.55
COG3010229 NanE Putative N-acetylmannosamine-6-phosphate epim 89.52
PRK02714320 O-succinylbenzoate synthase; Provisional 89.46
PRK00230230 orotidine 5'-phosphate decarboxylase; Reviewed 89.45
cd07941273 DRE_TIM_LeuA3 Desulfobacterium autotrophicum LeuA3 89.18
PRK05105322 O-succinylbenzoate synthase; Provisional 89.05
PF02219287 MTHFR: Methylenetetrahydrofolate reductase; InterP 89.05
COG2513289 PrpB PEP phosphonomutase and related enzymes [Carb 89.05
PRK10605362 N-ethylmaleimide reductase; Provisional 89.04
cd03324415 rTSbeta_L-fuconate_dehydratase Human rTS beta is e 89.02
cd07943263 DRE_TIM_HOA 4-hydroxy-2-oxovalerate aldolase, N-te 89.02
PF01729169 QRPTase_C: Quinolinate phosphoribosyl transferase, 89.0
cd02930353 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-bindin 88.97
PRK05692287 hydroxymethylglutaryl-CoA lyase; Provisional 88.85
PF00977229 His_biosynth: Histidine biosynthesis protein; Inte 88.84
PF00290259 Trp_syntA: Tryptophan synthase alpha chain; InterP 88.72
TIGR03217333 4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase. 88.72
cd04730236 NPD_like 2-Nitropropane dioxygenase (NPD), one of 88.7
PLN02274505 inosine-5'-monophosphate dehydrogenase 88.67
TIGR00742318 yjbN tRNA dihydrouridine synthase A. Members of th 88.61
PRK06559290 nicotinate-nucleotide pyrophosphorylase; Provision 88.58
TIGR01303475 IMP_DH_rel_1 IMP dehydrogenase family protein. Thi 88.55
PLN02535364 glycolate oxidase 88.48
PTZ00314495 inosine-5'-monophosphate dehydrogenase; Provisiona 88.47
PRK05567486 inosine 5'-monophosphate dehydrogenase; Reviewed 88.43
cd02922344 FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding dom 88.43
cd02929370 TMADH_HD_FMN Trimethylamine dehydrogenase (TMADH) 88.29
PRK11858378 aksA trans-homoaconitate synthase; Reviewed 88.25
PRK06978294 nicotinate-nucleotide pyrophosphorylase; Provision 88.24
PRK08649368 inosine 5-monophosphate dehydrogenase; Validated 88.23
TIGR02311249 HpaI 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldola 88.22
PRK05567486 inosine 5'-monophosphate dehydrogenase; Reviewed 88.13
CHL00200263 trpA tryptophan synthase alpha subunit; Provisiona 88.11
PRK08195337 4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic ac 88.07
PRK05458326 guanosine 5'-monophosphate oxidoreductase; Provisi 88.06
cd07944266 DRE_TIM_HOA_like 4-hydroxy-2-oxovalerate aldolase- 88.01
PRK09389 488 (R)-citramalate synthase; Provisional 88.0
cd04732234 HisA HisA. Phosphoribosylformimino-5-aminoimidazol 88.0
PRK05458326 guanosine 5'-monophosphate oxidoreductase; Provisi 87.99
PLN02898502 HMP-P kinase/thiamin-monophosphate pyrophosphoryla 87.88
PRK07695201 transcriptional regulator TenI; Provisional 87.87
CHL00162267 thiG thiamin biosynthesis protein G; Validated 87.84
TIGR02320285 PEP_mutase phosphoenolpyruvate phosphomutase. A cl 87.79
PLN02495385 oxidoreductase, acting on the CH-CH group of donor 87.71
PRK05096346 guanosine 5'-monophosphate oxidoreductase; Provisi 87.7
PRK11197381 lldD L-lactate dehydrogenase; Provisional 87.63
COG0821361 gcpE 1-hydroxy-2-methyl-2-(e)-butenyl 4-diphosphat 87.62
PRK12858340 tagatose 1,6-diphosphate aldolase; Reviewed 87.57
PRK00366360 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate s 87.57
COG0214296 SNZ1 Pyridoxine biosynthesis enzyme [Coenzyme meta 87.54
cd00739257 DHPS DHPS subgroup of Pterin binding enzymes. DHPS 87.49
PRK05742277 nicotinate-nucleotide pyrophosphorylase; Provision 87.49
cd02933338 OYE_like_FMN Old yellow enzyme (OYE)-like FMN bind 87.4
PRK07107502 inosine 5-monophosphate dehydrogenase; Validated 87.4
COG0269217 SgbH 3-hexulose-6-phosphate synthase and related p 87.38
PRK11815333 tRNA-dihydrouridine synthase A; Provisional 87.28
cd07948262 DRE_TIM_HCS Saccharomyces cerevisiae homocitrate s 87.28
COG0284240 PyrF Orotidine-5'-phosphate decarboxylase [Nucleot 87.26
PRK10605362 N-ethylmaleimide reductase; Provisional 87.23
PRK13753279 dihydropteroate synthase; Provisional 87.23
COG0107256 HisF Imidazoleglycerol-phosphate synthase [Amino a 87.21
TIGR00612346 ispG_gcpE 1-hydroxy-2-methyl-2-(E)-butenyl 4-dipho 87.2
TIGR03217333 4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase. 87.17
COG1794230 RacX Aspartate racemase [Cell envelope biogenesis, 87.17
PRK06843404 inosine 5-monophosphate dehydrogenase; Validated 86.91
TIGR01334277 modD putative molybdenum utilization protein ModD. 86.89
PLN02826409 dihydroorotate dehydrogenase 86.85
PRK13384322 delta-aminolevulinic acid dehydratase; Provisional 86.84
PRK05581220 ribulose-phosphate 3-epimerase; Validated 86.83
PRK07534336 methionine synthase I; Validated 86.81
PLN02746347 hydroxymethylglutaryl-CoA lyase 86.73
PRK05848273 nicotinate-nucleotide pyrophosphorylase; Provision 86.7
PRK13957247 indole-3-glycerol-phosphate synthase; Provisional 86.67
cd00452190 KDPG_aldolase KDPG and KHG aldolase. This family b 86.65
COG0167310 PyrD Dihydroorotate dehydrogenase [Nucleotide tran 86.62
TIGR02090363 LEU1_arch isopropylmalate/citramalate/homocitrate 86.5
PRK00507221 deoxyribose-phosphate aldolase; Provisional 86.49
PRK13813215 orotidine 5'-phosphate decarboxylase; Provisional 86.47
PRK09140206 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; R 86.44
TIGR01334277 modD putative molybdenum utilization protein ModD. 86.4
TIGR01927307 menC_gamma/gm+ o-succinylbenzoic acid (OSB) synthe 86.35
cd02812219 PcrB_like PcrB_like proteins. One member of this f 86.32
PF02679244 ComA: (2R)-phospho-3-sulfolactate synthase (ComA); 86.12
PRK00043212 thiE thiamine-phosphate pyrophosphorylase; Reviewe 85.96
PRK07896289 nicotinate-nucleotide pyrophosphorylase; Provision 85.9
cd04722200 TIM_phosphate_binding TIM barrel proteins share a 85.86
TIGR02090363 LEU1_arch isopropylmalate/citramalate/homocitrate 85.86
KOG1606296 consensus Stationary phase-induced protein, SOR/SN 85.79
TIGR00034344 aroFGH phospho-2-dehydro-3-deoxyheptonate aldolase 85.62
cd03318365 MLE Muconate Lactonizing Enzyme (MLE), an homoocta 85.59
PF03328221 HpcH_HpaI: HpcH/HpaI aldolase/citrate lyase family 85.39
TIGR01304369 IMP_DH_rel_2 IMP dehydrogenase family protein. Thi 85.37
PRK03512211 thiamine-phosphate pyrophosphorylase; Provisional 85.35
TIGR03326412 rubisco_III ribulose bisphosphate carboxylase, typ 85.25
cd08207406 RLP_NonPhot Ribulose bisphosphate carboxylase like 85.2
PRK04452319 acetyl-CoA decarbonylase/synthase complex subunit 85.19
PF01070356 FMN_dh: FMN-dependent dehydrogenase; InterPro: IPR 85.02
TIGR02708367 L_lactate_ox L-lactate oxidase. Members of this pr 84.98
TIGR00973494 leuA_bact 2-isopropylmalate synthase, bacterial ty 84.97
COG3836255 HpcH 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldola 84.85
COG0800211 Eda 2-keto-3-deoxy-6-phosphogluconate aldolase [Ca 84.79
PLN02428349 lipoic acid synthase 84.79
cd08209391 RLP_DK-MTP-1-P-enolase 2,3-diketo-5-methylthiopent 84.78
COG4948372 L-alanine-DL-glutamate epimerase and related enzym 84.76
COG3010229 NanE Putative N-acetylmannosamine-6-phosphate epim 84.7
PLN03228503 methylthioalkylmalate synthase; Provisional 84.69
cd08213412 RuBisCO_large_III Ribulose bisphosphate carboxylas 84.63
PRK06543281 nicotinate-nucleotide pyrophosphorylase; Provision 84.5
PLN02493367 probable peroxisomal (S)-2-hydroxy-acid oxidase 84.46
PRK05718212 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 84.46
cd00429211 RPE Ribulose-5-phosphate 3-epimerase (RPE). This e 84.46
TIGR03849237 arch_ComA phosphosulfolactate synthase. This model 84.43
PF03060330 NMO: Nitronate monooxygenase; InterPro: IPR004136 84.3
PRK06015201 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 84.3
COG5016 472 Pyruvate/oxaloacetate carboxyltransferase [Energy 84.3
PLN02591250 tryptophan synthase 84.28
PRK06106281 nicotinate-nucleotide pyrophosphorylase; Provision 84.15
PLN02980 1655 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesi 84.14
cd04737351 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding d 84.0
PRK07114222 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 83.94
PRK13307391 bifunctional formaldehyde-activating enzyme/3-hexu 83.89
PLN02321 632 2-isopropylmalate synthase 83.89
cd04734343 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN 83.85
TIGR02129253 hisA_euk phosphoribosylformimino-5-aminoimidazole 83.74
TIGR01182204 eda Entner-Doudoroff aldolase. 2-deydro-3-deoxypho 83.73
PRK08999312 hypothetical protein; Provisional 83.64
cd07944266 DRE_TIM_HOA_like 4-hydroxy-2-oxovalerate aldolase- 83.64
PLN02979366 glycolate oxidase 83.55
COG1830265 FbaB DhnA-type fructose-1,6-bisphosphate aldolase 83.54
cd00384314 ALAD_PBGS Porphobilinogen synthase (PBGS), which i 83.54
PF01180295 DHO_dh: Dihydroorotate dehydrogenase; InterPro: IP 83.53
cd02922344 FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding dom 83.48
PF00682237 HMGL-like: HMGL-like of this family is not conserv 83.24
COG0159265 TrpA Tryptophan synthase alpha chain [Amino acid t 83.21
PRK00915513 2-isopropylmalate synthase; Validated 83.09
PF02581180 TMP-TENI: Thiamine monophosphate synthase/TENI; In 83.08
PRK02506310 dihydroorotate dehydrogenase 1A; Reviewed 83.05
cd08148366 RuBisCO_large Ribulose bisphosphate carboxylase la 83.01
PRK13111258 trpA tryptophan synthase subunit alpha; Provisiona 82.94
cd08212450 RuBisCO_large_I Ribulose bisphosphate carboxylase 82.9
PRK09016296 quinolinate phosphoribosyltransferase; Validated 82.72
COG0113330 HemB Delta-aminolevulinic acid dehydratase [Coenzy 82.4
TIGR01036335 pyrD_sub2 dihydroorotate dehydrogenase, subfamily 82.19
PRK05500477 bifunctional orotidine 5'-phosphate decarboxylase/ 82.18
cd04726202 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxyl 82.14
PRK08072277 nicotinate-nucleotide pyrophosphorylase; Provision 82.07
COG0191286 Fba Fructose/tagatose bisphosphate aldolase [Carbo 81.92
TIGR00007230 phosphoribosylformimino-5-aminoimidazole carboxami 81.9
PRK00278260 trpC indole-3-glycerol-phosphate synthase; Reviewe 81.83
TIGR01036335 pyrD_sub2 dihydroorotate dehydrogenase, subfamily 81.82
PLN03228503 methylthioalkylmalate synthase; Provisional 81.81
PLN02716308 nicotinate-nucleotide diphosphorylase (carboxylati 81.76
PRK09389488 (R)-citramalate synthase; Provisional 81.75
PF02574305 S-methyl_trans: Homocysteine S-methyltransferase; 81.52
PRK01033258 imidazole glycerol phosphate synthase subunit HisF 81.42
CHL00040475 rbcL ribulose-1,5-bisphosphate carboxylase/oxygena 81.21
cd00951289 KDGDH 5-dehydro-4-deoxyglucarate dehydratase, also 81.12
COG0106241 HisA Phosphoribosylformimino-5-aminoimidazole carb 81.09
PRK00915 513 2-isopropylmalate synthase; Validated 81.03
cd08208424 RLP_Photo Ribulose bisphosphate carboxylase like p 81.01
PRK04208468 rbcL ribulose bisophosphate carboxylase; Reviewed 81.0
PRK07896289 nicotinate-nucleotide pyrophosphorylase; Provision 80.94
COG0119409 LeuA Isopropylmalate/homocitrate/citramalate synth 80.94
PRK15129321 L-Ala-D/L-Glu epimerase; Provisional 80.91
cd04731243 HisF The cyclase subunit of imidazoleglycerol phos 80.86
TIGR01306321 GMP_reduct_2 guanosine monophosphate reductase, ba 80.71
cd03320263 OSBS o-Succinylbenzoate synthase (OSBS) catalyzes 80.68
cd07938274 DRE_TIM_HMGL 3-hydroxy-3-methylglutaryl-CoA lyase, 80.59
PRK02615347 thiamine-phosphate pyrophosphorylase; Provisional 80.52
PRK02083253 imidazole glycerol phosphate synthase subunit HisF 80.47
PF01180295 DHO_dh: Dihydroorotate dehydrogenase; InterPro: IP 80.47
TIGR03586327 PseI pseudaminic acid synthase. 80.46
PRK08508279 biotin synthase; Provisional 80.46
COG1902363 NemA NADH:flavin oxidoreductases, Old Yellow Enzym 80.41
COG3142241 CutC Uncharacterized protein involved in copper re 80.4
PRK08645 612 bifunctional homocysteine S-methyltransferase/5,10 80.39
PRK04128228 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 80.36
PRK13585241 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 80.33
PRK15072404 bifunctional D-altronate/D-mannonate dehydratase; 80.27
cd07940268 DRE_TIM_IPMS 2-isopropylmalate synthase (IPMS), N- 80.25
PRK07807479 inosine 5-monophosphate dehydrogenase; Validated 80.18
COG2185143 Sbm Methylmalonyl-CoA mutase, C-terminal domain/su 80.16
TIGR02660365 nifV_homocitr homocitrate synthase NifV. This fami 80.04
>PRK11320 prpB 2-methylisocitrate lyase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=1.7e-73  Score=568.48  Aligned_cols=286  Identities=36%  Similarity=0.557  Sum_probs=269.6

Q ss_pred             ccHHHHHHHHHhCCCceeecccCChHHHHHHHHhCCcEEEecchHHhhhhcccCCCCCCCHHHHHHHHHHHHhccCCcEE
Q 012815           75 LSPAKSLRQILELPGVHQGPACFDALSAKLVEKSGFSFCFTSGFSISAARLALPDTGFISYGEMVDQGQLITQAVSIPVI  154 (456)
Q Consensus        75 ~~~a~~Lr~ll~~~~~lv~pgayDalSArl~e~aGfdAI~vSG~avSas~lG~PD~~~lt~~Eml~~~r~I~ra~~iPVI  154 (456)
                      +.++++||++|++++++++||+||++|||++|++||+++|+||+++|++++|+||.+++|++||++++++|++++++||+
T Consensus         3 ~~~~~~lr~ll~~~~~l~~p~~~Da~SAri~e~~Gf~ai~~Sg~~~a~~~lG~PD~g~l~~~e~~~~~~~I~~~~~iPvi   82 (292)
T PRK11320          3 HSAGARFRAALAAEKPLQIVGTINAYHALLAERAGFKAIYLSGGGVAAASLGLPDLGITTLDDVLIDVRRITDACDLPLL   82 (292)
T ss_pred             CCHHHHHHHHHcCCCcEEecCCCCHHHHHHHHHcCCCEEEeCHHHHHhHhcCCCCCCCCCHHHHHHHHHHHHhccCCCEE
Confidence            45678899999999999999999999999999999999999999999778999999999999999999999999999999


Q ss_pred             EeCCCCCCCHHHHHHHHHHHHHhCccEEEeCCCCCCCCccCCCCccccCHHHHHHHHHHHHHHhHhhCCCeEEEEecchh
Q 012815          155 GDGDNGYGNAMNVKRTVKGYIKAGFAGIILEDQVSPKGCGHTRGRKVVSREEAVMRIKAAVDARKESGSDIVIVARTDSR  234 (456)
Q Consensus       155 aD~DtGYG~~~nv~rtVk~l~~AGaaGI~IEDq~~pK~CGH~~gk~lvp~ee~v~kI~AA~~Ar~~~G~dfvIiARTDA~  234 (456)
                      ||+|+|||++.|++++|++|+++||+|||||||++||+|||..||+++|.+|+++||+||++|++  ++||+||||||++
T Consensus        83 aD~d~GyG~~~~v~r~V~~~~~aGaagi~IEDq~~pK~cg~~~~~~lv~~ee~~~kI~Aa~~a~~--~~d~~IiARTDa~  160 (292)
T PRK11320         83 VDIDTGFGGAFNIARTVKSMIKAGAAAVHIEDQVGAKRCGHRPNKEIVSQEEMVDRIKAAVDART--DPDFVIMARTDAL  160 (292)
T ss_pred             EECCCCCCCHHHHHHHHHHHHHcCCeEEEEecCCCccccCCCCCCcccCHHHHHHHHHHHHHhcc--CCCeEEEEecCcc
Confidence            99999999999999999999999999999999999999999999999999999999999999987  5899999999999


Q ss_pred             hcccHHHHHHHHHHhHhcCCCEEEeccCCCHHHHHHHHHhCCCCceeeeeeccCCCCCCCCHHHHHhcCCCEEeccchHH
Q 012815          235 QALSLEESLRRSRAFADAGADVLFIDALASKEEMKAFCEISPLVPKMANMLEGGGKTPILNPLELEELGFKLVAYPLSLI  314 (456)
Q Consensus       235 ~~~~ldeAI~RakAy~eAGAD~Ifie~~~s~eei~~i~~~v~~vP~~~N~~~~~g~tp~lt~~eL~elGv~~Vs~p~~ll  314 (456)
                      ...++||||+|+++|++||||+||+|++.+.+++++++++++ +|+++|++++ +++|.++.+||+++||++|+||++++
T Consensus       161 ~~~g~deAI~Ra~aY~eAGAD~ifi~~~~~~~~i~~~~~~~~-~Pl~~n~~~~-~~~p~~s~~~L~~lGv~~v~~~~~~~  238 (292)
T PRK11320        161 AVEGLDAAIERAQAYVEAGADMIFPEAMTELEMYRRFADAVK-VPILANITEF-GATPLFTTEELASAGVAMVLYPLSAF  238 (292)
T ss_pred             cccCHHHHHHHHHHHHHcCCCEEEecCCCCHHHHHHHHHhcC-CCEEEEeccC-CCCCCCCHHHHHHcCCcEEEEChHHH
Confidence            888999999999999999999999999999999999999998 7999999986 67899999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHcCCC--CCCCCCCCHHHHHHhcCcccHH-HHHHccccc
Q 012815          315 GVSVRAMQDALTAIKGGRI--PSPGSMPSFQEIKETLGFNTYY-EEEKRYATS  364 (456)
Q Consensus       315 ~aa~~A~~~~l~~i~~g~~--~~~~~~~~~~e~~~lvg~~~~~-~~e~~y~~~  364 (456)
                      ++++++|+++++.|++.+.  ...+.+++|+|+++++||++|. .+|++|...
T Consensus       239 ~aa~~a~~~~~~~l~~~g~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~  291 (292)
T PRK11320        239 RAMNKAAENVYEAIRRDGTQKAVVDTMQTREELYEYLGYHAYEQKLDALFAQK  291 (292)
T ss_pred             HHHHHHHHHHHHHHHHcCCcccchhccCCHHHHHHhcCcHHHHHHHHHHhccC
Confidence            9999999999999986443  2455688999999999999998 678888654

>TIGR02317 prpB methylisocitrate lyase Back     alignment and domain information
>COG2513 PrpB PEP phosphonomutase and related enzymes [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02319 CPEP_Pphonmut carboxyvinyl-carboxyphosphonate phosphorylmutase Back     alignment and domain information
>TIGR02321 Pphn_pyruv_hyd phosphonopyruvate hydrolase Back     alignment and domain information
>PRK15063 isocitrate lyase; Provisional Back     alignment and domain information
>TIGR02320 PEP_mutase phosphoenolpyruvate phosphomutase Back     alignment and domain information
>PF13714 PEP_mutase: Phosphoenolpyruvate phosphomutase; PDB: 1ZLP_A 3EOO_C 1UJQ_D 1O5Q_A 2DUA_A 2HJP_A 2HRW_A 2QIW_A 3KZ2_B 3IH1_B Back     alignment and domain information
>cd00377 ICL_PEPM Members of the ICL/PEPM enzyme family catalyze either P-C or C-C bond formation/cleavage Back     alignment and domain information
>TIGR01346 isocit_lyase isocitrate lyase Back     alignment and domain information
>COG2224 AceA Isocitrate lyase [Energy production and conversion] Back     alignment and domain information
>KOG1260 consensus Isocitrate lyase [Energy production and conversion] Back     alignment and domain information
>PLN02892 isocitrate lyase Back     alignment and domain information
>PF00463 ICL: Isocitrate lyase family; InterPro: IPR000918 Isocitrate lyase (4 Back     alignment and domain information
>cd06556 ICL_KPHMT Members of the ICL/PEPM_KPHMT enzyme superfamily catalyze the formation and cleavage of either P-C or C-C bonds Back     alignment and domain information
>PRK06498 isocitrate lyase; Provisional Back     alignment and domain information
>cd06557 KPHMT-like Ketopantoate hydroxymethyltransferase (KPHMT) is the first enzyme in the pantothenate biosynthesis pathway Back     alignment and domain information
>PRK00311 panB 3-methyl-2-oxobutanoate hydroxymethyltransferase; Reviewed Back     alignment and domain information
>TIGR00222 panB 3-methyl-2-oxobutanoate hydroxymethyltransferase Back     alignment and domain information
>PLN02424 ketopantoate hydroxymethyltransferase Back     alignment and domain information
>PF02548 Pantoate_transf: Ketopantoate hydroxymethyltransferase; InterPro: IPR003700 The panB gene from Escherichia coli encodes the first enzyme of the pantothenate biosynthesis pathway, ketopantoate hydroxymethyltransferase (KPHMT) 2 Back     alignment and domain information
>COG0413 PanB Ketopantoate hydroxymethyltransferase [Coenzyme metabolism] Back     alignment and domain information
>KOG2949 consensus Ketopantoate hydroxymethyltransferase [Coenzyme transport and metabolism] Back     alignment and domain information
>PF09370 TIM-br_sig_trns: TIM-barrel signal transduction protein; InterPro: IPR009215 Members of this family are predicted to have a TIM barrel fold, based on PSI-BLAST analysis (iteration 4) and on SCOP prediction (using SMART) Back     alignment and domain information
>PRK08185 hypothetical protein; Provisional Back     alignment and domain information
>cd00958 DhnA Class I fructose-1,6-bisphosphate (FBP) aldolases of the archaeal type (DhnA homologs) found in bacteria and archaea Back     alignment and domain information
>TIGR01037 pyrD_sub1_fam dihydroorotate dehydrogenase (subfamily 1) family protein Back     alignment and domain information
>TIGR00343 pyridoxal 5'-phosphate synthase, synthase subunit Pdx1 Back     alignment and domain information
>TIGR01859 fruc_bis_ald_ fructose-1,6-bisphosphate aldolase, class II, various bacterial and amitochondriate protist Back     alignment and domain information
>PRK06801 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01949 AroFGH_arch predicted phospho-2-dehydro-3-deoxyheptonate aldolase Back     alignment and domain information
>cd04727 pdxS PdxS is a subunit of the pyridoxal 5'-phosphate (PLP) synthase, an important enzyme in deoxyxylulose 5-phosphate (DXP)-independent pathway for de novo biosynthesis of PLP, present in some eubacteria, in archaea, fungi, plants, plasmodia, and some metazoa Back     alignment and domain information
>PRK04180 pyridoxal biosynthesis lyase PdxS; Provisional Back     alignment and domain information
>PRK07259 dihydroorotate dehydrogenase 1B; Reviewed Back     alignment and domain information
>cd02810 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>cd00952 CHBPH_aldolase Trans-o-hydroxybenzylidenepyruvate hydratase-aldolase (HBPHA) and trans-2'-carboxybenzalpyruvate hydratase-aldolase (CBPHA) Back     alignment and domain information
>PRK07998 gatY putative fructose-1,6-bisphosphate aldolase; Reviewed Back     alignment and domain information
>PRK06806 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>PRK12738 kbaY tagatose-bisphosphate aldolase; Reviewed Back     alignment and domain information
>cd00954 NAL N-Acetylneuraminic acid aldolase, also called N-acetylneuraminate lyase (NAL), which catalyses the reversible aldol reaction of N-acetyl-D-mannosamine and pyruvate to give N-acetyl-D-neuraminic acid (D-sialic acid) Back     alignment and domain information
>PRK09195 gatY tagatose-bisphosphate aldolase; Reviewed Back     alignment and domain information
>cd04732 HisA HisA Back     alignment and domain information
>PRK00748 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Validated Back     alignment and domain information
>PRK07315 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>cd00947 TBP_aldolase_IIB Tagatose-1,6-bisphosphate (TBP) aldolase and related Type B Class II aldolases Back     alignment and domain information
>TIGR02313 HpaI-NOT-DapA 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase Back     alignment and domain information
>PRK12857 fructose-1,6-bisphosphate aldolase; Reviewed Back     alignment and domain information
>cd04740 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain Back     alignment and domain information
>PRK08610 fructose-bisphosphate aldolase; Reviewed Back     alignment and domain information
>PRK12737 gatY tagatose-bisphosphate aldolase; Reviewed Back     alignment and domain information
>cd00945 Aldolase_Class_I Class I aldolases Back     alignment and domain information
>TIGR01858 tag_bisphos_ald class II aldolase, tagatose bisphosphate family Back     alignment and domain information
>TIGR00737 nifR3_yhdG putative TIM-barrel protein, nifR3 family Back     alignment and domain information
>TIGR00007 phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase Back     alignment and domain information
>TIGR00742 yjbN tRNA dihydrouridine synthase A Back     alignment and domain information
>PRK13585 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>TIGR00167 cbbA ketose-bisphosphate aldolases Back     alignment and domain information
>TIGR00683 nanA N-acetylneuraminate lyase Back     alignment and domain information
>PLN02417 dihydrodipicolinate synthase Back     alignment and domain information
>PRK04147 N-acetylneuraminate lyase; Provisional Back     alignment and domain information
>cd00945 Aldolase_Class_I Class I aldolases Back     alignment and domain information
>PRK13398 3-deoxy-7-phosphoheptulonate synthase; Provisional Back     alignment and domain information
>PRK07709 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>cd00408 DHDPS-like Dihydrodipicolinate synthase family Back     alignment and domain information
>PRK03170 dihydrodipicolinate synthase; Provisional Back     alignment and domain information
>cd04731 HisF The cyclase subunit of imidazoleglycerol phosphate synthase (HisF) Back     alignment and domain information
>cd00953 KDG_aldolase KDG (2-keto-3-deoxygluconate) aldolases found in archaea Back     alignment and domain information
>cd00951 KDGDH 5-dehydro-4-deoxyglucarate dehydratase, also called 5-keto-4-deoxy-glucarate dehydratase (KDGDH), which is member of dihydrodipicolinate synthase (DHDPS) family that comprises several pyruvate-dependent class I aldolases Back     alignment and domain information
>TIGR00674 dapA dihydrodipicolinate synthase Back     alignment and domain information
>cd00950 DHDPS Dihydrodipicolinate synthase (DHDPS) is a key enzyme in lysine biosynthesis Back     alignment and domain information
>COG0329 DapA Dihydrodipicolinate synthase/N-acetylneuraminate lyase [Amino acid transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR03249 KdgD 5-dehydro-4-deoxyglucarate dehydratase Back     alignment and domain information
>PRK08673 3-deoxy-7-phosphoheptulonate synthase; Reviewed Back     alignment and domain information
>PRK05286 dihydroorotate dehydrogenase 2; Reviewed Back     alignment and domain information
>PRK10415 tRNA-dihydrouridine synthase B; Provisional Back     alignment and domain information
>PRK07565 dihydroorotate dehydrogenase 2; Reviewed Back     alignment and domain information
>TIGR03572 WbuZ glycosyl amidation-associated protein WbuZ Back     alignment and domain information
>PF00701 DHDPS: Dihydrodipicolinate synthetase family; InterPro: IPR002220 Dihydropicolinate synthase (DHDPS) is the key enzyme in lysine biosynthesis via the diaminopimelate pathway of prokaryotes, some phycomycetes and higher plants Back     alignment and domain information
>PRK13399 fructose-1,6-bisphosphate aldolase; Provisional Back     alignment and domain information
>PRK03620 5-dehydro-4-deoxyglucarate dehydratase; Provisional Back     alignment and domain information
>cd00331 IGPS Indole-3-glycerol phosphate synthase (IGPS); an enzyme in the tryptophan biosynthetic pathway, catalyzing the ring closure reaction of 1-(o-carboxyphenylamino)-1-deoxyribulose-5-phosphate (CdRP) to indole-3-glycerol phosphate (IGP), accompanied by the release of carbon dioxide and water Back     alignment and domain information
>PRK11815 tRNA-dihydrouridine synthase A; Provisional Back     alignment and domain information
>COG0042 tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd04739 DHOD_like Dihydroorotate dehydrogenase (DHOD) like proteins Back     alignment and domain information
>TIGR01361 DAHP_synth_Bsub phospho-2-dehydro-3-deoxyheptonate aldolase Back     alignment and domain information
>PRK12595 bifunctional 3-deoxy-7-phosphoheptulonate synthase/chorismate mutase; Reviewed Back     alignment and domain information
>TIGR00736 nifR3_rel_arch TIM-barrel protein, putative Back     alignment and domain information
>PRK05835 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>cd04738 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) class 2 Back     alignment and domain information
>cd04740 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain Back     alignment and domain information
>PF01116 F_bP_aldolase: Fructose-bisphosphate aldolase class-II; InterPro: IPR000771 Fructose-bisphosphate aldolase [, ] is a glycolytic enzyme that catalyses the reversible aldol cleavage or condensation of fructose-1,6-bisphosphate into dihydroxyacetone-phosphate and glyceraldehyde 3-phosphate Back     alignment and domain information
>cd02801 DUS_like_FMN Dihydrouridine synthase-like (DUS-like) FMN-binding domain Back     alignment and domain information
>PRK10550 tRNA-dihydrouridine synthase C; Provisional Back     alignment and domain information
>PRK00278 trpC indole-3-glycerol-phosphate synthase; Reviewed Back     alignment and domain information
>PRK13397 3-deoxy-7-phosphoheptulonate synthase; Provisional Back     alignment and domain information
>PRK07084 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>PF05690 ThiG: Thiazole biosynthesis protein ThiG; InterPro: IPR008867 This family consists of several bacterial thiazole biosynthesis protein G sequences Back     alignment and domain information
>PRK13396 3-deoxy-7-phosphoheptulonate synthase; Provisional Back     alignment and domain information
>PRK05198 2-dehydro-3-deoxyphosphooctonate aldolase; Provisional Back     alignment and domain information
>CHL00162 thiG thiamin biosynthesis protein G; Validated Back     alignment and domain information
>PF01207 Dus: Dihydrouridine synthase (Dus); InterPro: IPR001269 Members of this family catalyse the reduction of the 5,6-double bond of a uridine residue on tRNA Back     alignment and domain information
>cd02930 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-binding domain Back     alignment and domain information
>cd02803 OYE_like_FMN_family Old yellow enzyme (OYE)-like FMN binding domain Back     alignment and domain information
>cd02810 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>cd02940 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>PRK12457 2-dehydro-3-deoxyphosphooctonate aldolase; Provisional Back     alignment and domain information
>TIGR01362 KDO8P_synth 3-deoxy-8-phosphooctulonate synthase Back     alignment and domain information
>PRK02083 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>PRK14024 phosphoribosyl isomerase A; Provisional Back     alignment and domain information
>PRK00208 thiG thiazole synthase; Reviewed Back     alignment and domain information
>PRK05437 isopentenyl pyrophosphate isomerase; Provisional Back     alignment and domain information
>cd02809 alpha_hydroxyacid_oxid_FMN Family of homologous FMN-dependent alpha-hydroxyacid oxidizing enzymes Back     alignment and domain information
>TIGR02151 IPP_isom_2 isopentenyl-diphosphate delta-isomerase, type 2 Back     alignment and domain information
>TIGR00735 hisF imidazoleglycerol phosphate synthase, cyclase subunit Back     alignment and domain information
>PRK09196 fructose-1,6-bisphosphate aldolase; Reviewed Back     alignment and domain information
>cd02932 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN binding domain Back     alignment and domain information
>cd02911 arch_FMN Archeal FMN-binding domain Back     alignment and domain information
>cd08205 RuBisCO_IV_RLP Ribulose bisphosphate carboxylase like proteins, Rubisco-Form IV Back     alignment and domain information
>cd04728 ThiG Thiazole synthase (ThiG) is the tetrameric enzyme that is involved in the formation of the thiazole moiety of thiamin pyrophosphate, an essential ubiquitous cofactor that plays an important role in carbohydrate and amino acid metabolism Back     alignment and domain information
>cd02940 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>cd08210 RLP_RrRLP Ribulose bisphosphate carboxylase like proteins (RLPs) similar to R Back     alignment and domain information
>PRK07259 dihydroorotate dehydrogenase 1B; Reviewed Back     alignment and domain information
>TIGR01521 FruBisAldo_II_B fructose-bisphosphate aldolase, class II, Calvin cycle subtype Back     alignment and domain information
>cd00453 FTBP_aldolase_II Fructose/tagarose-bisphosphate aldolase class II Back     alignment and domain information
>PLN03033 2-dehydro-3-deoxyphosphooctonate aldolase; Provisional Back     alignment and domain information
>PRK10128 2-keto-3-deoxy-L-rhamnonate aldolase; Provisional Back     alignment and domain information
>PLN02424 ketopantoate hydroxymethyltransferase Back     alignment and domain information
>cd02801 DUS_like_FMN Dihydrouridine synthase-like (DUS-like) FMN-binding domain Back     alignment and domain information
>cd04734 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 3 Back     alignment and domain information
>PRK08318 dihydropyrimidine dehydrogenase subunit B; Validated Back     alignment and domain information
>cd04741 DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) class 1A FMN-binding domain Back     alignment and domain information
>PLN02591 tryptophan synthase Back     alignment and domain information
>PRK09197 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>cd04730 NPD_like 2-Nitropropane dioxygenase (NPD), one of the nitroalkane oxidizing enzyme families, catalyzes oxidative denitrification of nitroalkanes to their corresponding carbonyl compounds and nitrites Back     alignment and domain information
>cd00946 FBP_aldolase_IIA Class II Type A, Fructose-1,6-bisphosphate (FBP) aldolases Back     alignment and domain information
>TIGR00262 trpA tryptophan synthase, alpha subunit Back     alignment and domain information
>PRK01130 N-acetylmannosamine-6-phosphate 2-epimerase; Provisional Back     alignment and domain information
>cd02811 IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl diphosphate isomerase type 2 (IDI-2) FMN-binding domain Back     alignment and domain information
>PF02548 Pantoate_transf: Ketopantoate hydroxymethyltransferase; InterPro: IPR003700 The panB gene from Escherichia coli encodes the first enzyme of the pantothenate biosynthesis pathway, ketopantoate hydroxymethyltransferase (KPHMT) 2 Back     alignment and domain information
>PRK08318 dihydropyrimidine dehydrogenase subunit B; Validated Back     alignment and domain information
>TIGR00737 nifR3_yhdG putative TIM-barrel protein, nifR3 family Back     alignment and domain information
>cd04733 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 2 Back     alignment and domain information
>cd00564 TMP_TenI Thiamine monophosphate synthase (TMP synthase)/TenI Back     alignment and domain information
>TIGR01037 pyrD_sub1_fam dihydroorotate dehydrogenase (subfamily 1) family protein Back     alignment and domain information
>PRK01033 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>cd03174 DRE_TIM_metallolyase DRE-TIM metallolyase superfamily Back     alignment and domain information
>TIGR00222 panB 3-methyl-2-oxobutanoate hydroxymethyltransferase Back     alignment and domain information
>PRK07226 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>PRK04302 triosephosphate isomerase; Provisional Back     alignment and domain information
>TIGR03151 enACPred_II putative enoyl-(acyl-carrier-protein) reductase II Back     alignment and domain information
>PRK12331 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>PF01791 DeoC: DeoC/LacD family aldolase; InterPro: IPR002915 This family includes the enzyme deoxyribose-phosphate aldolase, which is involved in nucleotide metabolism Back     alignment and domain information
>TIGR01520 FruBisAldo_II_A fructose-bisphosphate aldolase, class II, yeast/E Back     alignment and domain information
>COG5564 Predicted TIM-barrel enzyme, possibly a dioxygenase [General function prediction only] Back     alignment and domain information
>cd04722 TIM_phosphate_binding TIM barrel proteins share a structurally conserved phosphate binding motif and in general share an eight beta/alpha closed barrel structure Back     alignment and domain information
>PRK10558 alpha-dehydro-beta-deoxy-D-glucarate aldolase; Provisional Back     alignment and domain information
>PRK13111 trpA tryptophan synthase subunit alpha; Provisional Back     alignment and domain information
>PRK00043 thiE thiamine-phosphate pyrophosphorylase; Reviewed Back     alignment and domain information
>CHL00200 trpA tryptophan synthase alpha subunit; Provisional Back     alignment and domain information
>cd02931 ER_like_FMN Enoate reductase (ER)-like FMN-binding domain Back     alignment and domain information
>TIGR00736 nifR3_rel_arch TIM-barrel protein, putative Back     alignment and domain information
>cd04729 NanE N-acetylmannosamine-6-phosphate epimerase (NanE) converts N-acetylmannosamine-6-phosphate to N-acetylglucosamine-6-phosphate Back     alignment and domain information
>PF03932 CutC: CutC family; InterPro: IPR005627 Copper transport in Escherichia coli is mediated by the products of at least six genes, cutA, cutB, cutC, cutD, cutE, and cutF Back     alignment and domain information
>cd04728 ThiG Thiazole synthase (ThiG) is the tetrameric enzyme that is involved in the formation of the thiazole moiety of thiamin pyrophosphate, an essential ubiquitous cofactor that plays an important role in carbohydrate and amino acid metabolism Back     alignment and domain information
>PRK14042 pyruvate carboxylase subunit B; Provisional Back     alignment and domain information
>TIGR00126 deoC deoxyribose-phosphate aldolase Back     alignment and domain information
>cd04723 HisA_HisF Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase (HisA) and the cyclase subunit of imidazoleglycerol phosphate synthase (HisF) Back     alignment and domain information
>PF04131 NanE: Putative N-acetylmannosamine-6-phosphate epimerase; InterPro: IPR007260 This family represents a putative ManNAc-6-P-to-GlcNAc-6P epimerase in the N-acetylmannosamine (ManNAc) utilization pathway found mainly in pathogenic bacteria for the reaction: N-acyl-D-glucosamine 6-phosphate = N-acyl-D-mannosamine 6-phosphate It is probably encoded by the yhcJ gene [] Back     alignment and domain information
>PRK09282 pyruvate carboxylase subunit B; Validated Back     alignment and domain information
>cd06557 KPHMT-like Ketopantoate hydroxymethyltransferase (KPHMT) is the first enzyme in the pantothenate biosynthesis pathway Back     alignment and domain information
>PRK09250 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>PLN02858 fructose-bisphosphate aldolase Back     alignment and domain information
>cd06556 ICL_KPHMT Members of the ICL/PEPM_KPHMT enzyme superfamily catalyze the formation and cleavage of either P-C or C-C bonds Back     alignment and domain information
>cd03316 MR_like Mandelate racemase (MR)-like subfamily of the enolase superfamily Back     alignment and domain information
>TIGR01740 pyrF orotidine 5'-phosphate decarboxylase, subfamily 1 Back     alignment and domain information
>PRK15452 putative protease; Provisional Back     alignment and domain information
>PRK06512 thiamine-phosphate pyrophosphorylase; Provisional Back     alignment and domain information
>cd02933 OYE_like_FMN Old yellow enzyme (OYE)-like FMN binding domain Back     alignment and domain information
>KOG2335 consensus tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK12581 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>COG0826 Collagenase and related proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>PRK14041 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>cd03315 MLE_like Muconate lactonizing enzyme (MLE) like subgroup of the enolase superfamily Back     alignment and domain information
>cd00381 IMPDH IMPDH: The catalytic domain of the inosine monophosphate dehydrogenase Back     alignment and domain information
>PRK00311 panB 3-methyl-2-oxobutanoate hydroxymethyltransferase; Reviewed Back     alignment and domain information
>PF04131 NanE: Putative N-acetylmannosamine-6-phosphate epimerase; InterPro: IPR007260 This family represents a putative ManNAc-6-P-to-GlcNAc-6P epimerase in the N-acetylmannosamine (ManNAc) utilization pathway found mainly in pathogenic bacteria for the reaction: N-acyl-D-glucosamine 6-phosphate = N-acyl-D-mannosamine 6-phosphate It is probably encoded by the yhcJ gene [] Back     alignment and domain information
>PRK12330 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>TIGR00693 thiE thiamine-phosphate pyrophosphorylase Back     alignment and domain information
>PF05690 ThiG: Thiazole biosynthesis protein ThiG; InterPro: IPR008867 This family consists of several bacterial thiazole biosynthesis protein G sequences Back     alignment and domain information
>KOG1260 consensus Isocitrate lyase [Energy production and conversion] Back     alignment and domain information
>cd02809 alpha_hydroxyacid_oxid_FMN Family of homologous FMN-dependent alpha-hydroxyacid oxidizing enzymes Back     alignment and domain information
>COG2022 ThiG Uncharacterized enzyme of thiazole biosynthesis [Nucleotide transport and metabolism] Back     alignment and domain information
>cd02803 OYE_like_FMN_family Old yellow enzyme (OYE)-like FMN binding domain Back     alignment and domain information
>cd04735 OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 4 Back     alignment and domain information
>PRK13587 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>PRK14017 galactonate dehydratase; Provisional Back     alignment and domain information
>cd04739 DHOD_like Dihydroorotate dehydrogenase (DHOD) like proteins Back     alignment and domain information
>cd04724 Tryptophan_synthase_alpha Ttryptophan synthase (TRPS) alpha subunit (TSA) Back     alignment and domain information
>cd04741 DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) class 1A FMN-binding domain Back     alignment and domain information
>TIGR01163 rpe ribulose-phosphate 3-epimerase Back     alignment and domain information
>TIGR01769 GGGP geranylgeranylglyceryl phosphate synthase Back     alignment and domain information
>PRK07028 bifunctional hexulose-6-phosphate synthase/ribonuclease regulator; Validated Back     alignment and domain information
>TIGR01304 IMP_DH_rel_2 IMP dehydrogenase family protein Back     alignment and domain information
>PRK00208 thiG thiazole synthase; Reviewed Back     alignment and domain information
>TIGR00259 thylakoid_BtpA membrane complex biogenesis protein, BtpA family Back     alignment and domain information
>PF03437 BtpA: BtpA family; InterPro: IPR005137 Photosystem I (PSI) is a large protein complex embedded within the photosynthetic thylakoid membrane Back     alignment and domain information
>cd02911 arch_FMN Archeal FMN-binding domain Back     alignment and domain information
>COG0352 ThiE Thiamine monophosphate synthase [Coenzyme metabolism] Back     alignment and domain information
>PRK07695 transcriptional regulator TenI; Provisional Back     alignment and domain information
>PRK11840 bifunctional sulfur carrier protein/thiazole synthase protein; Provisional Back     alignment and domain information
>PRK13125 trpA tryptophan synthase subunit alpha; Provisional Back     alignment and domain information
>TIGR01108 oadA oxaloacetate decarboxylase alpha subunit Back     alignment and domain information
>cd04733 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 2 Back     alignment and domain information
>PRK10415 tRNA-dihydrouridine synthase B; Provisional Back     alignment and domain information
>TIGR03239 GarL 2-dehydro-3-deoxyglucarate aldolase Back     alignment and domain information
>COG0826 Collagenase and related proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00682 HMGL-like: HMGL-like of this family is not conserved in other members Back     alignment and domain information
>PRK05286 dihydroorotate dehydrogenase 2; Reviewed Back     alignment and domain information
>PRK12999 pyruvate carboxylase; Reviewed Back     alignment and domain information
>COG0434 SgcQ Predicted TIM-barrel enzyme [General function prediction only] Back     alignment and domain information
>cd00959 DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of the DeoC family Back     alignment and domain information
>cd00381 IMPDH IMPDH: The catalytic domain of the inosine monophosphate dehydrogenase Back     alignment and domain information
>cd03321 mandelate_racemase Mandelate racemase (MR) catalyzes the Mg2+-dependent 1,1-proton transfer reaction that interconverts the enantiomers of mandelic acid Back     alignment and domain information
>PRK05848 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>PRK07565 dihydroorotate dehydrogenase 2; Reviewed Back     alignment and domain information
>PRK13523 NADPH dehydrogenase NamA; Provisional Back     alignment and domain information
>COG0413 PanB Ketopantoate hydroxymethyltransferase [Coenzyme metabolism] Back     alignment and domain information
>PRK06852 aldolase; Validated Back     alignment and domain information
>PRK08649 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PRK02615 thiamine-phosphate pyrophosphorylase; Provisional Back     alignment and domain information
>PRK09490 metH B12-dependent methionine synthase; Provisional Back     alignment and domain information
>TIGR01305 GMP_reduct_1 guanosine monophosphate reductase, eukaryotic Back     alignment and domain information
>PLN02274 inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>PRK05692 hydroxymethylglutaryl-CoA lyase; Provisional Back     alignment and domain information
>PRK07807 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>cd03327 MR_like_2 Mandelate racemase (MR)-like subfamily of the enolase superfamily, subgroup 2 Back     alignment and domain information
>PRK14040 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>cd02932 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN binding domain Back     alignment and domain information
>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein Back     alignment and domain information
>TIGR02127 pyrF_sub2 orotidine 5'-phosphate decarboxylase, subfamily 2 Back     alignment and domain information
>PRK11572 copper homeostasis protein CutC; Provisional Back     alignment and domain information
>PRK11572 copper homeostasis protein CutC; Provisional Back     alignment and domain information
>cd03325 D-galactonate_dehydratase D-galactonate dehydratase catalyses the dehydration of galactonate to 2-keto-3-deoxygalactnate (KDGal), as part of the D-galactonate nonphosphorolytic catabolic Entner-Doudoroff pathway Back     alignment and domain information
>cd04729 NanE N-acetylmannosamine-6-phosphate epimerase (NanE) converts N-acetylmannosamine-6-phosphate to N-acetylglucosamine-6-phosphate Back     alignment and domain information
>PF01207 Dus: Dihydrouridine synthase (Dus); InterPro: IPR001269 Members of this family catalyse the reduction of the 5,6-double bond of a uridine residue on tRNA Back     alignment and domain information
>cd03329 MR_like_4 Mandelate racemase (MR)-like subfamily of the enolase superfamily, subgroup 4 Back     alignment and domain information
>PF01729 QRPTase_C: Quinolinate phosphoribosyl transferase, C-terminal domain; InterPro: IPR002638 Quinolinate phosphoribosyl transferase (QPRTase) or nicotinate-nucleotide pyrophosphorylase 2 Back     alignment and domain information
>cd04824 eu_ALAD_PBGS_cysteine_rich Porphobilinogen synthase (PBGS), which is also called delta-aminolevulinic acid dehydratase (ALAD), catalyzes the condensation of two 5-aminolevulinic acid (ALA) molecules to form the pyrrole porphobilinogen (PBG), which is the second step in the biosynthesis of tetrapyrroles, such as heme, vitamin B12 and chlorophyll Back     alignment and domain information
>PRK01130 N-acetylmannosamine-6-phosphate 2-epimerase; Provisional Back     alignment and domain information
>TIGR02082 metH 5-methyltetrahydrofolate--homocysteine methyltransferase Back     alignment and domain information
>PLN02495 oxidoreductase, acting on the CH-CH group of donors Back     alignment and domain information
>COG0157 NadC Nicotinate-nucleotide pyrophosphorylase [Coenzyme metabolism] Back     alignment and domain information
>PF00490 ALAD: Delta-aminolevulinic acid dehydratase; InterPro: IPR001731 Tetrapyrroles are large macrocyclic compounds derived from a common biosynthetic pathway [] Back     alignment and domain information
>PRK08195 4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic acid aldolase,; Validated Back     alignment and domain information
>PF00478 IMPDH: IMP dehydrogenase / GMP reductase domain; InterPro: IPR001093 Synonym(s): Inosine-5'-monophosphate dehydrogenase, Inosinic acid dehydrogenase; Synonym(s): Guanosine 5'-monophosphate oxidoreductase This entry contains two related enzymes IMP dehydrogenase and GMP reducatase Back     alignment and domain information
>PRK08227 autoinducer 2 aldolase; Validated Back     alignment and domain information
>PRK11858 aksA trans-homoaconitate synthase; Reviewed Back     alignment and domain information
>cd03319 L-Ala-DL-Glu_epimerase L-Ala-D/L-Glu epimerase catalyzes the epimerization of L-Ala-D/L-Glu and other dipeptides Back     alignment and domain information
>cd03328 MR_like_3 Mandelate racemase (MR)-like subfamily of the enolase superfamily, subgroup 3 Back     alignment and domain information
>COG2876 AroA 3-deoxy-D-arabino-heptulosonate 7-phosphate (DAHP) synthase [Amino acid transport and metabolism] Back     alignment and domain information
>cd03323 D-glucarate_dehydratase D-Glucarate dehydratase (GlucD) catalyzes the dehydration of both D-glucarate and L-idarate to form 5-keto-4-deoxy-D-glucarate (5-KDG) , the initial reaction of the catabolic pathway for (D)-glucarate Back     alignment and domain information
>PRK06843 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>cd04736 MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-binding domain Back     alignment and domain information
>TIGR02151 IPP_isom_2 isopentenyl-diphosphate delta-isomerase, type 2 Back     alignment and domain information
>PRK10550 tRNA-dihydrouridine synthase C; Provisional Back     alignment and domain information
>PF03932 CutC: CutC family; InterPro: IPR005627 Copper transport in Escherichia coli is mediated by the products of at least six genes, cutA, cutB, cutC, cutD, cutE, and cutF Back     alignment and domain information
>cd04725 OMP_decarboxylase_like Orotidine 5'-phosphate decarboxylase (ODCase) is a dimeric enzyme that decarboxylates orotidine 5'-monophosphate (OMP) to form uridine 5'-phosphate (UMP), an essential step in the pyrimidine biosynthetic pathway Back     alignment and domain information
>cd04724 Tryptophan_synthase_alpha Ttryptophan synthase (TRPS) alpha subunit (TSA) Back     alignment and domain information
>TIGR03151 enACPred_II putative enoyl-(acyl-carrier-protein) reductase II Back     alignment and domain information
>TIGR00035 asp_race aspartate racemase Back     alignment and domain information
>PLN02489 homocysteine S-methyltransferase Back     alignment and domain information
>PRK00125 pyrF orotidine 5'-phosphate decarboxylase; Reviewed Back     alignment and domain information
>cd04747 OYE_like_5_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 5 Back     alignment and domain information
>cd04738 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) class 2 Back     alignment and domain information
>TIGR01306 GMP_reduct_2 guanosine monophosphate reductase, bacterial Back     alignment and domain information
>PRK11613 folP dihydropteroate synthase; Provisional Back     alignment and domain information
>PLN02334 ribulose-phosphate 3-epimerase Back     alignment and domain information
>TIGR03247 glucar-dehydr glucarate dehydratase Back     alignment and domain information
>cd02811 IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl diphosphate isomerase type 2 (IDI-2) FMN-binding domain Back     alignment and domain information
>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK13523 NADPH dehydrogenase NamA; Provisional Back     alignment and domain information
>COG2022 ThiG Uncharacterized enzyme of thiazole biosynthesis [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>PF13714 PEP_mutase: Phosphoenolpyruvate phosphomutase; PDB: 1ZLP_A 3EOO_C 1UJQ_D 1O5Q_A 2DUA_A 2HJP_A 2HRW_A 2QIW_A 3KZ2_B 3IH1_B Back     alignment and domain information
>cd07948 DRE_TIM_HCS Saccharomyces cerevisiae homocitrate synthase and related proteins, catalytic TIM barrel domain Back     alignment and domain information
>TIGR03128 RuMP_HxlA 3-hexulose-6-phosphate synthase Back     alignment and domain information
>cd03326 MR_like_1 Mandelate racemase (MR)-like subfamily of the enolase superfamily, subgroup 1 Back     alignment and domain information
>PF02581 TMP-TENI: Thiamine monophosphate synthase/TENI; InterPro: IPR003733 Thiamine monophosphate synthase (TMP) (2 Back     alignment and domain information
>TIGR00640 acid_CoA_mut_C methylmalonyl-CoA mutase C-terminal domain Back     alignment and domain information
>cd04737 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding domain Back     alignment and domain information
>PLN02746 hydroxymethylglutaryl-CoA lyase Back     alignment and domain information
>PRK15452 putative protease; Provisional Back     alignment and domain information
>cd07937 DRE_TIM_PC_TC_5S Pyruvate carboxylase and Transcarboxylase 5S, carboxyltransferase domain Back     alignment and domain information
>TIGR02311 HpaI 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase Back     alignment and domain information
>cd00331 IGPS Indole-3-glycerol phosphate synthase (IGPS); an enzyme in the tryptophan biosynthetic pathway, catalyzing the ring closure reaction of 1-(o-carboxyphenylamino)-1-deoxyribulose-5-phosphate (CdRP) to indole-3-glycerol phosphate (IGP), accompanied by the release of carbon dioxide and water Back     alignment and domain information
>cd03332 LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-binding domain Back     alignment and domain information
>PRK09485 mmuM homocysteine methyltransferase; Provisional Back     alignment and domain information
>PRK10128 2-keto-3-deoxy-L-rhamnonate aldolase; Provisional Back     alignment and domain information
>TIGR02660 nifV_homocitr homocitrate synthase NifV Back     alignment and domain information
>PRK05437 isopentenyl pyrophosphate isomerase; Provisional Back     alignment and domain information
>TIGR01496 DHPS dihydropteroate synthase Back     alignment and domain information
>PRK08385 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>PF00478 IMPDH: IMP dehydrogenase / GMP reductase domain; InterPro: IPR001093 Synonym(s): Inosine-5'-monophosphate dehydrogenase, Inosinic acid dehydrogenase; Synonym(s): Guanosine 5'-monophosphate oxidoreductase This entry contains two related enzymes IMP dehydrogenase and GMP reducatase Back     alignment and domain information
>TIGR03239 GarL 2-dehydro-3-deoxyglucarate aldolase Back     alignment and domain information
>TIGR01305 GMP_reduct_1 guanosine monophosphate reductase, eukaryotic Back     alignment and domain information
>cd07945 DRE_TIM_CMS Leptospira interrogans citramalate synthase (CMS) and related proteins, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>cd00564 TMP_TenI Thiamine monophosphate synthase (TMP synthase)/TenI Back     alignment and domain information
>cd04726 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxylase (KGPDC) and D-arabino-3-hexulose-6-phosphate synthase (HPS) Back     alignment and domain information
>PRK10558 alpha-dehydro-beta-deoxy-D-glucarate aldolase; Provisional Back     alignment and domain information
>cd03322 rpsA The starvation sensing protein RpsA from E Back     alignment and domain information
>PRK07107 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PRK02506 dihydroorotate dehydrogenase 1A; Reviewed Back     alignment and domain information
>PRK06096 molybdenum transport protein ModD; Provisional Back     alignment and domain information
>PRK09283 delta-aminolevulinic acid dehydratase; Validated Back     alignment and domain information
>TIGR02708 L_lactate_ox L-lactate oxidase Back     alignment and domain information
>COG3010 NanE Putative N-acetylmannosamine-6-phosphate epimerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK02714 O-succinylbenzoate synthase; Provisional Back     alignment and domain information
>PRK00230 orotidine 5'-phosphate decarboxylase; Reviewed Back     alignment and domain information
>cd07941 DRE_TIM_LeuA3 Desulfobacterium autotrophicum LeuA3 and related proteins, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>PRK05105 O-succinylbenzoate synthase; Provisional Back     alignment and domain information
>PF02219 MTHFR: Methylenetetrahydrofolate reductase; InterPro: IPR003171 This family includes the 5,10-methylenetetrahydrofolate reductase 1 Back     alignment and domain information
>COG2513 PrpB PEP phosphonomutase and related enzymes [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK10605 N-ethylmaleimide reductase; Provisional Back     alignment and domain information
>cd03324 rTSbeta_L-fuconate_dehydratase Human rTS beta is encoded by the rTS gene which, through alternative RNA splicing, also encodes rTS alpha whose mRNA is complementary to thymidylate synthase mRNA Back     alignment and domain information
>cd07943 DRE_TIM_HOA 4-hydroxy-2-oxovalerate aldolase, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>PF01729 QRPTase_C: Quinolinate phosphoribosyl transferase, C-terminal domain; InterPro: IPR002638 Quinolinate phosphoribosyl transferase (QPRTase) or nicotinate-nucleotide pyrophosphorylase 2 Back     alignment and domain information
>cd02930 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-binding domain Back     alignment and domain information
>PRK05692 hydroxymethylglutaryl-CoA lyase; Provisional Back     alignment and domain information
>PF00977 His_biosynth: Histidine biosynthesis protein; InterPro: IPR006062 Histidine is formed by several complex and distinct biochemical reactions catalysed by eight enzymes Back     alignment and domain information
>PF00290 Trp_syntA: Tryptophan synthase alpha chain; InterPro: IPR002028 Tryptophan synthase (4 Back     alignment and domain information
>TIGR03217 4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase Back     alignment and domain information
>cd04730 NPD_like 2-Nitropropane dioxygenase (NPD), one of the nitroalkane oxidizing enzyme families, catalyzes oxidative denitrification of nitroalkanes to their corresponding carbonyl compounds and nitrites Back     alignment and domain information
>PLN02274 inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>TIGR00742 yjbN tRNA dihydrouridine synthase A Back     alignment and domain information
>PRK06559 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein Back     alignment and domain information
>PLN02535 glycolate oxidase Back     alignment and domain information
>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed Back     alignment and domain information
>cd02922 FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding domain Back     alignment and domain information
>cd02929 TMADH_HD_FMN Trimethylamine dehydrogenase (TMADH) and histamine dehydrogenase (HD) FMN-binding domain Back     alignment and domain information
>PRK11858 aksA trans-homoaconitate synthase; Reviewed Back     alignment and domain information
>PRK06978 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>PRK08649 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>TIGR02311 HpaI 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase Back     alignment and domain information
>PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed Back     alignment and domain information
>CHL00200 trpA tryptophan synthase alpha subunit; Provisional Back     alignment and domain information
>PRK08195 4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic acid aldolase,; Validated Back     alignment and domain information
>PRK05458 guanosine 5'-monophosphate oxidoreductase; Provisional Back     alignment and domain information
>cd07944 DRE_TIM_HOA_like 4-hydroxy-2-oxovalerate aldolase-like, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>PRK09389 (R)-citramalate synthase; Provisional Back     alignment and domain information
>cd04732 HisA HisA Back     alignment and domain information
>PRK05458 guanosine 5'-monophosphate oxidoreductase; Provisional Back     alignment and domain information
>PLN02898 HMP-P kinase/thiamin-monophosphate pyrophosphorylase Back     alignment and domain information
>PRK07695 transcriptional regulator TenI; Provisional Back     alignment and domain information
>CHL00162 thiG thiamin biosynthesis protein G; Validated Back     alignment and domain information
>TIGR02320 PEP_mutase phosphoenolpyruvate phosphomutase Back     alignment and domain information
>PLN02495 oxidoreductase, acting on the CH-CH group of donors Back     alignment and domain information
>PRK05096 guanosine 5'-monophosphate oxidoreductase; Provisional Back     alignment and domain information
>PRK11197 lldD L-lactate dehydrogenase; Provisional Back     alignment and domain information
>COG0821 gcpE 1-hydroxy-2-methyl-2-(e)-butenyl 4-diphosphate synthase [Lipid metabolism] Back     alignment and domain information
>PRK12858 tagatose 1,6-diphosphate aldolase; Reviewed Back     alignment and domain information
>PRK00366 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase; Reviewed Back     alignment and domain information
>COG0214 SNZ1 Pyridoxine biosynthesis enzyme [Coenzyme metabolism] Back     alignment and domain information
>cd00739 DHPS DHPS subgroup of Pterin binding enzymes Back     alignment and domain information
>PRK05742 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>cd02933 OYE_like_FMN Old yellow enzyme (OYE)-like FMN binding domain Back     alignment and domain information
>PRK07107 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>COG0269 SgbH 3-hexulose-6-phosphate synthase and related proteins [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11815 tRNA-dihydrouridine synthase A; Provisional Back     alignment and domain information
>cd07948 DRE_TIM_HCS Saccharomyces cerevisiae homocitrate synthase and related proteins, catalytic TIM barrel domain Back     alignment and domain information
>COG0284 PyrF Orotidine-5'-phosphate decarboxylase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK10605 N-ethylmaleimide reductase; Provisional Back     alignment and domain information
>PRK13753 dihydropteroate synthase; Provisional Back     alignment and domain information
>COG0107 HisF Imidazoleglycerol-phosphate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00612 ispG_gcpE 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase Back     alignment and domain information
>TIGR03217 4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase Back     alignment and domain information
>COG1794 RacX Aspartate racemase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK06843 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>TIGR01334 modD putative molybdenum utilization protein ModD Back     alignment and domain information
>PLN02826 dihydroorotate dehydrogenase Back     alignment and domain information
>PRK13384 delta-aminolevulinic acid dehydratase; Provisional Back     alignment and domain information
>PRK05581 ribulose-phosphate 3-epimerase; Validated Back     alignment and domain information
>PRK07534 methionine synthase I; Validated Back     alignment and domain information
>PLN02746 hydroxymethylglutaryl-CoA lyase Back     alignment and domain information
>PRK05848 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>PRK13957 indole-3-glycerol-phosphate synthase; Provisional Back     alignment and domain information
>cd00452 KDPG_aldolase KDPG and KHG aldolase Back     alignment and domain information
>COG0167 PyrD Dihydroorotate dehydrogenase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR02090 LEU1_arch isopropylmalate/citramalate/homocitrate synthases Back     alignment and domain information
>PRK00507 deoxyribose-phosphate aldolase; Provisional Back     alignment and domain information
>PRK13813 orotidine 5'-phosphate decarboxylase; Provisional Back     alignment and domain information
>PRK09140 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; Reviewed Back     alignment and domain information
>TIGR01334 modD putative molybdenum utilization protein ModD Back     alignment and domain information
>TIGR01927 menC_gamma/gm+ o-succinylbenzoic acid (OSB) synthetase Back     alignment and domain information
>cd02812 PcrB_like PcrB_like proteins Back     alignment and domain information
>PF02679 ComA: (2R)-phospho-3-sulfolactate synthase (ComA); InterPro: IPR003830 Methanogenic archaea produce methane via the anaerobic reduction of acetate or single carbon compounds [] Back     alignment and domain information
>PRK00043 thiE thiamine-phosphate pyrophosphorylase; Reviewed Back     alignment and domain information
>PRK07896 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>cd04722 TIM_phosphate_binding TIM barrel proteins share a structurally conserved phosphate binding motif and in general share an eight beta/alpha closed barrel structure Back     alignment and domain information
>TIGR02090 LEU1_arch isopropylmalate/citramalate/homocitrate synthases Back     alignment and domain information
>KOG1606 consensus Stationary phase-induced protein, SOR/SNZ family [Coenzyme transport and metabolism] Back     alignment and domain information
>TIGR00034 aroFGH phospho-2-dehydro-3-deoxyheptonate aldolase Back     alignment and domain information
>cd03318 MLE Muconate Lactonizing Enzyme (MLE), an homooctameric enzyme, catalyses the conversion of cis,cis-muconate (CCM) to muconolactone (ML) in the catechol branch of the beta-ketoadipate pathway Back     alignment and domain information
>PF03328 HpcH_HpaI: HpcH/HpaI aldolase/citrate lyase family; InterPro: IPR005000 This family includes 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase (4 Back     alignment and domain information
>TIGR01304 IMP_DH_rel_2 IMP dehydrogenase family protein Back     alignment and domain information
>PRK03512 thiamine-phosphate pyrophosphorylase; Provisional Back     alignment and domain information
>TIGR03326 rubisco_III ribulose bisphosphate carboxylase, type III Back     alignment and domain information
>cd08207 RLP_NonPhot Ribulose bisphosphate carboxylase like proteins from nonphototrophic bacteria Back     alignment and domain information
>PRK04452 acetyl-CoA decarbonylase/synthase complex subunit delta; Provisional Back     alignment and domain information
>PF01070 FMN_dh: FMN-dependent dehydrogenase; InterPro: IPR000262 A number of oxidoreductases that act on alpha-hydroxy acids and which are FMN-containing flavoproteins have been shown [, , ] to be structurally related Back     alignment and domain information
>TIGR02708 L_lactate_ox L-lactate oxidase Back     alignment and domain information
>TIGR00973 leuA_bact 2-isopropylmalate synthase, bacterial type Back     alignment and domain information
>COG3836 HpcH 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG0800 Eda 2-keto-3-deoxy-6-phosphogluconate aldolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02428 lipoic acid synthase Back     alignment and domain information
>cd08209 RLP_DK-MTP-1-P-enolase 2,3-diketo-5-methylthiopentyl-1-phosphate enolase Back     alignment and domain information
>COG4948 L-alanine-DL-glutamate epimerase and related enzymes of enolase superfamily [Cell envelope biogenesis, outer membrane / General function prediction only] Back     alignment and domain information
>COG3010 NanE Putative N-acetylmannosamine-6-phosphate epimerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN03228 methylthioalkylmalate synthase; Provisional Back     alignment and domain information
>cd08213 RuBisCO_large_III Ribulose bisphosphate carboxylase large chain, Form III Back     alignment and domain information
>PRK06543 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>PLN02493 probable peroxisomal (S)-2-hydroxy-acid oxidase Back     alignment and domain information
>PRK05718 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>cd00429 RPE Ribulose-5-phosphate 3-epimerase (RPE) Back     alignment and domain information
>TIGR03849 arch_ComA phosphosulfolactate synthase Back     alignment and domain information
>PF03060 NMO: Nitronate monooxygenase; InterPro: IPR004136 2-Nitropropane dioxygenase (1 Back     alignment and domain information
>PRK06015 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>COG5016 Pyruvate/oxaloacetate carboxyltransferase [Energy production and conversion] Back     alignment and domain information
>PLN02591 tryptophan synthase Back     alignment and domain information
>PRK06106 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>PLN02980 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding / thiamin pyrophosphate binding Back     alignment and domain information
>cd04737 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding domain Back     alignment and domain information
>PRK07114 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PRK13307 bifunctional formaldehyde-activating enzyme/3-hexulose-6-phosphate synthase; Provisional Back     alignment and domain information
>PLN02321 2-isopropylmalate synthase Back     alignment and domain information
>cd04734 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 3 Back     alignment and domain information
>TIGR02129 hisA_euk phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase, eukaryotic type Back     alignment and domain information
>TIGR01182 eda Entner-Doudoroff aldolase Back     alignment and domain information
>PRK08999 hypothetical protein; Provisional Back     alignment and domain information
>cd07944 DRE_TIM_HOA_like 4-hydroxy-2-oxovalerate aldolase-like, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>PLN02979 glycolate oxidase Back     alignment and domain information
>COG1830 FbaB DhnA-type fructose-1,6-bisphosphate aldolase and related enzymes [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd00384 ALAD_PBGS Porphobilinogen synthase (PBGS), which is also called delta-aminolevulinic acid dehydratase (ALAD), catalyzes the condensation of two 5-aminolevulinic acid (ALA) molecules to form the pyrrole porphobilinogen (PBG), which is the second step in the biosynthesis of tetrapyrroles, such as heme, vitamin B12 and chlorophyll Back     alignment and domain information
>PF01180 DHO_dh: Dihydroorotate dehydrogenase; InterPro: IPR012135 Dihydroorotate dehydrogenase (DHOD), also known as dihydroorotate oxidase, catalyses the fourth step in de novo pyrimidine biosynthesis, the stereospecific oxidation of (S)-dihydroorotate to orotate, which is the only redox reaction in this pathway Back     alignment and domain information
>cd02922 FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding domain Back     alignment and domain information
>PF00682 HMGL-like: HMGL-like of this family is not conserved in other members Back     alignment and domain information
>COG0159 TrpA Tryptophan synthase alpha chain [Amino acid transport and metabolism] Back     alignment and domain information
>PRK00915 2-isopropylmalate synthase; Validated Back     alignment and domain information
>PF02581 TMP-TENI: Thiamine monophosphate synthase/TENI; InterPro: IPR003733 Thiamine monophosphate synthase (TMP) (2 Back     alignment and domain information
>PRK02506 dihydroorotate dehydrogenase 1A; Reviewed Back     alignment and domain information
>cd08148 RuBisCO_large Ribulose bisphosphate carboxylase large chain Back     alignment and domain information
>PRK13111 trpA tryptophan synthase subunit alpha; Provisional Back     alignment and domain information
>cd08212 RuBisCO_large_I Ribulose bisphosphate carboxylase large chain, Form I Back     alignment and domain information
>PRK09016 quinolinate phosphoribosyltransferase; Validated Back     alignment and domain information
>COG0113 HemB Delta-aminolevulinic acid dehydratase [Coenzyme metabolism] Back     alignment and domain information
>TIGR01036 pyrD_sub2 dihydroorotate dehydrogenase, subfamily 2 Back     alignment and domain information
>PRK05500 bifunctional orotidine 5'-phosphate decarboxylase/orotate phosphoribosyltransferase protein; Validated Back     alignment and domain information
>cd04726 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxylase (KGPDC) and D-arabino-3-hexulose-6-phosphate synthase (HPS) Back     alignment and domain information
>PRK08072 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>COG0191 Fba Fructose/tagatose bisphosphate aldolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00007 phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase Back     alignment and domain information
>PRK00278 trpC indole-3-glycerol-phosphate synthase; Reviewed Back     alignment and domain information
>TIGR01036 pyrD_sub2 dihydroorotate dehydrogenase, subfamily 2 Back     alignment and domain information
>PLN03228 methylthioalkylmalate synthase; Provisional Back     alignment and domain information
>PLN02716 nicotinate-nucleotide diphosphorylase (carboxylating) Back     alignment and domain information
>PRK09389 (R)-citramalate synthase; Provisional Back     alignment and domain information
>PF02574 S-methyl_trans: Homocysteine S-methyltransferase; InterPro: IPR003726 S-methylmethionine: homocysteine methyltransferase 2 Back     alignment and domain information
>PRK01033 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>CHL00040 rbcL ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit Back     alignment and domain information
>cd00951 KDGDH 5-dehydro-4-deoxyglucarate dehydratase, also called 5-keto-4-deoxy-glucarate dehydratase (KDGDH), which is member of dihydrodipicolinate synthase (DHDPS) family that comprises several pyruvate-dependent class I aldolases Back     alignment and domain information
>COG0106 HisA Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK00915 2-isopropylmalate synthase; Validated Back     alignment and domain information
>cd08208 RLP_Photo Ribulose bisphosphate carboxylase like proteins from phototrophic bacteria Back     alignment and domain information
>PRK04208 rbcL ribulose bisophosphate carboxylase; Reviewed Back     alignment and domain information
>PRK07896 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>COG0119 LeuA Isopropylmalate/homocitrate/citramalate synthases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK15129 L-Ala-D/L-Glu epimerase; Provisional Back     alignment and domain information
>cd04731 HisF The cyclase subunit of imidazoleglycerol phosphate synthase (HisF) Back     alignment and domain information
>TIGR01306 GMP_reduct_2 guanosine monophosphate reductase, bacterial Back     alignment and domain information
>cd03320 OSBS o-Succinylbenzoate synthase (OSBS) catalyzes the conversion of 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate (SHCHC) to 4-(2'-carboxyphenyl)-4-oxobutyrate (o-succinylbenzoate or OSB), a reaction in the menaquinone biosynthetic pathway Back     alignment and domain information
>cd07938 DRE_TIM_HMGL 3-hydroxy-3-methylglutaryl-CoA lyase, catalytic TIM barrel domain Back     alignment and domain information
>PRK02615 thiamine-phosphate pyrophosphorylase; Provisional Back     alignment and domain information
>PRK02083 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>PF01180 DHO_dh: Dihydroorotate dehydrogenase; InterPro: IPR012135 Dihydroorotate dehydrogenase (DHOD), also known as dihydroorotate oxidase, catalyses the fourth step in de novo pyrimidine biosynthesis, the stereospecific oxidation of (S)-dihydroorotate to orotate, which is the only redox reaction in this pathway Back     alignment and domain information
>TIGR03586 PseI pseudaminic acid synthase Back     alignment and domain information
>PRK08508 biotin synthase; Provisional Back     alignment and domain information
>COG1902 NemA NADH:flavin oxidoreductases, Old Yellow Enzyme family [Energy production and conversion] Back     alignment and domain information
>COG3142 CutC Uncharacterized protein involved in copper resistance [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK08645 bifunctional homocysteine S-methyltransferase/5,10-methylenetetrahydrofolate reductase protein; Reviewed Back     alignment and domain information
>PRK04128 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>PRK13585 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>PRK15072 bifunctional D-altronate/D-mannonate dehydratase; Provisional Back     alignment and domain information
>cd07940 DRE_TIM_IPMS 2-isopropylmalate synthase (IPMS), N-terminal catalytic TIM barrel domain Back     alignment and domain information
>PRK07807 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>COG2185 Sbm Methylmalonyl-CoA mutase, C-terminal domain/subunit (cobalamin-binding) [Lipid metabolism] Back     alignment and domain information
>TIGR02660 nifV_homocitr homocitrate synthase NifV Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query456
1zlp_A318 Petal Death Protein Psr132 With Cysteine-Linked Glu 2e-40
3fa3_A302 Crystal Structure Of 2,3-Dimethylmalate Lyase, A Pe 2e-39
4iqd_A305 Crystal Structure Of Carboxyvinyl-carboxyphosphonat 9e-37
3lye_A307 Crystal Structure Of Oxaloacetate Acetylhydrolase L 3e-35
1mum_A295 Structure Of The 2-Methylisocitrate Lyase (Prpb) Fr 2e-33
1ujq_A305 Crystal Structure Of 2-Methylisocitrate Lyase (Prpb 5e-33
1xg3_A295 Crystal Structure Of The C123s 2-Methylisocitrate L 3e-32
3eoo_A298 2.9a Crystal Structure Of Methyl-Isocitrate Lyase F 6e-27
3b8i_A287 Crystal Structure Of Oxaloacetate Decarboxylase Fro 4e-19
2dua_A290 Crystal Structure Of Phosphonopyruvate Hydrolase Co 2e-16
1m1b_A295 Crystal Structure Of Phosphoenolpyruvate Mutase Com 2e-15
1s2u_A295 Crystal Structure Of The D58a Phosphoenolpyruvate M 3e-14
1pym_A295 Phosphoenolpyruvate Mutase From Mollusk In With Bou 3e-14
2ze3_A275 Crystal Structure Of Dfa0005 Complexed With Alpha-K 5e-12
3i4e_A439 Crystal Structure Of Isocitrate Lyase From Burkhold 2e-10
3eol_A433 2.0a Crystal Structure Of Isocitrate Lyase From Bru 6e-10
3e5b_A433 2.4 A Crystal Structure Of Isocitrate Lyase From Br 1e-09
1igw_A434 Crystal Structure Of The Isocitrate Lyase From The 2e-09
3lg3_A435 1.4a Crystal Structure Of Isocitrate Lyase From Yer 2e-09
1f61_A429 Crystal Structure Of Isocitrate Lyase From Mycobact 6e-09
1dqu_A538 Crystal Structure Of The Isocitrate Lyase From Aspe 1e-08
1f8i_A429 Crystal Structure Of Isocitrate Lyase:nitropropiona 1e-07
2qiw_A255 Crystal Structure Of A Putative Phosphoenolpyruvate 1e-05
>pdb|1ZLP|A Chain A, Petal Death Protein Psr132 With Cysteine-Linked Glutaraldehyde Forming A Thiohemiacetal Adduct Length = 318 Back     alignment and structure 
Iteration: 1

 Score =  163 bits (413), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 108/287 (37%), Positives = 165/287 (57%), Gaps = 11/287 (3%)
Query: 80  SLRQILELPGVHQGPACFDALSAKLVEKXXXXXXXXXXXXXXAARLALPDTGFISYGEMV 139
           ++ +++E  G    P   DALSA +VEK              AA L LPD G ++  E+V
Sbjct: 30  TMHRLIEEHGSVLMPGVQDALSAAVVEKTGFHAAFVSGYSVSAAMLGLPDFGLLTTTEVV 89
Query: 140 DQGQLITQAV-SIPVIGDGDNGYGNAMNVKRTVKGYIKAGFAGIILEDQVSPKGCGHTRG 198
           +  + IT A  ++ V+ DGD G G  +NV+R ++  I AG  G+ LEDQV PK CGH RG
Sbjct: 90  EATRRITAAAPNLCVVVDGDTGGGGPLNVQRFIRELISAGAKGVFLEDQVWPKKCGHMRG 149
Query: 199 RKVVSREEAVMRIKAAVDARKESGSDIVIVARTDSRQALSLEESLRRSRAFADAGADVLF 258
           + VV  EE  ++I AA +A  +  SD  +VARTD+R    LEE +RR+  + +AGAD  F
Sbjct: 150 KAVVPAEEHALKIAAAREAIGD--SDFFLVARTDARAPHGLEEGIRRANLYKEAGADATF 207
Query: 259 IDALASKEEMKAFCEISPLVP--KMANMLEGGGKTPILNPLELEELGFKLVAYPLSLIGV 316
           ++A A+ +E+K   E+S      ++ANM+E GGKTP+  P E +E+GF L+A+ L+ +  
Sbjct: 208 VEAPANVDELK---EVSAKTKGLRIANMIE-GGKTPLHTPEEFKEMGFHLIAHSLTAVYA 263
Query: 317 SVRAMQDALTAI--KGGRIPSPGSMPSFQEIKETLGFNTYYEEEKRY 361
           + RA+ + +  +  KG        M +F E  E +   ++YE E ++
Sbjct: 264 TARALVNIMKILKEKGTTRDDLDQMATFSEFNELISLESWYEMESKF 310
>pdb|3FA3|A Chain A, Crystal Structure Of 2,3-Dimethylmalate Lyase, A Pep MutaseISOCITRATE Lyase Superfamily Member, Trigonal Crystal Form Length = 302 Back     alignment and structure
>pdb|4IQD|A Chain A, Crystal Structure Of Carboxyvinyl-carboxyphosphonate Phosphorylmutase From Bacillus Anthracis Length = 305 Back     alignment and structure
>pdb|3LYE|A Chain A, Crystal Structure Of Oxaloacetate Acetylhydrolase Length = 307 Back     alignment and structure
>pdb|1MUM|A Chain A, Structure Of The 2-Methylisocitrate Lyase (Prpb) From Escherichia Coli Length = 295 Back     alignment and structure
>pdb|1UJQ|A Chain A, Crystal Structure Of 2-Methylisocitrate Lyase (Prpb) From Salmonella Enterica Serovar Typhimurium Length = 305 Back     alignment and structure
>pdb|1XG3|A Chain A, Crystal Structure Of The C123s 2-Methylisocitrate Lyase Mutant From Escherichia Coli In Complex With The Reaction Product, Mg(Ii)-Pyruvate And Succinate Length = 295 Back     alignment and structure
>pdb|3EOO|A Chain A, 2.9a Crystal Structure Of Methyl-Isocitrate Lyase From Burkholderia Pseudomallei Length = 298 Back     alignment and structure
>pdb|3B8I|A Chain A, Crystal Structure Of Oxaloacetate Decarboxylase From Pseudomonas Aeruginosa (Pa4872) In Complex With Oxalate And Mg2+. Length = 287 Back     alignment and structure
>pdb|2DUA|A Chain A, Crystal Structure Of Phosphonopyruvate Hydrolase Complex With Oxalate And Mg++ Length = 290 Back     alignment and structure
>pdb|1M1B|A Chain A, Crystal Structure Of Phosphoenolpyruvate Mutase Complexed With Sulfopyruvate Length = 295 Back     alignment and structure
>pdb|1S2U|A Chain A, Crystal Structure Of The D58a Phosphoenolpyruvate Mutase Mutant Protein Length = 295 Back     alignment and structure
>pdb|1PYM|A Chain A, Phosphoenolpyruvate Mutase From Mollusk In With Bound Mg2-oxalate Length = 295 Back     alignment and structure
>pdb|2ZE3|A Chain A, Crystal Structure Of Dfa0005 Complexed With Alpha-Ketoglutarate: A Novel Member Of The IclPEPM SUPERFAMILY FROM ALKALI-Tolerant Deinococcus Ficus Length = 275 Back     alignment and structure
>pdb|3I4E|A Chain A, Crystal Structure Of Isocitrate Lyase From Burkholderia Pseudomallei Length = 439 Back     alignment and structure
>pdb|3EOL|A Chain A, 2.0a Crystal Structure Of Isocitrate Lyase From Brucella Melitensis (P43212) Length = 433 Back     alignment and structure
>pdb|3E5B|A Chain A, 2.4 A Crystal Structure Of Isocitrate Lyase From Brucella Melitensis Length = 433 Back     alignment and structure
>pdb|1IGW|A Chain A, Crystal Structure Of The Isocitrate Lyase From The A219c Mutant Of Escherichia Coli Length = 434 Back     alignment and structure
>pdb|3LG3|A Chain A, 1.4a Crystal Structure Of Isocitrate Lyase From Yersinia Pestis Co92 Length = 435 Back     alignment and structure
>pdb|1F61|A Chain A, Crystal Structure Of Isocitrate Lyase From Mycobacterium Tuberculosis Length = 429 Back     alignment and structure
>pdb|1DQU|A Chain A, Crystal Structure Of The Isocitrate Lyase From Aspergillus Nidulans Length = 538 Back     alignment and structure
>pdb|1F8I|A Chain A, Crystal Structure Of Isocitrate Lyase:nitropropionate:glyoxylate Complex From Mycobacterium Tuberculosis Length = 429 Back     alignment and structure
>pdb|2QIW|A Chain A, Crystal Structure Of A Putative Phosphoenolpyruvate Phosphonomutase (ncgl1015, Cgl1060) From Corynebacterium Glutamicum Atcc 13032 At 1.80 A Resolution Length = 255 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query456
3fa4_A302 2,3-dimethylmalate lyase; alpha/beta barrel, helix 1e-139
1zlp_A318 PSR132, petal death protein; TIM-barrel, helix swa 1e-138
3lye_A307 Oxaloacetate acetyl hydrolase; (alpha/beta)8 barre 1e-135
3eoo_A298 Methylisocitrate lyase; seattle structural genomic 1e-135
3ih1_A305 Methylisocitrate lyase; alpha-beta structure, TIM- 1e-133
1xg4_A295 Probable methylisocitrate lyase; 2-methylisocitrat 1e-132
3b8i_A287 PA4872 oxaloacetate decarboxylase; alpha/beta barr 1e-125
1s2w_A295 Phosphoenolpyruvate phosphomutase; phosphonopyruva 1e-123
2hjp_A290 Phosphonopyruvate hydrolase; phosporus-Ca cleavage 1e-120
2ze3_A275 DFA0005; organic waste LEFT-OVER decomposition, al 1e-90
2qiw_A255 PEP phosphonomutase; structural genomics, joint ce 2e-82
3i4e_A439 Isocitrate lyase; structural genomics, seattle str 2e-30
1f8m_A429 Isocitrate lyase, ICL; alpha-beta barrel, helix-sw 3e-30
3eol_A433 Isocitrate lyase; seattle structural center for in 4e-30
1dqu_A538 Isocitrate lyase; beta barrel; 2.80A {Emericella n 1e-26
3lg3_A435 Isocitrate lyase; conserved, CD, proteomics eviden 3e-26
2p10_A286 MLL9387 protein; putative phosphonopyruvate hydrol 6e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-08
>3fa4_A 2,3-dimethylmalate lyase; alpha/beta barrel, helix swapping; 2.18A {Aspergillus niger} PDB: 3fa3_A Length = 302 Back     alignment and structure
 Score =  400 bits (1030), Expect = e-139
 Identities = 102/300 (34%), Positives = 162/300 (54%), Gaps = 7/300 (2%)

Query: 76  SPAKSLRQILELPG-VHQGPACFDALSAKLVEKSGFSFCFTSGFSISAARLALPDTGFIS 134
           + A SLR+ LE P      P  +D LSA++   +GF   + +G   +A+     D G  +
Sbjct: 4   TAATSLRRALENPDSFIVAPGVYDGLSARVALSAGFDALYMTGAGTAASVHGQADLGICT 63

Query: 135 YGEMVDQGQLITQA-VSIPVIGDGDNGYGNAMNVKRTVKGYIKAGFAGIILEDQVSPKGC 193
             +M    ++I+    S PVI D D GYG  + V RT + Y ++G A   +EDQV  K C
Sbjct: 64  LNDMRANAEMISNISPSTPVIADADTGYGGPIMVARTTEQYSRSGVAAFHIEDQVQTKRC 123

Query: 194 GHTRGRKVVSREEAVMRIKAAVDARKESGSDIVIVARTDSRQALSLEESLRRSRAFADAG 253
           GH  G+ +V  +  V RI+AAV AR+  GSDIV++ARTDS Q    EES+ R RA  DAG
Sbjct: 124 GHLAGKILVDTDTYVTRIRAAVQARQRIGSDIVVIARTDSLQTHGYEESVARLRAARDAG 183

Query: 254 ADVLFIDALASKEEMKAFCEISPLVPKMANMLEGGGKTPILNPLELEELGFKLVAYPLSL 313
           ADV F++ + S+E  +   +     P + NM+E  G TP ++  E +E+GF+++ +P + 
Sbjct: 184 ADVGFLEGITSREMARQVIQDLAGWPLLLNMVE-HGATPSISAAEAKEMGFRIIIFPFAA 242

Query: 314 IGVSVRAMQDALTAIKGGRIPSPGSMPSFQEIKETLGFNTYYEEEKRYATSMRRLSSENG 373
           +G +V AM++A+  +K   IP      + Q +    G +   + + +   +    + + G
Sbjct: 243 LGPAVAAMREAMEKLKRDGIPGLDKEMTPQMLFRVCGLDESMKVDAQAGGA----AFDGG 298
>1zlp_A PSR132, petal death protein; TIM-barrel, helix swapping,2-ethyl-3-methylmalate lyase, 2-P methylmalate lyase, lyase/PEP mutase superfamily; 2.70A {Dianthus caryophyllus} Length = 318 Back     alignment and structure
>3lye_A Oxaloacetate acetyl hydrolase; (alpha/beta)8 barrel; 1.30A {Cryphonectria parasitica} PDB: 3m0j_A* 3m0k_A Length = 307 Back     alignment and structure
>3eoo_A Methylisocitrate lyase; seattle structural genomics center for infectious disease, ssgcid; 2.90A {Burkholderia pseudomallei 1655} Length = 298 Back     alignment and structure
>1xg4_A Probable methylisocitrate lyase; 2-methylisocitrate lyase/inhibitor complex, isocitrate lyase superfamily; HET: ICT; 1.60A {Escherichia coli} PDB: 1xg3_A* 1mum_A 1oqf_A 1ujq_A 1o5q_A Length = 295 Back     alignment and structure
>3b8i_A PA4872 oxaloacetate decarboxylase; alpha/beta barrel, helix swapping, lyase; 1.90A {Pseudomonas aeruginosa} Length = 287 Back     alignment and structure
>1s2w_A Phosphoenolpyruvate phosphomutase; phosphonopyruvate, phosphonate biosynthesis pathway, isomera; 1.69A {Mytilus edulis} SCOP: c.1.12.7 PDB: 1m1b_A 1s2t_A 1s2v_A 1pym_A 1s2u_A Length = 295 Back     alignment and structure
>2hjp_A Phosphonopyruvate hydrolase; phosporus-Ca cleavage, PEP mutase/isocitrate lyase superfamily; HET: XYS PPR; 1.90A {Variovorax SP} PDB: 2dua_A* 2hrw_A Length = 290 Back     alignment and structure
>2ze3_A DFA0005; organic waste LEFT-OVER decomposition, alkaliphilic, ICL/PEPM superfamily, alpha-ketoglutarate LIG isomerase; HET: AKG; 1.65A {Deinococcus ficus} Length = 275 Back     alignment and structure
>2qiw_A PEP phosphonomutase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: P6G; 1.80A {Corynebacterium glutamicum atcc 13032} Length = 255 Back     alignment and structure
>3i4e_A Isocitrate lyase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.69A {Burkholderia pseudomallei} Length = 439 Back     alignment and structure
>1f8m_A Isocitrate lyase, ICL; alpha-beta barrel, helix-swapping, closed conformation, bromopyuvate modification, structural genomics; 1.80A {Mycobacterium tuberculosis H37RV} SCOP: c.1.12.7 PDB: 1f61_A 1f8i_A Length = 429 Back     alignment and structure
>3eol_A Isocitrate lyase; seattle structural center for infectious disease, ssgcid; 2.00A {Brucella melitensis} PDB: 3oq8_A 3e5b_A 3p0x_A* Length = 433 Back     alignment and structure
>1dqu_A Isocitrate lyase; beta barrel; 2.80A {Emericella nidulans} SCOP: c.1.12.7 Length = 538 Back     alignment and structure
>3lg3_A Isocitrate lyase; conserved, CD, proteomics evidence (cytopl periplasmic), drug target functions; 1.40A {Yersinia pestis} PDB: 1igw_A Length = 435 Back     alignment and structure
>2p10_A MLL9387 protein; putative phosphonopyruvate hydrolase, structural genomics, J center for structural genomics, JCSG; HET: MSE; 2.15A {Mesorhizobium loti} SCOP: c.1.12.9 Length = 286 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query456
3eoo_A298 Methylisocitrate lyase; seattle structural genomic 100.0
3fa4_A302 2,3-dimethylmalate lyase; alpha/beta barrel, helix 100.0
3lye_A307 Oxaloacetate acetyl hydrolase; (alpha/beta)8 barre 100.0
3ih1_A305 Methylisocitrate lyase; alpha-beta structure, TIM- 100.0
1zlp_A318 PSR132, petal death protein; TIM-barrel, helix swa 100.0
1xg4_A295 Probable methylisocitrate lyase; 2-methylisocitrat 100.0
3eol_A433 Isocitrate lyase; seattle structural center for in 100.0
3lg3_A435 Isocitrate lyase; conserved, CD, proteomics eviden 100.0
2hjp_A290 Phosphonopyruvate hydrolase; phosporus-Ca cleavage 100.0
3b8i_A287 PA4872 oxaloacetate decarboxylase; alpha/beta barr 100.0
3i4e_A439 Isocitrate lyase; structural genomics, seattle str 100.0
1f8m_A429 Isocitrate lyase, ICL; alpha-beta barrel, helix-sw 100.0
1s2w_A295 Phosphoenolpyruvate phosphomutase; phosphonopyruva 100.0
2ze3_A275 DFA0005; organic waste LEFT-OVER decomposition, al 100.0
2qiw_A255 PEP phosphonomutase; structural genomics, joint ce 100.0
1dqu_A538 Isocitrate lyase; beta barrel; 2.80A {Emericella n 100.0
3vav_A275 3-methyl-2-oxobutanoate hydroxymethyltransferase; 100.0
1m3u_A264 3-methyl-2-oxobutanoate hydroxymethyltransferase; 100.0
1o66_A275 3-methyl-2-oxobutanoate hydroxymethyltransferase; 100.0
1oy0_A281 Ketopantoate hydroxymethyltransferase; domain swap 100.0
2p10_A286 MLL9387 protein; putative phosphonopyruvate hydrol 98.22
1h5y_A253 HISF; histidine biosynthesis, TIM-barrel; 2.0A {Py 98.05
1thf_D253 HISF protein; thermophIle, TIM-barrel, histidine b 97.86
1ka9_F252 Imidazole glycerol phosphtate synthase; riken stru 97.76
3igs_A232 N-acetylmannosamine-6-phosphate 2-epimerase 2; ene 97.73
2yxg_A289 DHDPS, dihydrodipicolinate synthase; MJ0244, TIM b 97.7
2ehh_A294 DHDPS, dihydrodipicolinate synthase; structural ge 97.69
3q58_A229 N-acetylmannosamine-6-phosphate 2-epimerase; TIM b 97.68
3cpr_A304 Dihydrodipicolinate synthetase; (beta/alpha)8-barr 97.63
3l21_A304 DHDPS, dihydrodipicolinate synthase; DAPA, dimer, 97.62
3a5f_A291 Dihydrodipicolinate synthase; TIM barrel, enzyme, 97.62
1xky_A301 Dihydrodipicolinate synthase; TIM barrel, , lysine 97.61
3m5v_A301 DHDPS, dihydrodipicolinate synthase; TIM barrel, c 97.59
2w6r_A266 Imidazole glycerol phosphate synthase subunit HISF 97.58
2tps_A227 Protein (thiamin phosphate synthase); thiamin bios 97.57
2ekc_A262 AQ_1548, tryptophan synthase alpha chain; structur 97.57
1jub_A311 Dihydroorotate dehydrogenase A; homodimer, alpha-b 97.56
2ojp_A292 DHDPS, dihydrodipicolinate synthase; dimer, lysine 97.56
2rfg_A297 Dihydrodipicolinate synthase; beta barrel, amino-a 97.56
2vc6_A292 MOSA, dihydrodipicolinate synthase; DHDPS, TIM bar 97.55
2r8w_A332 AGR_C_1641P; APC7498, dihydrodipicolinate synthase 97.54
3flu_A297 DHDPS, dihydrodipicolinate synthase; TIM barrel, b 97.53
1o5k_A306 DHDPS, dihydrodipicolinate synthase; TM1521, struc 97.53
2wkj_A303 N-acetylneuraminate lyase; directed evolution, sia 97.53
1f6k_A293 N-acetylneuraminate lyase; beta barrel; 1.60A {Hae 97.53
3qfe_A318 Putative dihydrodipicolinate synthase family PROT; 97.52
2v9d_A343 YAGE; dihydrodipicolinic acid synthase, N-acetyl n 97.52
3e96_A316 Dihydrodipicolinate synthase; structural genomics, 97.5
3daq_A292 DHDPS, dihydrodipicolinate synthase; lysine biosyn 97.49
2e6f_A314 Dihydroorotate dehydrogenase; chagas disease, pyri 97.48
3tdn_A247 FLR symmetric alpha-beta TIM barrel; symmetric sup 97.48
3eb2_A300 Putative dihydrodipicolinate synthetase; lysine bi 97.47
3b4u_A294 Dihydrodipicolinate synthase; structural genomics, 97.47
2nuw_A288 2-keto-3-deoxygluconate/2-keto-3-deoxy-6-phospho a 97.44
3tak_A291 DHDPS, dihydrodipicolinate synthase; TIM barrel, l 97.43
3qze_A314 DHDPS, dihydrodipicolinate synthase; alpha beta ba 97.43
1rd5_A262 Tryptophan synthase alpha chain, chloroplast; hydr 97.41
2r91_A286 2-keto-3-deoxy-(6-phospho-)gluconate aldolase; TIM 97.4
3fkr_A309 L-2-keto-3-deoxyarabonate dehydratase; DHDPS/NAL f 97.4
1vzw_A244 Phosphoribosyl isomerase A; histidine biosynthesis 97.4
1yxy_A234 Putative N-acetylmannosamine-6-phosphate 2-epimer; 97.38
3na8_A315 Putative dihydrodipicolinate synthetase; lyase; HE 97.38
3si9_A315 DHDPS, dihydrodipicolinate synthase; structural ge 97.37
3d0c_A314 Dihydrodipicolinate synthase; lysine biosynthesis, 97.37
2y88_A244 Phosphoribosyl isomerase A; aromatic amino acid bi 97.36
1qop_A268 Tryptophan synthase alpha chain; lyase, carbon-oxy 97.35
3s5o_A307 4-hydroxy-2-oxoglutarate aldolase, mitochondrial; 97.31
1w3i_A293 EDA, 2-keto-3-deoxy gluconate aldolase; archaeal m 97.3
4dpp_A360 DHDPS 2, dihydrodipicolinate synthase 2, chloropla 97.28
1gte_A1025 Dihydropyrimidine dehydrogenase; electron transfer 97.2
3f4w_A211 Putative hexulose 6 phosphate synthase; humps, mal 97.18
4adt_A297 Pyridoxine biosynthetic enzyme PDX1 homologue, PU; 97.17
1y0e_A223 Putative N-acetylmannosamine-6-phosphate 2-epimer; 97.14
3h5d_A311 DHDPS, dihydrodipicolinate synthase; lysine biosyn 97.14
3dz1_A313 Dihydrodipicolinate synthase; lysine biosynthesis, 97.14
1xi3_A215 Thiamine phosphate pyrophosphorylase; structural g 97.13
3vnd_A267 TSA, tryptophan synthase alpha chain; psychrophili 97.12
1qo2_A241 Molecule: N-((5-phosphoribosyl)-formimino)-5-amino 97.12
2f6u_A234 GGGPS, (S)-3-O-geranylgeranylglyceryl phosphate sy 97.05
3nav_A271 Tryptophan synthase alpha chain; alpha subunit, st 97.04
1ujp_A271 Tryptophan synthase alpha chain; riken structural 97.04
2qjg_A273 Putative aldolase MJ0400; beta-alpha barrel, lyase 97.03
1vyr_A364 Pentaerythritol tetranitrate reductase; oxidoreduc 96.99
1z41_A338 YQJM, probable NADH-dependent flavin oxidoreductas 96.97
3b0p_A350 TRNA-dihydrouridine synthase; TIM barrel, oxidored 96.96
2r14_A377 Morphinone reductase; H-tunnelling, flavoprotein, 96.93
1mdl_A359 Mandelate racemase; isomerase, mandelate pathway, 96.83
1p0k_A349 Isopentenyl-diphosphate delta-isomerase; terpene b 96.82
2hmc_A344 AGR_L_411P, dihydrodipicolinate synthase; alpha-be 96.81
1f76_A336 Dihydroorotate dehydrogenase; monomer, alpha-beta- 96.8
2z6i_A332 Trans-2-enoyl-ACP reductase II; fatty acid synthes 96.8
1wv2_A265 Thiazole moeity, thiazole biosynthesis protein THI 96.76
1gvf_A286 Tagatose-bisphosphate aldolase AGAY; lyase, zinc.; 96.73
4ef8_A354 Dihydroorotate dehydrogenase; phenyl isothiocyanat 96.73
1viz_A240 PCRB protein homolog; structural genomics, unknown 96.71
2v82_A212 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; l 96.69
2zad_A345 Muconate cycloisomerase; muconate lactonizing enzy 96.65
1ps9_A 671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 96.64
2gou_A365 Oxidoreductase, FMN-binding; OLD yeallow enzyme, f 96.62
3hgj_A349 Chromate reductase; TIM barrel, oxidoreductase; HE 96.59
2p8b_A369 Mandelate racemase/muconate lactonizing enzyme fam 96.56
3ru6_A303 Orotidine 5'-phosphate decarboxylase; structural g 96.56
2rdx_A379 Mandelate racemase/muconate lactonizing enzyme, P; 96.55
2yzr_A330 Pyridoxal biosynthesis lyase PDXS; redox protein, 96.52
2fiq_A420 Putative tagatose 6-phosphate kinase 1; structural 96.52
3sz8_A285 2-dehydro-3-deoxyphosphooctonate aldolase 2; ssgci 96.52
2nv1_A305 Pyridoxal biosynthesis lyase PDXS; (beta/alpha)8-b 96.5
1geq_A248 Tryptophan synthase alpha-subunit; hyperthermophIl 96.49
1to3_A304 Putative aldolase YIHT; beta-alpha barrel, structu 96.47
1tkk_A366 Similar to chloromuconate cycloisomerase; epimeras 96.45
2oz8_A389 MLL7089 protein; structural genomics, unknown func 96.42
3tfx_A259 Orotidine 5'-phosphate decarboxylase; PSI-biology, 96.38
3nvt_A385 3-deoxy-D-arabino-heptulosonate 7-phosphate synth; 96.35
1rvk_A382 Isomerase/lactonizing enzyme; enolase superfamily, 96.35
2ovl_A371 Putative racemase; structural genomics, PSI-2, pro 96.27
2ps2_A371 Putative mandelate racemase/muconate lactonizing e 96.27
3m47_A228 Orotidine 5'-phosphate decarboxylase; orotidine 5' 96.19
3o63_A243 Probable thiamine-phosphate pyrophosphorylase; thi 96.19
3q94_A288 Fructose-bisphosphate aldolase, class II; structur 96.18
1jvn_A555 Glutamine, bifunctional histidine biosynthesis pro 96.18
1zco_A262 2-dehydro-3-deoxyphosphoheptonate aldolase; arabin 96.18
3zwt_A367 Dihydroorotate dehydrogenase (quinone), mitochond; 96.18
3bo9_A326 Putative nitroalkan dioxygenase; TM0800, structura 96.17
2qde_A397 Mandelate racemase/muconate lactonizing enzyme FA 96.15
1icp_A376 OPR1, 12-oxophytodienoate reductase 1; beta-alpha- 96.08
2zbt_A297 Pyridoxal biosynthesis lyase PDXS; pyridoxine bios 96.02
2og9_A393 Mandelate racemase/muconate lactonizing enzyme; NY 96.02
3bjs_A428 Mandelate racemase/muconate lactonizing enzyme; en 96.01
3o07_A291 Pyridoxine biosynthesis protein SNZ1; (beta/alpha) 96.01
3r0u_A379 Enzyme of enolase superfamily; structural genomics 95.92
3sr7_A365 Isopentenyl-diphosphate delta-isomerase; isopenten 95.88
1o66_A275 3-methyl-2-oxobutanoate hydroxymethyltransferase; 95.87
2pcq_A283 Putative dihydrodipicolinate synthase; lyase, lysi 95.86
4e5t_A404 Mandelate racemase / muconate lactonizing enzyme, 95.86
2pgw_A384 Muconate cycloisomerase; enolase superfamily, octa 95.86
3gr7_A340 NADPH dehydrogenase; flavin, FMN, beta-alpha-barre 95.86
3khj_A361 Inosine-5-monophosphate dehydrogenase; enzyme-inhi 95.85
1nu5_A370 Chloromuconate cycloisomerase; enzyme, dehalogenat 95.83
1rvg_A305 Fructose-1,6-bisphosphate aldolase; class II aldol 95.83
2nwr_A267 2-dehydro-3-deoxyphosphooctonate aldolase; KDO, KD 95.83
3l5l_A363 Xenobiotic reductase A; TIM barrel, oxidoreductase 95.79
1dqu_A538 Isocitrate lyase; beta barrel; 2.80A {Emericella n 95.77
3ozy_A389 Putative mandelate racemase; beta-alpha barrel, en 95.72
1jub_A311 Dihydroorotate dehydrogenase A; homodimer, alpha-b 95.71
2pp0_A398 L-talarate/galactarate dehydratase; enolase superf 95.66
3tsm_A272 IGPS, indole-3-glycerol phosphate synthase; struct 95.65
3eez_A378 Putative mandelate racemase/muconate lactonizing e 95.55
3qja_A272 IGPS, indole-3-glycerol phosphate synthase; struct 95.55
1xm3_A264 Thiazole biosynthesis protein THIG; structural gen 95.54
3fs2_A298 2-dehydro-3-deoxyphosphooctonate aldolase; ssgcid, 95.53
3iwp_A287 Copper homeostasis protein CUTC homolog; conserved 95.51
3vav_A275 3-methyl-2-oxobutanoate hydroxymethyltransferase; 95.5
2qdd_A378 Mandelate racemase/muconate lactonizing enzyme; en 95.49
1vs1_A276 3-deoxy-7-phosphoheptulonate synthase; (beta/alpha 95.48
2czd_A208 Orotidine 5'-phosphate decarboxylase; pyrimidine b 95.48
1ep3_A311 Dihydroorotate dehydrogenase B (PYRD subunit); het 95.46
1vr6_A350 Phospho-2-dehydro-3-deoxyheptonate aldolase; TM034 95.45
1ypf_A336 GMP reductase; GUAC, purines, pyrimidines, nucleos 95.43
2qgy_A391 Enolase from the environmental genome shotgun sequ 95.41
3kru_A343 NADH:flavin oxidoreductase/NADH oxidase; homotetra 95.37
2nli_A368 Lactate oxidase; flavoenzyme, FMN, D-lactate, oxid 95.36
1z41_A338 YQJM, probable NADH-dependent flavin oxidoreductas 95.3
1m3u_A264 3-methyl-2-oxobutanoate hydroxymethyltransferase; 95.26
1h7n_A342 5-aminolaevulinic acid dehydratase; lyase, aldolas 95.24
3gd6_A391 Muconate cycloisomerase; structural genomics, NYSG 95.23
4fo4_A366 Inosine 5'-monophosphate dehydrogenase; structural 95.23
3sjn_A374 Mandelate racemase/muconate lactonizing protein; e 95.2
2gjl_A328 Hypothetical protein PA1024; 2-nitropropane dioxyg 95.18
3stp_A412 Galactonate dehydratase, putative; PSI biology, st 95.18
2hxt_A441 L-fuconate dehydratase; enolase superfamily, D-ery 95.15
3i65_A415 Dihydroorotate dehydrogenase homolog, mitochondria 95.14
2e6f_A314 Dihydroorotate dehydrogenase; chagas disease, pyri 95.1
4e4u_A412 Mandalate racemase/muconate lactonizing enzyme; ma 95.09
2nql_A388 AGR_PAT_674P, isomerase/lactonizing enzyme; enolas 95.03
3gr7_A340 NADPH dehydrogenase; flavin, FMN, beta-alpha-barre 95.0
3vkj_A368 Isopentenyl-diphosphate delta-isomerase; type 2 is 94.97
3tml_A288 2-dehydro-3-deoxyphosphooctonate aldolase; ssgcid, 94.94
3igs_A232 N-acetylmannosamine-6-phosphate 2-epimerase 2; ene 94.93
3ajx_A207 3-hexulose-6-phosphate synthase; HPS, OMPDC supraf 94.9
3r2g_A361 Inosine 5'-monophosphate dehydrogenase; structural 94.88
3q58_A229 N-acetylmannosamine-6-phosphate 2-epimerase; TIM b 94.88
3jva_A354 Dipeptide epimerase; enolase superfamily, isomeras 94.83
3txv_A450 Probable tagatose 6-phosphate kinase; structural g 94.83
1f76_A336 Dihydroorotate dehydrogenase; monomer, alpha-beta- 94.78
1y0e_A223 Putative N-acetylmannosamine-6-phosphate 2-epimer; 94.77
2gdq_A382 YITF; mandelate racemase/muconate lactonizing enzy 94.76
4dwd_A393 Mandelate racemase/muconate lactonizing enzyme, C 94.72
2qkf_A280 3-deoxy-D-manno-octulosonic acid 8- phosphate SYN; 94.7
3l5a_A419 NADH/flavin oxidoreductase/NADH oxidase; OLD yello 94.65
1tzz_A392 Hypothetical protein L1841; structural genomics, m 94.64
1wv2_A265 Thiazole moeity, thiazole biosynthesis protein THI 94.63
1o60_A292 2-dehydro-3-deoxyphosphooctonate aldolase; structu 94.61
3aty_A379 Tcoye, prostaglandin F2A synthase; alpha/beta barr 94.54
3toy_A383 Mandelate racemase/muconate lactonizing enzyme FA 94.53
2qq6_A410 Mandelate racemase/muconate lactonizing enzyme- li 94.48
3pm6_A306 Putative fructose-bisphosphate aldolase; structura 94.42
4ab4_A362 Xenobiotic reductase B; oxidoreductase, OLD yellow 94.4
2htm_A268 Thiazole biosynthesis protein THIG; thiamin biosyn 94.31
3sgz_A352 Hydroxyacid oxidase 2; flavoprotein, homology, INH 94.29
2poz_A392 Putative dehydratase; octamer, structural genomics 94.29
2hsa_B402 12-oxophytodienoate reductase 3; alpha beta 8 barr 94.24
3qw3_A255 Orotidine-5-phosphate decarboxylase/orotate phosph 94.23
1ydn_A295 Hydroxymethylglutaryl-COA lyase; TIM-barrel protei 94.22
1pv8_A330 Delta-aminolevulinic acid dehydratase; porphobilin 94.2
2o56_A407 Putative mandelate racemase; dehydratase, structur 94.16
1yad_A221 Regulatory protein TENI; TIM barrel, transcription 94.06
3iwp_A287 Copper homeostasis protein CUTC homolog; conserved 94.01
2ox4_A403 Putative mandelate racemase; enolase, dehydratase, 93.99
3gka_A361 N-ethylmaleimide reductase; decode biostructures, 93.96
3ik4_A365 Mandelate racemase/muconate lactonizing protein; s 93.96
3rcy_A433 Mandelate racemase/muconate lactonizing enzyme-LI 93.94
1w8s_A263 FBP aldolase, fructose-bisphosphate aldolase class 93.89
2h6r_A219 Triosephosphate isomerase; beta-alpha barrel; 2.30 93.83
1mzh_A225 Deoxyribose-phosphate aldolase; alpha-beta barrel, 93.82
3rr1_A405 GALD, putative D-galactonate dehydratase; enolase, 93.8
3ffs_A400 Inosine-5-monophosphate dehydrogenase; beta-alpha 93.79
3hgj_A349 Chromate reductase; TIM barrel, oxidoreductase; HE 93.78
4dbe_A222 Orotidine 5'-phosphate decarboxylase; TIM barrel, 93.77
2ftp_A302 Hydroxymethylglutaryl-COA lyase; structural genomi 93.77
2hzg_A401 Mandelate racemase/muconate lactonizing enzyme/EN 93.73
1wa3_A205 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, 93.73
2gl5_A410 Putative dehydratase protein; structural genomics, 93.7
3mqt_A394 Mandelate racemase/muconate lactonizing protein; P 93.65
4e8g_A391 Enolase, mandelate racemase/muconate lactonizing e 93.62
3vzx_A228 Heptaprenylglyceryl phosphate synthase; biosynthes 93.62
4ef8_A354 Dihydroorotate dehydrogenase; phenyl isothiocyanat 93.57
3kru_A343 NADH:flavin oxidoreductase/NADH oxidase; homotetra 93.54
3b0p_A350 TRNA-dihydrouridine synthase; TIM barrel, oxidored 93.5
4fo4_A366 Inosine 5'-monophosphate dehydrogenase; structural 93.48
1gox_A370 (S)-2-hydroxy-acid oxidase, peroxisomal; oxidoredu 93.41
4fxs_A496 Inosine-5'-monophosphate dehydrogenase; structural 93.4
3khj_A361 Inosine-5-monophosphate dehydrogenase; enzyme-inhi 93.4
3tj4_A372 Mandelate racemase; enolase, dehydratase, enzyme f 93.39
4h2h_A376 Mandelate racemase/muconate lactonizing enzyme; en 93.37
1vhn_A318 Putative flavin oxidoreducatase; structural genomi 93.33
2nli_A368 Lactate oxidase; flavoenzyme, FMN, D-lactate, oxid 93.27
3bw2_A369 2-nitropropane dioxygenase; TIM barrel, oxidoreduc 93.27
3i4k_A383 Muconate lactonizing enzyme; structural genomics, 93.26
3n9r_A307 Fructose-bisphosphate aldolase; FBP aldolase, clas 93.18
1jcn_A514 Inosine monophosphate dehydrogenase I; IMPD, IMPDH 93.17
1h1y_A228 D-ribulose-5-phosphate 3-epimerase; oxidative pent 93.16
3go2_A409 Putative L-alanine-DL-glutamate epimerase; structu 93.15
3sgz_A352 Hydroxyacid oxidase 2; flavoprotein, homology, INH 93.15
3oix_A345 Putative dihydroorotate dehydrogenase; dihydrooro 93.1
1vrd_A494 Inosine-5'-monophosphate dehydrogenase; TM1347, st 93.07
3ugv_A390 Enolase; enzyme function initiative, EFI, lyase; 2 92.94
4avf_A490 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 92.92
1ypf_A336 GMP reductase; GUAC, purines, pyrimidines, nucleos 92.91
1vc4_A254 Indole-3-glycerol phosphate synthase; lyase, trypt 92.84
1twd_A256 Copper homeostasis protein CUTC; TIM-like protein, 92.81
3zwt_A367 Dihydroorotate dehydrogenase (quinone), mitochond; 92.81
3fv9_G386 Mandelate racemase/muconate lactonizing enzyme; st 92.81
2c6q_A351 GMP reductase 2; TIM barrel, metal-binding, NADP, 92.78
2bdq_A224 Copper homeostasis protein CUTC; alpha beta protei 92.71
1eep_A404 Inosine 5'-monophosphate dehydrogenase; alpha-beta 92.68
1rd5_A262 Tryptophan synthase alpha chain, chloroplast; hydr 92.68
3vc5_A441 Mandelate racemase/muconate lactonizing protein; d 92.64
3ffs_A400 Inosine-5-monophosphate dehydrogenase; beta-alpha 92.64
3mkc_A394 Racemase; metabolic process, PSI2, NYSGXRC, struct 92.62
3ddm_A392 Putative mandelate racemase/muconate lactonizing e 92.61
3q45_A368 Mandelate racemase/muconate lactonizing enzyme FA 92.6
1lt8_A406 Betaine-homocysteine methyltransferase; homocystei 92.56
1eix_A245 Orotidine 5'-monophosphate decarboxylase; alpha-be 92.55
3tr2_A239 Orotidine 5'-phosphate decarboxylase; purines, pyr 92.54
2ze3_A275 DFA0005; organic waste LEFT-OVER decomposition, al 92.5
1oy0_A281 Ketopantoate hydroxymethyltransferase; domain swap 92.49
2cw6_A298 Hydroxymethylglutaryl-COA lyase, mitochondrial; HM 92.39
1dbt_A239 Orotidine 5'-phosphate decarboxylase; UMP, TIM bar 92.38
3t6c_A440 RSPA, putative MAND family dehydratase; enolase, m 92.38
3ro6_B356 Putative chloromuconate cycloisomerase; TIM barrel 92.37
3dg3_A367 Muconate cycloisomerase; muconate lactonizing enzy 92.37
1vhn_A318 Putative flavin oxidoreducatase; structural genomi 92.35
3jr2_A218 Hexulose-6-phosphate synthase SGBH; 3-keto-L-gulon 92.3
1jcn_A514 Inosine monophosphate dehydrogenase I; IMPD, IMPDH 92.27
3s5s_A389 Mandelate racemase/muconate lactonizing enzyme FA 92.2
3ldv_A255 Orotidine 5'-phosphate decarboxylase; structural g 92.15
1vhc_A224 Putative KHG/KDPG aldolase; structural genomics, u 92.13
3qw4_B453 UMP synthase; N-terminal orotidine monophosphate d 92.05
1o94_A 729 Tmadh, trimethylamine dehydrogenase; electron tran 92.03
4hnl_A421 Mandelate racemase/muconate lactonizing enzyme; de 91.99
2agk_A260 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) me 91.94
3r4e_A418 Mandelate racemase/muconate lactonizing enzyme; en 91.93
3vcn_A425 Mannonate dehydratase; enolase, magnesium binding 91.93
1tv5_A443 Dhodehase, dihydroorotate dehydrogenase homolog, m 91.89
3k30_A 690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 91.81
2nzl_A392 Hydroxyacid oxidase 1; HAOX1, glycolate oxidase, G 91.77
3l5l_A363 Xenobiotic reductase A; TIM barrel, oxidoreductase 91.77
2nx9_A464 Oxaloacetate decarboxylase 2, subunit alpha; carbo 91.76
3oa3_A288 Aldolase; structural genomics, seattle structural 91.75
3p3b_A392 Mandelate racemase/muconate lactonizing protein; e 91.74
4a35_A441 Mitochondrial enolase superfamily member 1; isomer 91.71
3glc_A295 Aldolase LSRF; TIM barrel, lyase, schiff base; HET 91.64
3vdg_A445 Probable glucarate dehydratase; enolase, magnesium 91.63
3v3w_A424 Starvation sensing protein RSPA; enolase, enzyme f 91.62
2isw_A323 Putative fructose-1,6-bisphosphate aldolase; class 91.58
3iv3_A332 Tagatose 1,6-diphosphate aldolase 2; TIM barrel, p 91.58
1l6s_A323 Porphobilinogen synthase; dehydratase, lyase; HET: 91.55
3my9_A377 Muconate cycloisomerase; structural genomics, PSI- 91.55
3usb_A511 Inosine-5'-monophosphate dehydrogenase; structural 91.53
1tqj_A230 Ribulose-phosphate 3-epimerase; beta-alpha barrel 91.51
1ub3_A220 Aldolase protein; schiff base, deoxyribose phospha 91.5
1ydo_A307 HMG-COA lyase; TIM-barrel protein, structural geno 91.38
3va8_A445 Probable dehydratase; enolase, magnesium binding s 91.32
4h1z_A412 Enolase Q92ZS5; dehydratase, magnesium binding sit 91.32
1xm3_A264 Thiazole biosynthesis protein THIG; structural gen 91.31
3ble_A337 Citramalate synthase from leptospira interrogans; 91.29
3usb_A511 Inosine-5'-monophosphate dehydrogenase; structural 91.26
2yw3_A207 4-hydroxy-2-oxoglutarate aldolase/2-deydro-3- deox 91.12
1vqt_A213 Orotidine 5'-phosphate decarboxylase; TM0332, stru 91.1
1rqb_A 539 Transcarboxylase 5S subunit; TIM-barrel, carbamyla 91.08
2pge_A377 MENC; OSBS, NYSGXRC, PSI-II, structural genomics, 91.06
1rpx_A230 Protein (ribulose-phosphate 3-epimerase); chloropl 91.03
2gou_A365 Oxidoreductase, FMN-binding; OLD yeallow enzyme, f 91.0
2ozt_A332 TLR1174 protein; structural genomics, O-succinylbe 90.98
1n7k_A234 Deoxyribose-phosphate aldolase; A.pernix, tetramer 90.97
3ceu_A210 Thiamine phosphate pyrophosphorylase; TIM barrel-l 90.95
2nzl_A392 Hydroxyacid oxidase 1; HAOX1, glycolate oxidase, G 90.92
3rmj_A370 2-isopropylmalate synthase; LEUA, truncation, neis 90.88
1gte_A1025 Dihydropyrimidine dehydrogenase; electron transfer 90.88
2v82_A212 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; l 90.86
3noy_A366 4-hydroxy-3-methylbut-2-EN-1-YL diphosphate synth; 90.81
3fcp_A381 L-Ala-D/L-Glu epimerase, A muconate lactonizing en 90.8
1nvm_A345 HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered 90.75
1q6o_A216 Humps, 3-keto-L-gulonate 6-phosphate decarboxylase 90.71
1yad_A221 Regulatory protein TENI; TIM barrel, transcription 90.58
2htm_A268 Thiazole biosynthesis protein THIG; thiamin biosyn 90.56
1w1z_A328 Delta-aminolevulinic acid dehydratase; synthase, t 90.55
3tji_A422 Mandelate racemase/muconate lactonizing enzyme, N 90.52
1kbi_A511 Cytochrome B2, L-LCR; flavocytochrome B2, electron 90.49
3nl6_A 540 Thiamine biosynthetic bifunctional enzyme; thiamin 90.44
1sjd_A368 N-acylamino acid racemase; lyase, isomerase; HET: 90.41
2gjl_A328 Hypothetical protein PA1024; 2-nitropropane dioxyg 90.31
4ab4_A362 Xenobiotic reductase B; oxidoreductase, OLD yellow 90.31
3r12_A260 Deoxyribose-phosphate aldolase; TIM beta/alpha-bar 90.31
3elf_A349 Fructose-bisphosphate aldolase; zinc enzyme, dihyd 90.23
1me8_A503 Inosine-5'-monophosphate dehydrogenase; alpha beta 90.17
1vyr_A364 Pentaerythritol tetranitrate reductase; oxidoreduc 90.12
1vrd_A494 Inosine-5'-monophosphate dehydrogenase; TM1347, st 90.11
1o5k_A306 DHDPS, dihydrodipicolinate synthase; TM1521, struc 90.1
1p4c_A380 L(+)-mandelate dehydrogenase; TIM barrel, hydroxy 90.08
4af0_A556 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 90.06
3l0g_A300 Nicotinate-nucleotide pyrophosphorylase; ssgcid, N 90.05
1mzh_A225 Deoxyribose-phosphate aldolase; alpha-beta barrel, 90.01
3u9i_A393 Mandelate racemase/muconate lactonizing enzyme, C 89.97
2ztj_A382 Homocitrate synthase; (beta/alpha)8 TIM barrel, su 89.96
3tqv_A287 Nicotinate-nucleotide pyrophosphorylase; glycosylt 89.96
4e38_A232 Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho 89.92
4avf_A490 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 89.88
1w5q_A337 Delta-aminolevulinic acid dehydratase; synthase, e 89.82
3dip_A410 Enolase; structural genomics, isomerase, PSI-2, pr 89.77
1twd_A256 Copper homeostasis protein CUTC; TIM-like protein, 89.76
3bw2_A369 2-nitropropane dioxygenase; TIM barrel, oxidoreduc 89.74
3o63_A243 Probable thiamine-phosphate pyrophosphorylase; thi 89.74
1p0k_A349 Isopentenyl-diphosphate delta-isomerase; terpene b 89.68
2ekc_A262 AQ_1548, tryptophan synthase alpha chain; structur 89.68
4fxs_A496 Inosine-5'-monophosphate dehydrogenase; structural 89.61
2qr6_A393 IMP dehydrogenase/GMP reductase; NP_599840.1, G re 89.55
3gka_A361 N-ethylmaleimide reductase; decode biostructures, 89.54
1n8f_A350 DAHP synthetase; (beta/alpha)8 barrel, metal bindi 89.48
1vcf_A332 Isopentenyl-diphosphate delta-isomerase; TIM barre 89.45
1ep3_A311 Dihydroorotate dehydrogenase B (PYRD subunit); het 89.44
3dgb_A382 Muconate cycloisomerase; muconate lactonizing enzy 89.42
3n3m_A342 Orotidine 5'-phosphate decarboxylase; P. falciparu 89.35
3ngj_A239 Deoxyribose-phosphate aldolase; lyase, structural 89.35
3i65_A415 Dihydroorotate dehydrogenase homolog, mitochondria 89.34
1eye_A280 DHPS 1, dihydropteroate synthase I; alpha-beta bar 89.32
1ydn_A295 Hydroxymethylglutaryl-COA lyase; TIM-barrel protei 89.21
1qop_A268 Tryptophan synthase alpha chain; lyase, carbon-oxy 89.18
4djd_D323 C/Fe-SP, corrinoid/iron-sulfur protein small subun 89.16
3qz6_A261 HPCH/HPAI aldolase; structural genomics, PSI-biolo 89.13
2ehh_A294 DHDPS, dihydrodipicolinate synthase; structural ge 88.91
3sbf_A401 Mandelate racemase / muconate lactonizing enzyme; 88.89
3tcs_A388 Racemase, putative; PSI-biology, nysgrc, structura 88.88
1i4n_A251 Indole-3-glycerol phosphate synthase; thermostable 88.88
3bo9_A326 Putative nitroalkan dioxygenase; TM0800, structura 88.84
1dos_A358 Aldolase class II; lyase, classii fructose 1,6-bis 88.77
1eep_A404 Inosine 5'-monophosphate dehydrogenase; alpha-beta 88.76
1wbh_A214 KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} 88.72
1qwg_A251 PSL synthase;, (2R)-phospho-3-sulfolactate synthas 88.63
1mxs_A225 KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate a 88.62
3w01_A235 Heptaprenylglyceryl phosphate synthase; biosynthes 88.56
1gox_A370 (S)-2-hydroxy-acid oxidase, peroxisomal; oxidoredu 88.53
2chr_A370 Chloromuconate cycloisomerase; 3.00A {Cupriavidus 88.53
1to3_A304 Putative aldolase YIHT; beta-alpha barrel, structu 88.41
1yxy_A234 Putative N-acetylmannosamine-6-phosphate 2-epimer; 88.27
1xi3_A215 Thiamine phosphate pyrophosphorylase; structural g 88.25
3mzn_A450 Glucarate dehydratase; lyase, structural genomics, 88.2
2vc6_A292 MOSA, dihydrodipicolinate synthase; DHDPS, TIM bar 88.19
3ewb_X293 2-isopropylmalate synthase; LEUA, structural genom 88.15
2r14_A377 Morphinone reductase; H-tunnelling, flavoprotein, 88.07
2vp8_A318 Dihydropteroate synthase 2; RV1207 transferase, fo 88.04
1aj0_A282 DHPS, dihydropteroate synthase; antibiotic, resist 88.0
1ps9_A 671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 87.95
3i6e_A385 Muconate cycloisomerase I; structural genomics, NY 87.86
3ve9_A215 Orotidine-5'-phosphate decarboxylase; TIM barrel f 87.76
3exr_A221 RMPD (hexulose-6-phosphate synthase); beta barrel, 87.74
4dye_A398 Isomerase; enolase family protein, EFI, enzym func 87.68
3tha_A252 Tryptophan synthase alpha chain; structural genomi 87.59
3o07_A291 Pyridoxine biosynthesis protein SNZ1; (beta/alpha) 87.58
3sr7_A365 Isopentenyl-diphosphate delta-isomerase; isopenten 87.51
3ndo_A231 Deoxyribose-phosphate aldolase; ssgcid, NIH, niaid 87.5
3rmj_A370 2-isopropylmalate synthase; LEUA, truncation, neis 87.42
3ovp_A228 Ribulose-phosphate 3-epimerase; iron binding, isom 87.41
3ewb_X293 2-isopropylmalate synthase; LEUA, structural genom 87.29
4hpn_A378 Putative uncharacterized protein; enolase, enzyme 87.16
3qm3_A357 Fructose-bisphosphate aldolase; structural genomic 87.09
2yyu_A246 Orotidine 5'-phosphate decarboxylase; TIM barrel, 86.95
3fa4_A302 2,3-dimethylmalate lyase; alpha/beta barrel, helix 86.93
1q7z_A566 5-methyltetrahydrofolate S-homocysteine methyltran 86.9
1icp_A376 OPR1, 12-oxophytodienoate reductase 1; beta-alpha- 86.84
1tx2_A297 DHPS, dihydropteroate synthase; folate biosynthesi 86.79
2hsa_B402 12-oxophytodienoate reductase 3; alpha beta 8 barr 86.7
2qiw_A255 PEP phosphonomutase; structural genomics, joint ce 86.69
3iv3_A332 Tagatose 1,6-diphosphate aldolase 2; TIM barrel, p 86.55
2v9d_A343 YAGE; dihydrodipicolinic acid synthase, N-acetyl n 86.52
2zbt_A297 Pyridoxal biosynthesis lyase PDXS; pyridoxine bios 86.51
1chr_A370 Chloromuconate cycloisomerase; 3.00A {Ralstonia eu 86.51
2cw6_A298 Hydroxymethylglutaryl-COA lyase, mitochondrial; HM 86.42
3vnd_A267 TSA, tryptophan synthase alpha chain; psychrophili 86.42
1zfj_A491 Inosine monophosphate dehydrogenase; IMPDH, CBS do 86.34
3r2g_A361 Inosine 5'-monophosphate dehydrogenase; structural 86.33
2pgw_A384 Muconate cycloisomerase; enolase superfamily, octa 86.33
1qpo_A284 Quinolinate acid phosphoribosyl transferase; type 86.27
3oix_A345 Putative dihydroorotate dehydrogenase; dihydrooro 86.26
3mwc_A400 Mandelate racemase/muconate lactonizing protein; e 86.22
3tdn_A247 FLR symmetric alpha-beta TIM barrel; symmetric sup 86.21
2rdx_A379 Mandelate racemase/muconate lactonizing enzyme, P; 85.95
3obk_A356 Delta-aminolevulinic acid dehydratase; ssgcid, str 85.69
2fli_A220 Ribulose-phosphate 3-epimerase; (beta/alpha)8-barr 85.65
3p0w_A470 Mandelate racemase/muconate lactonizing protein; s 85.62
2agk_A260 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) me 85.58
3ivs_A423 Homocitrate synthase, mitochondrial; TIM barrel, m 85.45
1zlp_A318 PSR132, petal death protein; TIM-barrel, helix swa 85.39
3cyj_A372 Mandelate racemase/muconate lactonizing enzyme-LI 85.34
2ftp_A302 Hydroxymethylglutaryl-COA lyase; structural genomi 85.25
3ble_A337 Citramalate synthase from leptospira interrogans; 85.2
2r91_A286 2-keto-3-deoxy-(6-phospho-)gluconate aldolase; TIM 85.14
2qjg_A273 Putative aldolase MJ0400; beta-alpha barrel, lyase 85.06
2tps_A227 Protein (thiamin phosphate synthase); thiamin bios 85.01
2opj_A327 O-succinylbenzoate-COA synthase; TIM barrel, struc 85.0
2bdq_A224 Copper homeostasis protein CUTC; alpha beta protei 84.97
2w6r_A266 Imidazole glycerol phosphate synthase subunit HISF 84.78
1xg4_A295 Probable methylisocitrate lyase; 2-methylisocitrat 84.6
2wqp_A349 Polysialic acid capsule biosynthesis protein SIAC; 84.49
3pfr_A455 Mandelate racemase/muconate lactonizing protein; e 84.49
3bg3_A 718 Pyruvate carboxylase, mitochondrial; TIM barrel, A 84.46
3gnn_A298 Nicotinate-nucleotide pyrophosphorylase; decode bi 84.35
2yzr_A330 Pyridoxal biosynthesis lyase PDXS; redox protein, 84.04
1thf_D253 HISF protein; thermophIle, TIM-barrel, histidine b 83.94
3vkj_A368 Isopentenyl-diphosphate delta-isomerase; type 2 is 83.64
1nvm_A345 HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered 83.63
2dqw_A294 Dihydropteroate synthase; dimer, structural genomi 83.61
2y5s_A294 DHPS, dihydropteroate synthase; transferase, folat 83.52
1vli_A385 Spore coat polysaccharide biosynthesis protein SP; 83.49
2ffc_A353 Orotidine 5-monophosphate decarboxylase; PV-PF10_0 83.49
3qja_A272 IGPS, indole-3-glycerol phosphate synthase; struct 83.37
3eoo_A298 Methylisocitrate lyase; seattle structural genomic 83.36
1p4c_A380 L(+)-mandelate dehydrogenase; TIM barrel, hydroxy 83.3
2qr6_A393 IMP dehydrogenase/GMP reductase; NP_599840.1, G re 83.27
2y88_A244 Phosphoribosyl isomerase A; aromatic amino acid bi 83.16
2z6i_A332 Trans-2-enoyl-ACP reductase II; fatty acid synthes 83.1
3nav_A271 Tryptophan synthase alpha chain; alpha subunit, st 83.04
1vzw_A244 Phosphoribosyl isomerase A; histidine biosynthesis 82.89
1o4u_A285 Type II quinolic acid phosphoribosyltransferase; s 82.87
3inp_A246 D-ribulose-phosphate 3-epimerase; IDP02542, isomer 82.85
4gj1_A243 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) me 82.84
4hb7_A270 Dihydropteroate synthase; transferase; 1.95A {Stap 82.79
4h83_A388 Mandelate racemase/muconate lactonizing enzyme; st 82.76
3fok_A307 Uncharacterized protein CGL0159; CGL0159 ,brevibac 82.65
4e4f_A426 Mannonate dehydratase; magnesium binding, enzyme f 82.55
1w3i_A293 EDA, 2-keto-3-deoxy gluconate aldolase; archaeal m 82.52
3tsm_A272 IGPS, indole-3-glycerol phosphate synthase; struct 82.37
3eeg_A325 2-isopropylmalate synthase; 11106D, beta barrel, P 82.33
4a29_A258 Engineered retro-aldol enzyme RA95.0; de novo prot 82.32
3paj_A320 Nicotinate-nucleotide pyrophosphorylase, carboxyl; 82.29
2uva_G 2060 Fatty acid synthase beta subunits; fungal, dehydra 82.27
4dxk_A400 Mandelate racemase / muconate lactonizing enzyme p 82.01
1q7z_A 566 5-methyltetrahydrofolate S-homocysteine methyltran 81.72
2fds_A352 Orotidine-monophosphate-decarboxylase; TIM barrel, 81.45
2nx9_A464 Oxaloacetate decarboxylase 2, subunit alpha; carbo 81.44
3ivs_A423 Homocitrate synthase, mitochondrial; TIM barrel, m 81.34
1s2w_A295 Phosphoenolpyruvate phosphomutase; phosphonopyruva 81.15
3aty_A379 Tcoye, prostaglandin F2A synthase; alpha/beta barr 81.1
2h9a_B310 CO dehydrogenase/acetyl-COA synthase, iron- sulfur 81.06
1tv5_A443 Dhodehase, dihydroorotate dehydrogenase homolog, m 80.99
1wbh_A214 KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} 80.83
1wa3_A205 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, 80.73
4e38_A232 Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho 80.64
1vc4_A254 Indole-3-glycerol phosphate synthase; lyase, trypt 80.58
1rqb_A539 Transcarboxylase 5S subunit; TIM-barrel, carbamyla 80.54
3gnn_A298 Nicotinate-nucleotide pyrophosphorylase; decode bi 80.53
1u83_A276 Phosphosulfolactate synthase; structural genomics, 80.46
1vcf_A332 Isopentenyl-diphosphate delta-isomerase; TIM barre 80.08
1kbi_A511 Cytochrome B2, L-LCR; flavocytochrome B2, electron 80.04
>3eoo_A Methylisocitrate lyase; seattle structural genomics center for infectious disease, ssgcid; 2.90A {Burkholderia pseudomallei 1655} SCOP: c.1.12.7 Back     alignment and structure
Probab=100.00  E-value=2.9e-74  Score=574.19  Aligned_cols=287  Identities=31%  Similarity=0.500  Sum_probs=273.3

Q ss_pred             cccHHHHHHHHHhCCCceeecccCChHHHHHHHHhCCcEEEecchHHhhhhcccCCCCCCCHHHHHHHHHHHHhccCCcE
Q 012815           74 CLSPAKSLRQILELPGVHQGPACFDALSAKLVEKSGFSFCFTSGFSISAARLALPDTGFISYGEMVDQGQLITQAVSIPV  153 (456)
Q Consensus        74 a~~~a~~Lr~ll~~~~~lv~pgayDalSArl~e~aGfdAI~vSG~avSas~lG~PD~~~lt~~Eml~~~r~I~ra~~iPV  153 (456)
                      .++++++||++|++++++++|||||++||++++++||++||+||++++++++|+||++.+|++||++|+++|++++++||
T Consensus         7 ~~~~~~~lr~l~~~~~~i~~~~a~D~~sA~l~e~aGf~ai~vs~~s~a~~~~G~pD~~~vt~~em~~~~~~I~r~~~~Pv   86 (298)
T 3eoo_A            7 LISAGAKFRAAVAAEQPLQVVGAITAYAAKMAEAVGFKAVYLSGGGVAANSLGIPDLGISTMDDVLVDANRITNATNLPL   86 (298)
T ss_dssp             CCCHHHHHHHHHHHSSSEEEEECSSHHHHHHHHHHTCSCEEECHHHHHHHTTCCCSSSCCCHHHHHHHHHHHHHHCCSCE
T ss_pred             cccHHHHHHHHHhCCCcEEEecCCCHHHHHHHHHcCCCEEEECcHHHHHHhcCCCCCCCCCHHHHHHHHHHHHhhcCCeE
Confidence            46789999999999999999999999999999999999999999999978899999999999999999999999999999


Q ss_pred             EEeCCCCCCCHHHHHHHHHHHHHhCccEEEeCCCCCCCCccCCCCccccCHHHHHHHHHHHHHHhHhhCCCeEEEEecch
Q 012815          154 IGDGDNGYGNAMNVKRTVKGYIKAGFAGIILEDQVSPKGCGHTRGRKVVSREEAVMRIKAAVDARKESGSDIVIVARTDS  233 (456)
Q Consensus       154 IaD~DtGYG~~~nv~rtVk~l~~AGaaGI~IEDq~~pK~CGH~~gk~lvp~ee~v~kI~AA~~Ar~~~G~dfvIiARTDA  233 (456)
                      |+|+|+|||+++++.+++++|+++||+|||||||++||+|||.+||+|+|.+|+++||+||++|++  ++||+|+||||+
T Consensus        87 iaD~d~Gyg~~~~v~~~v~~l~~aGaagv~iEDq~~~k~cGh~~gk~l~~~~e~~~ri~Aa~~A~~--~~~~~I~ARTDa  164 (298)
T 3eoo_A           87 LVDIDTGWGGAFNIARTIRSFIKAGVGAVHLEDQVGQKRCGHRPGKECVPAGEMVDRIKAAVDART--DETFVIMARTDA  164 (298)
T ss_dssp             EEECTTCSSSHHHHHHHHHHHHHTTCSEEEEECBCCCCCTTCCCCCCBCCHHHHHHHHHHHHHHCS--STTSEEEEEECT
T ss_pred             EEECCCCCCCHHHHHHHHHHHHHhCCeEEEECCCCCCcccCCCCCCeecCHHHHHHHHHHHHHhcc--CCCeEEEEeehh
Confidence            999999999999999999999999999999999999999999999999999999999999999986  589999999999


Q ss_pred             hhcccHHHHHHHHHHhHhcCCCEEEeccCCCHHHHHHHHHhCCCCceeeeeeccCCCCCCCCHHHHHhcCCCEEeccchH
Q 012815          234 RQALSLEESLRRSRAFADAGADVLFIDALASKEEMKAFCEISPLVPKMANMLEGGGKTPILNPLELEELGFKLVAYPLSL  313 (456)
Q Consensus       234 ~~~~~ldeAI~RakAy~eAGAD~Ifie~~~s~eei~~i~~~v~~vP~~~N~~~~~g~tp~lt~~eL~elGv~~Vs~p~~l  313 (456)
                      +...++||+|+|+++|++||||+||+|++++.+++++|+++++ +|+++|++++ |++|.++.+||+++||++|+||+++
T Consensus       165 ~~~~gldeai~Ra~ay~~AGAD~if~~~~~~~ee~~~~~~~~~-~Pl~~n~~~~-g~tp~~~~~eL~~lGv~~v~~~~~~  242 (298)
T 3eoo_A          165 AAAEGIDAAIERAIAYVEAGADMIFPEAMKTLDDYRRFKEAVK-VPILANLTEF-GSTPLFTLDELKGANVDIALYCCGA  242 (298)
T ss_dssp             HHHHHHHHHHHHHHHHHHTTCSEEEECCCCSHHHHHHHHHHHC-SCBEEECCTT-SSSCCCCHHHHHHTTCCEEEECSHH
T ss_pred             hhhcCHHHHHHHHHhhHhcCCCEEEeCCCCCHHHHHHHHHHcC-CCeEEEeccC-CCCCCCCHHHHHHcCCeEEEEchHH
Confidence            9888999999999999999999999999999999999999998 8999999987 6789999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHc-CCCC-CCCCCCCHHHHHHhcCcccHHHHHHccccc
Q 012815          314 IGVSVRAMQDALTAIKG-GRIP-SPGSMPSFQEIKETLGFNTYYEEEKRYATS  364 (456)
Q Consensus       314 l~aa~~A~~~~l~~i~~-g~~~-~~~~~~~~~e~~~lvg~~~~~~~e~~y~~~  364 (456)
                      +++++.||++++++|++ |+.. ..+.+++|+|+++++||++|++++++|...
T Consensus       243 ~raa~~a~~~~~~~i~~~g~~~~~~~~~~~~~el~~l~~~~~~~~~~~~~~~~  295 (298)
T 3eoo_A          243 YRAMNKAALNFYETVRRDGTQKAAVPTMQTRAQLYDYLGYYAYEEKLDQLFNQ  295 (298)
T ss_dssp             HHHHHHHHHHHHHHHHHHSSSGGGGGGSCCHHHHHHHTTHHHHHHHHHHHHCC
T ss_pred             HHHHHHHHHHHHHHHHHcCCccchhhcCCCHHHHHHHcCHHHHHHHHHHHhcc
Confidence            99999999999999986 4443 356788999999999999999999998643
>3fa4_A 2,3-dimethylmalate lyase; alpha/beta barrel, helix swapping; 2.18A {Aspergillus niger} PDB: 3fa3_A Back     alignment and structure
>3lye_A Oxaloacetate acetyl hydrolase; (alpha/beta)8 barrel; 1.30A {Cryphonectria parasitica} PDB: 3m0j_A* 3m0k_A Back     alignment and structure
>1zlp_A PSR132, petal death protein; TIM-barrel, helix swapping,2-ethyl-3-methylmalate lyase, 2-P methylmalate lyase, lyase/PEP mutase superfamily; 2.70A {Dianthus caryophyllus} Back     alignment and structure
>1xg4_A Probable methylisocitrate lyase; 2-methylisocitrate lyase/inhibitor complex, isocitrate lyase superfamily; HET: ICT; 1.60A {Escherichia coli} PDB: 1xg3_A* 1mum_A 1oqf_A 1ujq_A 1o5q_A Back     alignment and structure
>3eol_A Isocitrate lyase; seattle structural center for infectious disease, ssgcid; 2.00A {Brucella melitensis} PDB: 3oq8_A 3e5b_A 3p0x_A* Back     alignment and structure
>3lg3_A Isocitrate lyase; conserved, CD, proteomics evidence (cytopl periplasmic), drug target functions; 1.40A {Yersinia pestis} SCOP: c.1.12.7 PDB: 1igw_A Back     alignment and structure
>2hjp_A Phosphonopyruvate hydrolase; phosporus-Ca cleavage, PEP mutase/isocitrate lyase superfamily; HET: XYS PPR; 1.90A {Variovorax SP} PDB: 2dua_A* 2hrw_A Back     alignment and structure
>3b8i_A PA4872 oxaloacetate decarboxylase; alpha/beta barrel, helix swapping, lyase; 1.90A {Pseudomonas aeruginosa} Back     alignment and structure
>3i4e_A Isocitrate lyase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.69A {Burkholderia pseudomallei} Back     alignment and structure
>1f8m_A Isocitrate lyase, ICL; alpha-beta barrel, helix-swapping, closed conformation, bromopyuvate modification, structural genomics; 1.80A {Mycobacterium tuberculosis H37RV} SCOP: c.1.12.7 PDB: 1f61_A 1f8i_A Back     alignment and structure
>1s2w_A Phosphoenolpyruvate phosphomutase; phosphonopyruvate, phosphonate biosynthesis pathway, isomera; 1.69A {Mytilus edulis} SCOP: c.1.12.7 PDB: 1m1b_A 1s2t_A 1s2v_A 1pym_A 1s2u_A Back     alignment and structure
>2ze3_A DFA0005; organic waste LEFT-OVER decomposition, alkaliphilic, ICL/PEPM superfamily, alpha-ketoglutarate LIG isomerase; HET: AKG; 1.65A {Deinococcus ficus} Back     alignment and structure
>2qiw_A PEP phosphonomutase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: P6G; 1.80A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1dqu_A Isocitrate lyase; beta barrel; 2.80A {Emericella nidulans} SCOP: c.1.12.7 Back     alignment and structure
>3vav_A 3-methyl-2-oxobutanoate hydroxymethyltransferase; structural genomics, seattle structural genomics center for infectious disease; 1.80A {Burkholderia thailandensis} SCOP: c.1.12.8 PDB: 3ez4_A Back     alignment and structure
>1m3u_A 3-methyl-2-oxobutanoate hydroxymethyltransferase; beta-alpha-barrel, TIM-barrel, ketopantoate, selenomethionin decamer; HET: KPL; 1.80A {Escherichia coli} SCOP: c.1.12.8 Back     alignment and structure
>1o66_A 3-methyl-2-oxobutanoate hydroxymethyltransferase; structural genomics; HET: MSE; 1.75A {Neisseria meningitidis serogroup B} SCOP: c.1.12.8 PDB: 1o68_A* Back     alignment and structure
>1oy0_A Ketopantoate hydroxymethyltransferase; domain swapping, structural genomics, PSI, protein structure initiative; 2.80A {Mycobacterium tuberculosis} SCOP: c.1.12.8 Back     alignment and structure
>2p10_A MLL9387 protein; putative phosphonopyruvate hydrolase, structural genomics, J center for structural genomics, JCSG; HET: MSE; 2.15A {Mesorhizobium loti} SCOP: c.1.12.9 Back     alignment and structure
>1h5y_A HISF; histidine biosynthesis, TIM-barrel; 2.0A {Pyrobaculum aerophilum} SCOP: c.1.2.1 Back     alignment and structure
>1thf_D HISF protein; thermophIle, TIM-barrel, histidine biosynthesis, lyase, phosphate-binding sites; 1.45A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2wjz_A 2a0n_A* 1gpw_A 1vh7_A 2rkx_A 3iio_A 3iip_A* 3iiv_A Back     alignment and structure
>1ka9_F Imidazole glycerol phosphtate synthase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 2.30A {Thermus thermophilus} SCOP: c.1.2.1 Back     alignment and structure
>3igs_A N-acetylmannosamine-6-phosphate 2-epimerase 2; energy metabolism, sugars, csgid, carbohydrate metabolism, isomerase; HET: MSE 16G; 1.50A {Salmonella enterica subsp} SCOP: c.1.2.0 Back     alignment and structure
>2yxg_A DHDPS, dihydrodipicolinate synthase; MJ0244, TIM beta/alpha-barrel fold, structural genomics, NPPSFA; 2.20A {Methanocaldococcus jannaschii DSM2661} Back     alignment and structure
>2ehh_A DHDPS, dihydrodipicolinate synthase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.90A {Aquifex aeolicus} Back     alignment and structure
>3q58_A N-acetylmannosamine-6-phosphate 2-epimerase; TIM beta/alpha barrel, ribulose-phosphate binding barrel, carbohydrate metabolic process; HET: BTB; 1.80A {Salmonella enterica subsp} Back     alignment and structure
>3cpr_A Dihydrodipicolinate synthetase; (beta/alpha)8-barrel fold with A C-terminal alpha-helical segment, amino-acid biosynthesis, cytoplasm; HET: MCL; 2.20A {Corynebacterium glutamicum} Back     alignment and structure
>3l21_A DHDPS, dihydrodipicolinate synthase; DAPA, dimer, RV2753C, lysine biosynthesis, amino-acid biosynthesis, diaminopimelate biosynthesis; HET: KPI CME; 2.10A {Mycobacterium tuberculosis} SCOP: c.1.10.1 PDB: 1xxx_A Back     alignment and structure
>3a5f_A Dihydrodipicolinate synthase; TIM barrel, enzyme, amino-acid biosynthesis, cytoplasm, diaminopimelate biosynthesis, lyase; HET: KPI; 1.19A {Clostridium botulinum A} PDB: 3bi8_A* 3ird_A* Back     alignment and structure
>1xky_A Dihydrodipicolinate synthase; TIM barrel, , lysine biosynthesis;spine, lyase; 1.94A {Bacillus anthracis} SCOP: c.1.10.1 PDB: 1xl9_A 3hij_A* Back     alignment and structure
>3m5v_A DHDPS, dihydrodipicolinate synthase; TIM barrel, csgid, amino-acid biosynthesis, diaminopimelate biosynthesis, lyase, lysine biosynthesis; HET: MSE; 1.80A {Campylobacter jejuni} SCOP: c.1.10.0 PDB: 3ler_A* Back     alignment and structure
>2w6r_A Imidazole glycerol phosphate synthase subunit HISF; lyase, fusion protein, cobalamin, precorrin, novel fold, VIT; 2.10A {Thermotoga maritima} Back     alignment and structure
>2tps_A Protein (thiamin phosphate synthase); thiamin biosynthesis, TIM barrel; HET: TPS; 1.25A {Bacillus subtilis} SCOP: c.1.3.1 PDB: 1g4t_A* 3o15_A* 1g6c_A* 1g4e_A* 1g69_A* 3o16_A 1g4s_A* 1g4p_A* 1g67_A* Back     alignment and structure
>2ekc_A AQ_1548, tryptophan synthase alpha chain; structural genomics, lyase, NPPSFA, national project on PROT structural and functional analyses; 2.00A {Aquifex aeolicus} Back     alignment and structure
>1jub_A Dihydroorotate dehydrogenase A; homodimer, alpha-beta barrel, flavoprotein, mutant enzyme, oxidoreductase; HET: FMN; 1.40A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ovd_A* 1jue_A* 1dor_A* 2bsl_A* 2bx7_A* 2dor_A* 1jqv_A* 1jrb_A* 1jrc_A* 1jqx_A* Back     alignment and structure
>2ojp_A DHDPS, dihydrodipicolinate synthase; dimer, lysine biosynthe lyase; HET: KGC GOL; 1.70A {Escherichia coli} PDB: 1yxc_A 1dhp_A 1yxd_A* 2ats_A* 3du0_A* 3c0j_A* 3ubs_A* 4eou_A* 3i7q_A* 3i7r_A* 3i7s_A* 2pur_A* 1s5v_A 1s5w_A 1s5t_A 3den_A* 2a6l_A 2a6n_A 3g0s_A Back     alignment and structure
>2rfg_A Dihydrodipicolinate synthase; beta barrel, amino-acid biosynthesis, diaminopimelate biosyn lyase, lysine biosynthesis, schiff base; 1.50A {Hahella chejuensis} Back     alignment and structure
>2vc6_A MOSA, dihydrodipicolinate synthase; DHDPS, TIM barrel, schiff base, lyase; HET: MCL; 1.95A {Sinorhizobium meliloti} Back     alignment and structure
>2r8w_A AGR_C_1641P; APC7498, dihydrodipicolinate synthase, agrobacterium tumefac C58, structural genomics, PSI-2; HET: MSE; 1.80A {Agrobacterium tumefaciens str} Back     alignment and structure
>3flu_A DHDPS, dihydrodipicolinate synthase; TIM barrel, beta-alpha-barrel, amino-acid biosynthesis, diaminopimelate biosynthesis; 2.00A {Neisseria meningitidis serogroup B} SCOP: c.1.10.0 Back     alignment and structure
>1o5k_A DHDPS, dihydrodipicolinate synthase; TM1521, structural genomics, J protein structure initiative, joint center for structural G lyase; HET: MCL; 1.80A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 3pb2_A 3pb0_A Back     alignment and structure
>2wkj_A N-acetylneuraminate lyase; directed evolution, sialic acid mimetics, aldolase, S base, carbohydrate metabolism, N-acetylneuraminic acid LYAS; HET: KPI PYR; 1.45A {Escherichia coli} PDB: 2wnq_A 2xfw_A* 2wpb_A* 2wnz_A* 2ygy_A* 2wo5_A* 2wnn_A* 3lbm_A 3lbc_A 3lcf_A 3lcl_A 3lcg_A 3lch_A 3lci_A 1hl2_A 1fdy_A 1fdz_A 1nal_1 3lcx_A 3lcw_A Back     alignment and structure
>1f6k_A N-acetylneuraminate lyase; beta barrel; 1.60A {Haemophilus influenzae} SCOP: c.1.10.1 PDB: 1f5z_A 1f6p_A 1f73_A* 1f74_A* 1f7b_A* Back     alignment and structure
>3qfe_A Putative dihydrodipicolinate synthase family PROT; seattle structural genomics center for infectious disease, S coccidioides, valley fever; 2.35A {Coccidioides immitis} Back     alignment and structure
>2v9d_A YAGE; dihydrodipicolinic acid synthase, N-acetyl neuraminate lyase, NAL, lyase, DHDPS, prophage; 2.15A {Escherichia coli} PDB: 2v8z_A 3nev_A* 3n2x_A* Back     alignment and structure
>3e96_A Dihydrodipicolinate synthase; structural genomics, nysgrc, target 9375C, operon, PSI-2; 1.80A {Bacillus clausii ksm-k16} SCOP: c.1.10.0 Back     alignment and structure
>3daq_A DHDPS, dihydrodipicolinate synthase; lysine biosynthesis, amino-ACI biosynthesis, diaminopimelate biosynthesis, lyase, schiff B; 1.45A {Staphylococcus aureus} SCOP: c.1.10.0 PDB: 3di1_A 3di0_A Back     alignment and structure
>2e6f_A Dihydroorotate dehydrogenase; chagas disease, pyrimidine biosynthesis, fumarate reductase, energy metabolism, redox homeostasis, flavoprotein; HET: FMN OXC; 1.26A {Trypanosoma cruzi} PDB: 2e6a_A* 2e6d_A* 2e68_A* 2djl_A* 2djx_A* 3c3n_A* 2b4g_A* 3c61_A* 3mhu_A* 3mjy_A* Back     alignment and structure
>3eb2_A Putative dihydrodipicolinate synthetase; lysine biosynthesis, pyruvate, TIM barrel, NYSGXRC, PSI2., structural genomics; HET: PGE; 2.04A {Rhodopseudomonas palustris} SCOP: c.1.10.0 Back     alignment and structure
>3b4u_A Dihydrodipicolinate synthase; structural genomics, PSI-2, MC protein structure initiative, midwest center for structural genomics; 1.20A {Agrobacterium tumefaciens str} Back     alignment and structure
>2nuw_A 2-keto-3-deoxygluconate/2-keto-3-deoxy-6-phospho aldolase; TIM barrel, lyase; 1.80A {Sulfolobus acidocaldarius dsm 639} PDB: 2nux_A 2nuy_A Back     alignment and structure
>3tak_A DHDPS, dihydrodipicolinate synthase; TIM barrel, lysine biosynthesis, pyruvate, lyase; 1.42A {Acinetobacter baumannii} PDB: 3pud_A* 3pue_A* 3pul_A 3rk8_A 3tce_A* 3tdf_A 3u8g_A 3uqn_A 4dxv_A Back     alignment and structure
>3qze_A DHDPS, dihydrodipicolinate synthase; alpha beta barrel, cytoplasmic; 1.59A {Pseudomonas aeruginosa} PDB: 3puo_A* 3noe_A 3ps7_A* 3s8h_A Back     alignment and structure
>1rd5_A Tryptophan synthase alpha chain, chloroplast; hydroxamic acid, diboa, dimboa, indole, indole-glycerol-PHOS lyase; 2.02A {Zea mays} SCOP: c.1.2.4 PDB: 1tjr_A Back     alignment and structure
>2r91_A 2-keto-3-deoxy-(6-phospho-)gluconate aldolase; TIM barrel, thermophilic, lyase; 2.00A {Thermoproteus tenax} PDB: 2r94_A Back     alignment and structure
>3fkr_A L-2-keto-3-deoxyarabonate dehydratase; DHDPS/NAL family, complex, pyruvate, lyase; HET: KPI; 1.80A {Azospirillum brasilense} PDB: 3fkk_A Back     alignment and structure
>1vzw_A Phosphoribosyl isomerase A; histidine biosynthesis, tryptophan biosynthesis; 1.8A {Streptomyces coelicolor} SCOP: c.1.2.1 PDB: 2vep_A 2x30_A Back     alignment and structure
>1yxy_A Putative N-acetylmannosamine-6-phosphate 2-epimer; structural genomics, epimerase, PSI, structure initiative; 1.60A {Streptococcus pyogenes} SCOP: c.1.2.5 Back     alignment and structure
>3na8_A Putative dihydrodipicolinate synthetase; lyase; HET: MSE; 1.85A {Pseudomonas aeruginosa} Back     alignment and structure
>3si9_A DHDPS, dihydrodipicolinate synthase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, TIM barrel; 2.10A {Bartonella henselae} Back     alignment and structure
>3d0c_A Dihydrodipicolinate synthase; lysine biosynthesis, pyruvate, TIM barrel, NYSGXRC, PSI-2, structural genomics; 1.90A {Oceanobacillus iheyensis HTE831} Back     alignment and structure
>2y88_A Phosphoribosyl isomerase A; aromatic amino acid biosynthesis, TIM-barrel, His biosynthesis, tryptophan biosynthesis; HET: 2ER; 1.33A {Mycobacterium tuberculosis} PDB: 2y89_A 2y85_A* Back     alignment and structure
>1qop_A Tryptophan synthase alpha chain; lyase, carbon-oxygen lyase, tryptophan biosynthesis, pyridoxal phosphate; HET: IPL PLP; 1.4A {Salmonella typhimurium} SCOP: c.1.2.4 PDB: 1k8x_A* 1wbj_A* 2clk_A* 2j9z_A* 3cep_A* 1k8y_A* 1a5s_A* 1a50_A* 1c29_A* 1c8v_A* 1c9d_A* 1bks_A* 1cx9_A* 1fuy_A* 1cw2_A* 1k7e_A* 1k7f_A* 1k7x_A* 1k3u_A* 1k8z_A* ... Back     alignment and structure
>3s5o_A 4-hydroxy-2-oxoglutarate aldolase, mitochondrial; beta barrel, schiff base, hydroxyproline metabolis; HET: KPI; 1.97A {Homo sapiens} SCOP: c.1.10.0 PDB: 3s5n_A Back     alignment and structure
>1w3i_A EDA, 2-keto-3-deoxy gluconate aldolase; archaeal metabolism, pyruvate; 1.7A {Sulfolobus solfataricus} SCOP: c.1.10.1 PDB: 1w37_A 1w3n_A* 1w3t_A* 2yda_A* Back     alignment and structure
>4dpp_A DHDPS 2, dihydrodipicolinate synthase 2, chloroplastic; amino-acid biosynthesis, (S)-lysine biosynthesis VIA DAP PAT (beta/alpha)8-barrel; 2.00A {Arabidopsis thaliana} PDB: 4dpq_A* 3tuu_A* Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>3f4w_A Putative hexulose 6 phosphate synthase; humps, malonate, lyase; 1.65A {Salmonella typhimurium} SCOP: c.1.2.0 Back     alignment and structure
>4adt_A Pyridoxine biosynthetic enzyme PDX1 homologue, PU; transferase, pyridoxal 5-phosphate biosynthesis; 2.42A {Plasmodium berghei} PDB: 4adu_A* 4ads_A Back     alignment and structure
>1y0e_A Putative N-acetylmannosamine-6-phosphate 2-epimer; mannac-6-P epimerase, NANE, structural genomics, protein STR initiative, PSI; 1.95A {Staphylococcus aureus subsp} SCOP: c.1.2.5 Back     alignment and structure
>3h5d_A DHDPS, dihydrodipicolinate synthase; lysine biosynthesis, amino-ACI biosynthesis, schiff base, cytoplasm, diaminopimelate biosy lyase; HET: MES; 1.99A {Streptococcus pneumoniae} Back     alignment and structure
>3dz1_A Dihydrodipicolinate synthase; lysine biosynthesis, pyruvate, TIM barrel, NYSGXRC, PSI2, structural genomics; 1.87A {Rhodopseudomonas palustris} SCOP: c.1.10.0 Back     alignment and structure
>1xi3_A Thiamine phosphate pyrophosphorylase; structural genomics, southeast collaboratory for structural genomics, hyperthermophIle; 1.70A {Pyrococcus furiosus} SCOP: c.1.3.1 Back     alignment and structure
>3vnd_A TSA, tryptophan synthase alpha chain; psychrophilic enzyme, cold adaptation; HET: PE8; 2.60A {Shewanella frigidimarina} Back     alignment and structure
>1qo2_A Molecule: N-((5-phosphoribosyl)-formimino)-5-aminoimidazol- 4-carboxamid ribonucleotid...; isomerase, histidine biosynthesis; 1.85A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2cff_A 2w79_A Back     alignment and structure
>2f6u_A GGGPS, (S)-3-O-geranylgeranylglyceryl phosphate synthase; non-canonical TIM-barrel, prenyltransferase, archaeal lipid synthesis, dimer; HET: CIT; 1.55A {Archaeoglobus fulgidus} SCOP: c.1.4.1 PDB: 2f6x_A* Back     alignment and structure
>3nav_A Tryptophan synthase alpha chain; alpha subunit, structural genomics, CSG center for structural genomics of infectious diseases; 2.10A {Vibrio cholerae o1 biovar el tor} SCOP: c.1.2.4 Back     alignment and structure
>1ujp_A Tryptophan synthase alpha chain; riken structural genomics/P initiative, RSGI, structural genomics, lyase; HET: CIT; 1.34A {Thermus thermophilus} SCOP: c.1.2.4 PDB: 1wxj_A* Back     alignment and structure
>2qjg_A Putative aldolase MJ0400; beta-alpha barrel, lyase; HET: F2P; 2.60A {Methanocaldococcus jannaschii} PDB: 2qjh_A 2qji_A Back     alignment and structure
>1vyr_A Pentaerythritol tetranitrate reductase; oxidoreductase, flavoenzyme, explosive degradation, steroid binding; HET: FMN TNF; 0.9A {Enterobacter cloacae} SCOP: c.1.4.1 PDB: 1gvq_A* 1gvr_A* 1gvs_A* 1h50_A* 1h51_A* 1h60_A* 1h61_A* 1h62_A* 1h63_A* 1gvo_A* 2aba_A* 3f03_K* 3kft_A* 3p7y_A* 3p80_A* 3p81_A* 3p62_A* 3p8i_A* 2abb_A* 3p67_A* ... Back     alignment and structure
>1z41_A YQJM, probable NADH-dependent flavin oxidoreductase YQJ; FMN, beta-alpha-barrel; HET: FMN; 1.30A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1z42_A* 1z44_A* 1z48_A* Back     alignment and structure
>3b0p_A TRNA-dihydrouridine synthase; TIM barrel, oxidoreductase; HET: FMN; 1.70A {Thermus thermophilus} PDB: 3b0u_X* 3b0v_C* Back     alignment and structure
>2r14_A Morphinone reductase; H-tunnelling, flavoprotein, NADH, hydride transfer, oxidoreductase; HET: FMN TXD; 1.40A {Pseudomonas putida} PDB: 3gx9_A* 1gwj_A* Back     alignment and structure
>1mdl_A Mandelate racemase; isomerase, mandelate pathway, magnesium; HET: RMN SMN; 1.85A {Pseudomonas aeruginosa} SCOP: c.1.11.2 d.54.1.1 PDB: 1mdr_A* 3uxk_A* 3uxl_A* 1dtn_A* 1mra_A* 2mnr_A 1mns_A Back     alignment and structure
>1p0k_A Isopentenyl-diphosphate delta-isomerase; terpene biosynthesis, dimethylallyl diphosphate, flavoprotein; 1.90A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1p0n_A* Back     alignment and structure
>2hmc_A AGR_L_411P, dihydrodipicolinate synthase; alpha-beta barrel (TIM barrel), structural genomics, PSI-2, structure initiative; HET: MSE; 1.90A {Agrobacterium tumefaciens str} Back     alignment and structure
>1f76_A Dihydroorotate dehydrogenase; monomer, alpha-beta-barrel, FMN binding domain, orotate complex, oxidoreductase; HET: MSE FMN ORO; 2.50A {Bacteria} SCOP: c.1.4.1 Back     alignment and structure
>2z6i_A Trans-2-enoyl-ACP reductase II; fatty acid synthesis, antibiotics, oxidoreductase, flavoprotein; HET: FMN; 1.70A {Streptococcus pneumoniae} PDB: 2z6j_A* Back     alignment and structure
>1wv2_A Thiazole moeity, thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI; 2.90A {Pseudomonas aeruginosa} SCOP: c.1.31.1 Back     alignment and structure
>1gvf_A Tagatose-bisphosphate aldolase AGAY; lyase, zinc.; HET: PGH; 1.45A {Escherichia coli} SCOP: c.1.10.2 Back     alignment and structure
>4ef8_A Dihydroorotate dehydrogenase; phenyl isothiocyanate, PYRD, oxidoreductase, oxidoreductase-oxidor inhibitor complex; HET: FMN; 1.56A {Leishmania major} PDB: 3gye_A* 3gz3_A* 4ef9_A* 3tro_A* 3tjx_A* Back     alignment and structure
>1viz_A PCRB protein homolog; structural genomics, unknown function; 1.85A {Bacillus subtilis} SCOP: c.1.4.1 Back     alignment and structure
>2v82_A 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; lyase, kdpgal; HET: KDP; 2.1A {Escherichia coli} PDB: 2v81_A* Back     alignment and structure
>2zad_A Muconate cycloisomerase; muconate lactonizing enzyme (MLE), TM0006, struct genomics, NPPSFA; HET: 1PE; 1.60A {Thermotoga maritima} PDB: 3deq_A 3der_A* 3des_A* 3dfy_A Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>2gou_A Oxidoreductase, FMN-binding; OLD yeallow enzyme, flavoenzyme; HET: BOG FMN PE4; 1.40A {Shewanella oneidensis} PDB: 2gq8_A* 2gq9_A* 2gqa_A* Back     alignment and structure
>3hgj_A Chromate reductase; TIM barrel, oxidoreductase; HET: FMN; 2.00A {Thermus scotoductus} SCOP: c.1.4.0 PDB: 3hf3_A* Back     alignment and structure
>2p8b_A Mandelate racemase/muconate lactonizing enzyme family protein; enolase superfamily, prediction of function; HET: NSK; 1.70A {Bacillus cereus atcc 14579} PDB: 2p88_A* 2p8c_A* Back     alignment and structure
>3ru6_A Orotidine 5'-phosphate decarboxylase; structural genomics, center for structural genomics of infec diseases (csgid), TIM-barrel; 1.80A {Campylobacter jejuni subsp} Back     alignment and structure
>2rdx_A Mandelate racemase/muconate lactonizing enzyme, P; enolase, structural genomics, PSI, protein structu initiative, nysgrc; 2.00A {Roseovarius nubinhibens} Back     alignment and structure
>2yzr_A Pyridoxal biosynthesis lyase PDXS; redox protein, pyridoxal phosphate, structural genomi NPPSFA; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>2fiq_A Putative tagatose 6-phosphate kinase 1; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics; 2.25A {Escherichia coli} SCOP: c.1.10.7 Back     alignment and structure
>3sz8_A 2-dehydro-3-deoxyphosphooctonate aldolase 2; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 2.05A {Burkholderia pseudomallei} PDB: 3tmq_A* 3und_A* Back     alignment and structure
>2nv1_A Pyridoxal biosynthesis lyase PDXS; (beta/alpha)8-barrel, synthase; 2.08A {Bacillus subtilis} PDB: 2nv2_A* 1znn_A Back     alignment and structure
>1geq_A Tryptophan synthase alpha-subunit; hyperthermophIle, pyrococ furiosus, X-RAY analysis, stability, calorimetry, lyase; 2.00A {Pyrococcus furiosus} SCOP: c.1.2.4 PDB: 1wdw_A* 2dzu_A 2dzp_A 2e09_A 2dzw_A 2dzs_A 2dzv_A 2dzt_A 2dzx_A Back     alignment and structure
>1to3_A Putative aldolase YIHT; beta-alpha barrel, structural genomics, PSI, protein structure initiative; 2.70A {Salmonella typhimurium} SCOP: c.1.10.1 Back     alignment and structure
>1tkk_A Similar to chloromuconate cycloisomerase; epimerase, enolase super family,; 2.10A {Bacillus subtilis} SCOP: c.1.11.2 d.54.1.1 PDB: 1jpm_A Back     alignment and structure
>2oz8_A MLL7089 protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.48A {Mesorhizobium loti} Back     alignment and structure
>3tfx_A Orotidine 5'-phosphate decarboxylase; PSI-biology, nysgrc, 000529, structural genomics, NEW YORK S genomics research consortium; 2.19A {Lactobacillus acidophilus} Back     alignment and structure
>3nvt_A 3-deoxy-D-arabino-heptulosonate 7-phosphate synth; bifunctional 3-deoxy-7-phosphoheptulonate synthase/chorismat listeria monocytogenes EGD-E; 1.95A {Listeria monocytogenes} PDB: 3tfc_A* Back     alignment and structure
>1rvk_A Isomerase/lactonizing enzyme; enolase superfamily, MR.GI-17937161, NYSGXRC, target T1522, structural genomics, PSI; 1.70A {Agrobacterium tumefaciens} SCOP: c.1.11.2 d.54.1.1 Back     alignment and structure
>2ovl_A Putative racemase; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.13A {Streptomyces coelicolor A3} PDB: 3ck5_A Back     alignment and structure
>2ps2_A Putative mandelate racemase/muconate lactonizing enzyme; structural genomics, NYSGXRC, target 9440A, enolase superfamily, PSI-2; 1.80A {Aspergillus oryzae RIB40} Back     alignment and structure
>3m47_A Orotidine 5'-phosphate decarboxylase; orotidine 5'-monophosphate decarboxylase, mutant I218A, LYAS; 1.20A {Methanothermobacter thermautotrophicusdelta H} SCOP: c.1.2.3 PDB: 3li1_A 3m5z_A 3lty_A 3ltp_A* 3g18_A* 3g1d_A* 3g1f_A* 3g1h_A* 3g1a_A* 3lv6_A* 1klz_A* 3g1y_A 3g22_A* 3g24_A* 3p5z_A* 3siz_A* 3sy5_A* 1loq_A* 1lor_A* 1kly_A* ... Back     alignment and structure
>3o63_A Probable thiamine-phosphate pyrophosphorylase; thiamin biosynthesis, TIM barrel, transferase; 2.35A {Mycobacterium tuberculosis} Back     alignment and structure
>3q94_A Fructose-bisphosphate aldolase, class II; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta barrel; HET: 13P; 2.30A {Bacillus anthracis} SCOP: c.1.10.0 Back     alignment and structure
>1jvn_A Glutamine, bifunctional histidine biosynthesis protein hishf; substrate channeling, amidotransferase, TIM-barrel AS A SUBS tunnel; HET: 143; 2.10A {Saccharomyces cerevisiae} SCOP: c.1.2.1 c.23.16.1 PDB: 1ox4_B* 1ox5_A* 1ox6_A 1ox4_A Back     alignment and structure
>1zco_A 2-dehydro-3-deoxyphosphoheptonate aldolase; arabino-heptulosonate, synthase, shikimate, DAHP, DAH7P, DAH DAH7PS, lyase; HET: PEP; 2.25A {Pyrococcus furiosus} Back     alignment and structure
>3zwt_A Dihydroorotate dehydrogenase (quinone), mitochond; oxidoreductase; HET: FMN ORO KFZ; 1.55A {Homo sapiens} PDB: 1d3h_A* 2bxv_A* 2prh_A* 2prl_A* 2prm_A* 3f1q_A* 3fj6_A* 3fjl_A* 3g0u_A* 3g0x_A* 3zws_A* 1d3g_A* 3u2o_A* 2fpv_A* 2fpt_A* 2fpy_A* 2fqi_A* 3kvl_A* 3kvk_A* 3kvj_A* ... Back     alignment and structure
>3bo9_A Putative nitroalkan dioxygenase; TM0800, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE 2PE; 2.71A {Thermotoga maritima MSB8} Back     alignment and structure
>2qde_A Mandelate racemase/muconate lactonizing enzyme FA protein; PSI-II, NYSGXRC, enolase, structural genomics, protei structure initiative, PSI-2; 1.93A {Azoarcus SP} Back     alignment and structure
>1icp_A OPR1, 12-oxophytodienoate reductase 1; beta-alpha-barrel, protein-FMN-PEG complex, oxidoreductase; HET: FMN 2PE; 1.90A {Solanum lycopersicum} SCOP: c.1.4.1 PDB: 1icq_A* 1ics_A* 3hgr_A* 1vji_A* 2q3r_A* Back     alignment and structure
>2zbt_A Pyridoxal biosynthesis lyase PDXS; pyridoxine biosynthesis, structural genomics, NPPSFA; 1.65A {Thermus thermophilus} PDB: 2iss_A* Back     alignment and structure
>2og9_A Mandelate racemase/muconate lactonizing enzyme; NYSGXRC, protein structure initiative (PSI) II, PSI-2, 9382A mandelate racemase; 1.90A {Polaromonas SP} PDB: 3cb3_A* Back     alignment and structure
>3bjs_A Mandelate racemase/muconate lactonizing enzyme; enolase, structural genomics, PSI-2, protein struc initiative; 2.70A {Polaromonas SP} Back     alignment and structure
>3o07_A Pyridoxine biosynthesis protein SNZ1; (beta/alpha)8-barrel, pyridoxal 5-phosphate synthase, PLP G3 SNO1, biosynthetic protein; HET: 1GP; 1.80A {Saccharomyces cerevisiae} PDB: 3o06_A 3o05_A* 3fem_A Back     alignment and structure
>3r0u_A Enzyme of enolase superfamily; structural genomics, putative epimerase, PSI-biolog YORK structural genomics research consortium; HET: MSE TAR; 1.90A {Francisella philomiragia subsp} PDB: 3px5_A* 3r0k_A* 3r10_A 3r11_A 3r1z_A* Back     alignment and structure
>3sr7_A Isopentenyl-diphosphate delta-isomerase; isopentenyl pyrophosphate isomerase, TIM-barrel; 2.04A {Streptococcus mutans} Back     alignment and structure
>1o66_A 3-methyl-2-oxobutanoate hydroxymethyltransferase; structural genomics; HET: MSE; 1.75A {Neisseria meningitidis serogroup B} SCOP: c.1.12.8 PDB: 1o68_A* Back     alignment and structure
>2pcq_A Putative dihydrodipicolinate synthase; lyase, lysine biosynthesis, dihydrodipicoliante, S genomics, NPPSFA; 2.10A {Thermus thermophilus} Back     alignment and structure
>4e5t_A Mandelate racemase / muconate lactonizing enzyme, terminal domain protein; aldolase, structural genomics, biology; 2.90A {Labrenzia alexandrii} Back     alignment and structure
>2pgw_A Muconate cycloisomerase; enolase superfamily, octamer, small metabolism, PSI-II, NYSGXRC, structural genomics, PR structure initiative; 1.95A {Sinorhizobium meliloti} Back     alignment and structure
>3gr7_A NADPH dehydrogenase; flavin, FMN, beta-alpha-barrel, oxidoreductase, flavoprotein; HET: FMN; 2.30A {Geobacillus kaustophilus} PDB: 3gr8_A* Back     alignment and structure
>3khj_A Inosine-5-monophosphate dehydrogenase; enzyme-inhibitor complex, oxidoreductase; HET: IMP C64; 2.80A {Cryptosporidium parvum} Back     alignment and structure
>1nu5_A Chloromuconate cycloisomerase; enzyme, dehalogenation; 1.95A {Pseudomonas SP} SCOP: c.1.11.2 d.54.1.1 Back     alignment and structure
>1rvg_A Fructose-1,6-bisphosphate aldolase; class II aldolase, metal-depdendent aldolase, lyase; 2.00A {Thermus aquaticus} SCOP: c.1.10.2 PDB: 1rv8_A 2fjk_A* Back     alignment and structure
>2nwr_A 2-dehydro-3-deoxyphosphooctonate aldolase; KDO, KDO8P, KDO8PS, PEP, A5P, transferase; HET: PEP; 1.50A {Aquifex aeolicus} PDB: 2nws_A* 2nx1_A* 3e0i_A* 1fwn_A* 1fwt_A* 1fws_A* 1fx6_A 1fww_A 1fxq_A* 1fy6_A* 1jcx_A* 1jcy_A* 1pck_A* 1pcw_A* 1fxp_A* 2a21_A* 2a2i_A* 1pe1_A* 3e12_A* 2nx3_A* ... Back     alignment and structure
>3l5l_A Xenobiotic reductase A; TIM barrel, oxidoreductase; HET: BU3 FMN; 1.03A {Pseudomonas putida} SCOP: c.1.4.0 PDB: 3l5m_A* 3n19_B* 3n16_A* 3l68_A* 3l67_A* 3l65_A* 3l66_A* 3n14_A* 2h8z_A* 2h90_A* 2h8x_A* Back     alignment and structure
>1dqu_A Isocitrate lyase; beta barrel; 2.80A {Emericella nidulans} SCOP: c.1.12.7 Back     alignment and structure
>3ozy_A Putative mandelate racemase; beta-alpha barrel, enolase superfamily member, M-xylarate, U function; HET: DXL; 1.30A {Bordetella bronchiseptica} PDB: 3ozm_A* 3h12_A 3op2_A* Back     alignment and structure
>1jub_A Dihydroorotate dehydrogenase A; homodimer, alpha-beta barrel, flavoprotein, mutant enzyme, oxidoreductase; HET: FMN; 1.40A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ovd_A* 1jue_A* 1dor_A* 2bsl_A* 2bx7_A* 2dor_A* 1jqv_A* 1jrb_A* 1jrc_A* 1jqx_A* Back     alignment and structure
>2pp0_A L-talarate/galactarate dehydratase; enolase superfamily, LYA; 2.20A {Salmonella typhimurium} PDB: 2pp1_A* 2pp3_A* Back     alignment and structure
>3tsm_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, ssgcid, seattle structural GE center for infectious disease, lyase; 2.15A {Brucella melitensis} SCOP: c.1.2.0 Back     alignment and structure
>3eez_A Putative mandelate racemase/muconate lactonizing enzyme; structural genomics, unknown function, PSI-2, protein structure initiative; 2.80A {Silicibacter pomeroyi} Back     alignment and structure
>3qja_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, T structural genomics consortium, TBSGC, lyase; 1.29A {Mycobacterium tuberculosis} PDB: 3t40_A* 3t44_A* 3t55_A* 3t78_A* 4fb7_A* Back     alignment and structure
>1xm3_A Thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI, NESG, northeast structural genomics consortium; 1.80A {Bacillus subtilis} SCOP: c.1.31.1 PDB: 1tyg_A Back     alignment and structure
>3fs2_A 2-dehydro-3-deoxyphosphooctonate aldolase; ssgcid, bruciellla melitensis, DAHP synthetase I, cytoplasm, lipopolysaccharide biosynthesis; HET: PG4; 1.85A {Brucella melitensis} Back     alignment and structure
>3iwp_A Copper homeostasis protein CUTC homolog; conserved sequence motif, metal-binding site, polymorphism, metal binding protein; 2.50A {Homo sapiens} Back     alignment and structure
>3vav_A 3-methyl-2-oxobutanoate hydroxymethyltransferase; structural genomics, seattle structural genomics center for infectious disease; 1.80A {Burkholderia thailandensis} SCOP: c.1.12.8 PDB: 3ez4_A Back     alignment and structure
>2qdd_A Mandelate racemase/muconate lactonizing enzyme; enolase, structural genomics, PSI, protein structu initiative, nysgrc; 2.30A {Roseovarius nubinhibens} PDB: 3fvd_B Back     alignment and structure
>1vs1_A 3-deoxy-7-phosphoheptulonate synthase; (beta/alpha)8 barrel, transferase; HET: PEP; 2.30A {Aeropyrum pernix} Back     alignment and structure
>2czd_A Orotidine 5'-phosphate decarboxylase; pyrimidine biosynthesis, orotidine 5'-phosphate decarboxylas (ompdecase), structural genomics; 1.60A {Pyrococcus horikoshii} SCOP: c.1.2.3 PDB: 2cz5_A 2cze_A* 2czf_A* Back     alignment and structure
>1ep3_A Dihydroorotate dehydrogenase B (PYRD subunit); heterotetramer, alpha-beta barrel, beta sandwich, FAD domain alpha/beta NADP domain; HET: FMN FAD; 2.10A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ep2_A* 1ep1_A* Back     alignment and structure
>1vr6_A Phospho-2-dehydro-3-deoxyheptonate aldolase; TM0343, structural genomics, joint center for STRU genomics, JCSG, protein structure initiative; 1.92A {Thermotoga maritima} SCOP: c.1.10.4 PDB: 1rzm_A* 3pg9_A* 3pg8_A* Back     alignment and structure
>1ypf_A GMP reductase; GUAC, purines, pyrimidines, nucleosides, nucleotides, nucleo nucleoside interconversions, spine, structural genomics; 1.80A {Bacillus anthracis} PDB: 2a1y_A* Back     alignment and structure
>2qgy_A Enolase from the environmental genome shotgun sequencing of the sargasso SEA; structural genomics, unknown function, PSI-2; 1.80A {Environmental sample} Back     alignment and structure
>3kru_A NADH:flavin oxidoreductase/NADH oxidase; homotetramer, dimer of dimers, TIM barrel, thermophilic, OLD enzyme; HET: FMN; 1.60A {Thermoanaerobacter pseudethanolicus AT} SCOP: c.1.4.0 PDB: 3krz_A* Back     alignment and structure
>2nli_A Lactate oxidase; flavoenzyme, FMN, D-lactate, oxidoreducta; HET: FMN; 1.59A {Aerococcus viridans} PDB: 2zfa_A* 2du2_A* 2e77_A* 2j6x_A* Back     alignment and structure
>1z41_A YQJM, probable NADH-dependent flavin oxidoreductase YQJ; FMN, beta-alpha-barrel; HET: FMN; 1.30A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1z42_A* 1z44_A* 1z48_A* Back     alignment and structure
>1m3u_A 3-methyl-2-oxobutanoate hydroxymethyltransferase; beta-alpha-barrel, TIM-barrel, ketopantoate, selenomethionin decamer; HET: KPL; 1.80A {Escherichia coli} SCOP: c.1.12.8 Back     alignment and structure
>1h7n_A 5-aminolaevulinic acid dehydratase; lyase, aldolase, TIM barrel, tetrapyrrole synthesis; HET: SHF; 1.6A {Saccharomyces cerevisiae} SCOP: c.1.10.3 PDB: 1h7p_A* 1h7r_A* 1ohl_A* 1qml_A 1qnv_A 1w31_A* 1h7o_A* 1eb3_A* 1gjp_A* 1ylv_A* 1aw5_A Back     alignment and structure
>3gd6_A Muconate cycloisomerase; structural genomics, NYSGXRC, target 9375A, divergent enolase, lyase, PSI-2; 1.60A {Oceanobacillus iheyensis HTE831} PDB: 2oqy_A 3es8_A 3es7_A 3fyy_A 3hpf_A* Back     alignment and structure
>4fo4_A Inosine 5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.03A {Vibrio cholerae o1 biovar el tor} PDB: 4ff0_A* 4hlv_A* 4fez_A Back     alignment and structure
>3sjn_A Mandelate racemase/muconate lactonizing protein; enolase, magnesium binding site, lyase; 1.90A {Shewanella pealeana} Back     alignment and structure
>2gjl_A Hypothetical protein PA1024; 2-nitropropane dioxygenase, 2-nitropropane, FMN, oxidoreduct; HET: FMN; 2.00A {Pseudomonas aeruginosa PAO1} PDB: 2gjn_A* Back     alignment and structure
>3stp_A Galactonate dehydratase, putative; PSI biology, structural genomics, NEW YORK structural genomi research consortium; 1.88A {Labrenzia aggregata iam 12614} PDB: 3sqs_A 3ssz_A Back     alignment and structure
>2hxt_A L-fuconate dehydratase; enolase superfamily, D-erythromohydr unknown function; HET: EHM; 1.70A {Xanthomonas campestris PV} PDB: 1yey_A 2hxu_A* 2hne_A Back     alignment and structure
>3i65_A Dihydroorotate dehydrogenase homolog, mitochondrial; triazolopyrimidine,inhibitor, DSM1, FAD, flavoprotein, membrane, mitochondrion; HET: JZ8 FMN ORO LDA; 2.00A {Plasmodium falciparum 3D7} PDB: 3i68_A* 3i6r_A* 3o8a_A* 3sfk_A* Back     alignment and structure
>2e6f_A Dihydroorotate dehydrogenase; chagas disease, pyrimidine biosynthesis, fumarate reductase, energy metabolism, redox homeostasis, flavoprotein; HET: FMN OXC; 1.26A {Trypanosoma cruzi} PDB: 2e6a_A* 2e6d_A* 2e68_A* 2djl_A* 2djx_A* 3c3n_A* 2b4g_A* 3c61_A* 3mhu_A* 3mjy_A* Back     alignment and structure
>4e4u_A Mandalate racemase/muconate lactonizing enzyme; mandelate racemase, aldolase, structural genomics, biology; 1.35A {Unidentified} Back     alignment and structure
>2nql_A AGR_PAT_674P, isomerase/lactonizing enzyme; enolase, structural genomics, protein structure initiative, nysgxrc; 1.80A {Agrobacterium tumefaciens str} PDB: 4dn1_A Back     alignment and structure
>3gr7_A NADPH dehydrogenase; flavin, FMN, beta-alpha-barrel, oxidoreductase, flavoprotein; HET: FMN; 2.30A {Geobacillus kaustophilus} PDB: 3gr8_A* Back     alignment and structure
>3vkj_A Isopentenyl-diphosphate delta-isomerase; type 2 isopentenyl diphosphate isomerase; HET: FNR; 1.70A {Sulfolobus shibatae} PDB: 2zrv_A* 2zrw_A* 2zrx_A* 2zry_A* 2zrz_A* 3b03_A* 3b04_A* 3b05_A* 3b06_A* 2zru_A* Back     alignment and structure
>3tml_A 2-dehydro-3-deoxyphosphooctonate aldolase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.90A {Burkholderia cenocepacia} PDB: 3t4c_A Back     alignment and structure
>3igs_A N-acetylmannosamine-6-phosphate 2-epimerase 2; energy metabolism, sugars, csgid, carbohydrate metabolism, isomerase; HET: MSE 16G; 1.50A {Salmonella enterica subsp} SCOP: c.1.2.0 Back     alignment and structure
>3ajx_A 3-hexulose-6-phosphate synthase; HPS, OMPDC suprafamily, LYA; 1.60A {Mycobacterium gastri} Back     alignment and structure
>3r2g_A Inosine 5'-monophosphate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.94A {Legionella pneumophila subsp} Back     alignment and structure
>3q58_A N-acetylmannosamine-6-phosphate 2-epimerase; TIM beta/alpha barrel, ribulose-phosphate binding barrel, carbohydrate metabolic process; HET: BTB; 1.80A {Salmonella enterica subsp} Back     alignment and structure
>3jva_A Dipeptide epimerase; enolase superfamily, isomerase; 1.70A {Enterococcus faecalis V583} PDB: 3jw7_A* 3jzu_A* 3k1g_A* 3kum_A* Back     alignment and structure
>3txv_A Probable tagatose 6-phosphate kinase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>1f76_A Dihydroorotate dehydrogenase; monomer, alpha-beta-barrel, FMN binding domain, orotate complex, oxidoreductase; HET: MSE FMN ORO; 2.50A {Bacteria} SCOP: c.1.4.1 Back     alignment and structure
>1y0e_A Putative N-acetylmannosamine-6-phosphate 2-epimer; mannac-6-P epimerase, NANE, structural genomics, protein STR initiative, PSI; 1.95A {Staphylococcus aureus subsp} SCOP: c.1.2.5 Back     alignment and structure
>2gdq_A YITF; mandelate racemase/muconate lactonizing enzyme, TIM-barrel, octamer, structural genomics, PSI; 1.80A {Bacillus subtilis subsp} SCOP: c.1.11.2 d.54.1.1 PDB: 2gge_A Back     alignment and structure
>4dwd_A Mandelate racemase/muconate lactonizing enzyme, C domain protein; structural genomics, EFI, enzyme function initiative, metal protein; HET: MSE; 1.50A {Paracoccus denitrificans} PDB: 3n4e_A* Back     alignment and structure
>2qkf_A 3-deoxy-D-manno-octulosonic acid 8- phosphate SYN; manno-octulosonate, synthase, lipopolysaccharide, KDOP, KDO8 KDO8PS; 1.75A {Neisseria meningitidis serogroup B} PDB: 3stf_A 3qpy_A 3ste_A 3qpz_A 3qq0_A 3fyo_A* 3qq1_A 3fyp_A* 3stc_A 3stg_A 1phw_A 1g7v_A* 1gg0_A 1phq_A* 1d9e_A 1pl9_A* 1q3n_A* 1x6u_A* 1x8f_A 1g7u_A* Back     alignment and structure
>3l5a_A NADH/flavin oxidoreductase/NADH oxidase; OLD yellow enzyme family, OYE-like FMN-binding domain, TIM B oxidoreductase; HET: PGE; 1.65A {Staphylococcus aureus} Back     alignment and structure
>1tzz_A Hypothetical protein L1841; structural genomics, mandelate racemase like fold, nysgxrc target T1523, PSI, protein structure initiative; 1.86A {Bradyrhizobium japonicum} SCOP: c.1.11.2 d.54.1.1 PDB: 2dw7_A* 2dw6_A* Back     alignment and structure
>1wv2_A Thiazole moeity, thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI; 2.90A {Pseudomonas aeruginosa} SCOP: c.1.31.1 Back     alignment and structure
>1o60_A 2-dehydro-3-deoxyphosphooctonate aldolase; structural genomics, transferase; 1.80A {Haemophilus influenzae} SCOP: c.1.10.4 PDB: 3e9a_A Back     alignment and structure
>3aty_A Tcoye, prostaglandin F2A synthase; alpha/beta barrel, oxidoreductase, flavin mononucleotide; HET: FMN; 1.70A {Trypanosoma cruzi} PDB: 3atz_A* Back     alignment and structure
>3toy_A Mandelate racemase/muconate lactonizing enzyme FA protein; enolase, magnesium binding site, lyase; HET: P4C; 1.80A {Bradyrhizobium SP} PDB: 3tte_A* Back     alignment and structure
>2qq6_A Mandelate racemase/muconate lactonizing enzyme- like protein; enolase, Mg ION, PSI-2, NYSGXRC, structural genomics; 2.90A {Rubrobacter xylanophilus dsm 9941} Back     alignment and structure
>3pm6_A Putative fructose-bisphosphate aldolase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.20A {Coccidioides immitis} Back     alignment and structure
>4ab4_A Xenobiotic reductase B; oxidoreductase, OLD yellow enzyme; HET: FMN TNL EDO; 1.50A {Pseudomonas putida KT2440} Back     alignment and structure
>2htm_A Thiazole biosynthesis protein THIG; thiamin biosynthesis, THIG, thermus thermophilus HB8, structural genomics, NPPSFA; 2.30A {Thermus thermophilus} Back     alignment and structure
>3sgz_A Hydroxyacid oxidase 2; flavoprotein, homology, INH oxidoreductase-oxidoreductase inhibitor complex; HET: FMN HO6; 1.35A {Rattus norvegicus} PDB: 1tb3_A* Back     alignment and structure
>2poz_A Putative dehydratase; octamer, structural genomics, P protein structure initiative, NEW YORK SGX research center structural genomics, nysgxrc; 2.04A {Mesorhizobium loti} Back     alignment and structure
>2hsa_B 12-oxophytodienoate reductase 3; alpha beta 8 barrel, flavoprotein, jasmonate biosynthesis, oxidoreductase; HET: FMN; 1.50A {Solanum lycopersicum} PDB: 2hs6_A* 3hgs_A* 2hs8_A* 3hgo_A* 1q45_A* 2g5w_A* 2q3o_A* Back     alignment and structure
>3qw3_A Orotidine-5-phosphate decarboxylase/orotate phosphoribosyltransferase, putative (OMPDCASE-OPRTASE,...; orotidine monophosphate decarboxylase; 1.70A {Leishmania infantum} Back     alignment and structure
>1ydn_A Hydroxymethylglutaryl-COA lyase; TIM-barrel protein, structural genomics, PSI, protein struct initiative; 2.30A {Brucella melitensis} Back     alignment and structure
>1pv8_A Delta-aminolevulinic acid dehydratase; porphobilinogen synthase, tetrapyrrole biosynthesis, reactio intermediate, lyase; HET: PB1; 2.20A {Homo sapiens} SCOP: c.1.10.3 PDB: 1e51_A* 2z0i_A 2z1b_A Back     alignment and structure
>2o56_A Putative mandelate racemase; dehydratase, structural genomics, protein structure initiati 2; 2.00A {Salmonella typhimurium} Back     alignment and structure
>1yad_A Regulatory protein TENI; TIM barrel, transcription; 2.10A {Bacillus subtilis} PDB: 3qh2_A* Back     alignment and structure
>3iwp_A Copper homeostasis protein CUTC homolog; conserved sequence motif, metal-binding site, polymorphism, metal binding protein; 2.50A {Homo sapiens} Back     alignment and structure
>2ox4_A Putative mandelate racemase; enolase, dehydratase, structural genomics, protein structure initiative, PSI, nysgrc; 1.80A {Zymomonas mobilis} Back     alignment and structure
>3gka_A N-ethylmaleimide reductase; decode biostructures, ssgcid, niaid, targetdb bupsa00093A, structural genomics; HET: FMN; 2.30A {Burkholderia pseudomallei} SCOP: c.1.4.0 Back     alignment and structure
>3ik4_A Mandelate racemase/muconate lactonizing protein; structural genomics, enolase, epimerase, PSI-2, protein STRU initiative; 2.10A {Herpetosiphon aurantiacus atcc 23779} Back     alignment and structure
>3rcy_A Mandelate racemase/muconate lactonizing enzyme-LI protein; structural genomics, protein structure initiative; HET: RIB; 1.99A {Roseovarius SP} PDB: 3t4w_A Back     alignment and structure
>1w8s_A FBP aldolase, fructose-bisphosphate aldolase class I; TIM barrel, glycolytic, archaeal, catalytic mechanism, reaction intermediate, lyase; HET: FBP; 1.85A {Thermoproteus tenax} SCOP: c.1.10.1 PDB: 1w8r_A* 2yce_A* 1ojx_A 1ok4_A 1ok6_A Back     alignment and structure
>2h6r_A Triosephosphate isomerase; beta-alpha barrel; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>1mzh_A Deoxyribose-phosphate aldolase; alpha-beta barrel, structural genomics, PSI, protein structure initiative; 2.00A {Aquifex aeolicus} SCOP: c.1.10.1 Back     alignment and structure
>3rr1_A GALD, putative D-galactonate dehydratase; enolase, magnesium binding site, lyase; 1.95A {Ralstonia pickettii} PDB: 3rra_A Back     alignment and structure
>3ffs_A Inosine-5-monophosphate dehydrogenase; beta-alpha barrel, TIM fold, oxidoreductase; 3.19A {Cryptosporidium parvum} Back     alignment and structure
>3hgj_A Chromate reductase; TIM barrel, oxidoreductase; HET: FMN; 2.00A {Thermus scotoductus} SCOP: c.1.4.0 PDB: 3hf3_A* Back     alignment and structure
>4dbe_A Orotidine 5'-phosphate decarboxylase; TIM barrel, orotidine 5'-monophosphate decarboxylase, inhibi lyase-lyase inhibitor complex; HET: BMP; 1.79A {Sulfolobus solfataricus} Back     alignment and structure
>2ftp_A Hydroxymethylglutaryl-COA lyase; structural genomics, PSI, protein structure initiativ midwest center for structural genomics, MCSG; 2.40A {Pseudomonas aeruginosa} Back     alignment and structure
>2hzg_A Mandelate racemase/muconate lactonizing enzyme/EN superfamily; structural genomics, predicted mandelate racemase, PSI; 2.02A {Rhodobacter sphaeroides} Back     alignment and structure
>1wa3_A 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, pyruvate, lyase; 1.9A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 1vlw_A Back     alignment and structure
>2gl5_A Putative dehydratase protein; structural genomics, protein structure initiati nysgxrc; 1.60A {Salmonella typhimurium} SCOP: c.1.11.2 d.54.1.1 PDB: 4e6m_A* Back     alignment and structure
>3mqt_A Mandelate racemase/muconate lactonizing protein; PSI-II, NYSGXRC, muconate lactonizing EN structural genomics, protein structure initiative; 2.10A {Shewanella pealeana} Back     alignment and structure
>4e8g_A Enolase, mandelate racemase/muconate lactonizing enzyme, N domain protein; putative racemase, nysgrc, structural genomics, PSI-biology; 2.00A {Paracoccus denitrificans} Back     alignment and structure
>3vzx_A Heptaprenylglyceryl phosphate synthase; biosynthesis, prenyltransferases, enzyme catalysis, transfer; 1.54A {Bacillus subtilis} PDB: 3vzy_A* 3vzz_A* 3w00_A* 1viz_A Back     alignment and structure
>4ef8_A Dihydroorotate dehydrogenase; phenyl isothiocyanate, PYRD, oxidoreductase, oxidoreductase-oxidor inhibitor complex; HET: FMN; 1.56A {Leishmania major} PDB: 3gye_A* 3gz3_A* 4ef9_A* 3tro_A* 3tjx_A* Back     alignment and structure
>3kru_A NADH:flavin oxidoreductase/NADH oxidase; homotetramer, dimer of dimers, TIM barrel, thermophilic, OLD enzyme; HET: FMN; 1.60A {Thermoanaerobacter pseudethanolicus AT} SCOP: c.1.4.0 PDB: 3krz_A* Back     alignment and structure
>3b0p_A TRNA-dihydrouridine synthase; TIM barrel, oxidoreductase; HET: FMN; 1.70A {Thermus thermophilus} PDB: 3b0u_X* 3b0v_C* Back     alignment and structure
>4fo4_A Inosine 5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.03A {Vibrio cholerae o1 biovar el tor} PDB: 4ff0_A* 4hlv_A* 4fez_A Back     alignment and structure
>1gox_A (S)-2-hydroxy-acid oxidase, peroxisomal; oxidoreductase (oxygen(A)); HET: FMN; 2.00A {Spinacia oleracea} SCOP: c.1.4.1 PDB: 1gyl_A* 1al8_A* 1al7_A* 2cdh_0 Back     alignment and structure
>4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>3khj_A Inosine-5-monophosphate dehydrogenase; enzyme-inhibitor complex, oxidoreductase; HET: IMP C64; 2.80A {Cryptosporidium parvum} Back     alignment and structure
>3tj4_A Mandelate racemase; enolase, dehydratase, enzyme function initiative, EFI, lyase; 1.50A {Agrobacterium tumefaciens} PDB: 4h19_A* Back     alignment and structure
>4h2h_A Mandelate racemase/muconate lactonizing enzyme; enolase, mandelate racemase subgroup, enzyme function initia EFI, structural genomics; HET: 0XW; 1.70A {Pelagibaca bermudensis} PDB: 2pmq_A* Back     alignment and structure
>1vhn_A Putative flavin oxidoreducatase; structural genomics, unknown function; HET: FMN; 1.59A {Thermotoga maritima} SCOP: c.1.4.1 Back     alignment and structure
>2nli_A Lactate oxidase; flavoenzyme, FMN, D-lactate, oxidoreducta; HET: FMN; 1.59A {Aerococcus viridans} PDB: 2zfa_A* 2du2_A* 2e77_A* 2j6x_A* Back     alignment and structure
>3bw2_A 2-nitropropane dioxygenase; TIM barrel, oxidoreductase; HET: FMN; 2.10A {Streptomyces ansochromogenes} PDB: 3bw4_A* 3bw3_A* Back     alignment and structure
>3i4k_A Muconate lactonizing enzyme; structural genomics, NYSGXRC, target 9450D, isomerase, PSI-2, protein structure initiative; 2.20A {Corynebacterium glutamicum} Back     alignment and structure
>3n9r_A Fructose-bisphosphate aldolase; FBP aldolase, class II, inhibitor, lyase; HET: TD3; 1.80A {Helicobacter pylori} SCOP: c.1.10.0 PDB: 3c52_A* 3c56_A* 3c4u_A* 3n9s_A* Back     alignment and structure
>1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* Back     alignment and structure
>1h1y_A D-ribulose-5-phosphate 3-epimerase; oxidative pentose phosphate pathway, isomerase; 1.87A {Oryza sativa} SCOP: c.1.2.2 PDB: 1h1z_A Back     alignment and structure
>3go2_A Putative L-alanine-DL-glutamate epimerase; structural genomics, isomerase, PSI-2; 1.70A {Burkholderia xenovorans} PDB: 2oo6_A 3sn0_A 3sn1_A* 3sn4_A* Back     alignment and structure
>3sgz_A Hydroxyacid oxidase 2; flavoprotein, homology, INH oxidoreductase-oxidoreductase inhibitor complex; HET: FMN HO6; 1.35A {Rattus norvegicus} PDB: 1tb3_A* Back     alignment and structure
>3oix_A Putative dihydroorotate dehydrogenase; dihydrooro oxidase; TIM barrel, oxidoreductase; HET: MLY FMN; 2.40A {Streptococcus mutans} Back     alignment and structure
>1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 Back     alignment and structure
>3ugv_A Enolase; enzyme function initiative, EFI, lyase; 2.30A {Alpha proteobacterium BAL199} Back     alignment and structure
>4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} Back     alignment and structure
>1ypf_A GMP reductase; GUAC, purines, pyrimidines, nucleosides, nucleotides, nucleo nucleoside interconversions, spine, structural genomics; 1.80A {Bacillus anthracis} PDB: 2a1y_A* Back     alignment and structure
>1vc4_A Indole-3-glycerol phosphate synthase; lyase, tryptophan biosynthesis, riken structural genomics/PR initiative, RSGI, structural genomics; 1.80A {Thermus thermophilus} SCOP: c.1.2.4 Back     alignment and structure
>1twd_A Copper homeostasis protein CUTC; TIM-like protein, structural genomics, PSI, protein structure initiative; 1.70A {Shigella flexneri} SCOP: c.1.30.1 PDB: 1x7i_A 1x8c_A Back     alignment and structure
>3zwt_A Dihydroorotate dehydrogenase (quinone), mitochond; oxidoreductase; HET: FMN ORO KFZ; 1.55A {Homo sapiens} PDB: 1d3h_A* 2bxv_A* 2prh_A* 2prl_A* 2prm_A* 3f1q_A* 3fj6_A* 3fjl_A* 3g0u_A* 3g0x_A* 3zws_A* 1d3g_A* 3u2o_A* 2fpv_A* 2fpt_A* 2fpy_A* 2fqi_A* 3kvl_A* 3kvk_A* 3kvj_A* ... Back     alignment and structure
>3fv9_G Mandelate racemase/muconate lactonizing enzyme; structural genomics, mandelate racemase/muconatelactonizing hydrolase, PSI-2; 1.90A {Roseovarius nubinhibens ism} PDB: 2pce_A Back     alignment and structure
>2c6q_A GMP reductase 2; TIM barrel, metal-binding, NADP, oxidoreductase, potassium; HET: IMP NDP; 1.70A {Homo sapiens} PDB: 2bzn_A* 2a7r_A* 2ble_A* 2bwg_A* Back     alignment and structure
>2bdq_A Copper homeostasis protein CUTC; alpha beta protein, structural genomics, PSI, protein structure initiative; 2.30A {Streptococcus agalactiae} Back     alignment and structure
>1eep_A Inosine 5'-monophosphate dehydrogenase; alpha-beta barrel, TIM barrel, IMPDH, IMP dehydrogenase, LOO purine biosynthesis, oxidoreductase; 2.40A {Borrelia burgdorferi} SCOP: c.1.5.1 Back     alignment and structure
>1rd5_A Tryptophan synthase alpha chain, chloroplast; hydroxamic acid, diboa, dimboa, indole, indole-glycerol-PHOS lyase; 2.02A {Zea mays} SCOP: c.1.2.4 PDB: 1tjr_A Back     alignment and structure
>3vc5_A Mandelate racemase/muconate lactonizing protein; dehydratase, magnesium binding, enzyme function initiative, enolase, isomerase; 1.50A {Thermobispora bispora} PDB: 3vc6_A 4dhg_A Back     alignment and structure
>3ffs_A Inosine-5-monophosphate dehydrogenase; beta-alpha barrel, TIM fold, oxidoreductase; 3.19A {Cryptosporidium parvum} Back     alignment and structure
>3mkc_A Racemase; metabolic process, PSI2, NYSGXRC, structu genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; 1.77A {Pseudovibrio SP} PDB: 3nzg_A Back     alignment and structure
>3ddm_A Putative mandelate racemase/muconate lactonizing enzyme; structural genomics, NYSGXRC, target 9284B, enolase family, PSI-2; 2.60A {Bordetella bronchiseptica} Back     alignment and structure
>3q45_A Mandelate racemase/muconate lactonizing enzyme FA possible chloromuconate cycloisomerase...; (beta/alpha)8-barrel; 3.00A {Cytophaga hutchinsonii} PDB: 3q4d_A Back     alignment and structure
>1lt8_A Betaine-homocysteine methyltransferase; homocysteine metabolism, homocysteinemia, zinc, thiol alkyl transfer; HET: CBH CIT; 2.05A {Homo sapiens} SCOP: c.1.26.1 PDB: 1lt7_A* 1umy_A Back     alignment and structure
>1eix_A Orotidine 5'-monophosphate decarboxylase; alpha-beta-barrel, protein-inhibitor complex, homodimer, lyase; HET: BMQ; 2.50A {Escherichia coli} SCOP: c.1.2.3 PDB: 1jjk_A* 1l2u_A Back     alignment and structure
>3tr2_A Orotidine 5'-phosphate decarboxylase; purines, pyrimidines, nucleosides, nucleotides, lyase; 2.00A {Coxiella burnetii} Back     alignment and structure
>2ze3_A DFA0005; organic waste LEFT-OVER decomposition, alkaliphilic, ICL/PEPM superfamily, alpha-ketoglutarate LIG isomerase; HET: AKG; 1.65A {Deinococcus ficus} Back     alignment and structure
>1oy0_A Ketopantoate hydroxymethyltransferase; domain swapping, structural genomics, PSI, protein structure initiative; 2.80A {Mycobacterium tuberculosis} SCOP: c.1.12.8 Back     alignment and structure
>2cw6_A Hydroxymethylglutaryl-COA lyase, mitochondrial; HMG-COA lyase, ketogenic enzyme; HET: 3HG; 2.10A {Homo sapiens} PDB: 3mp3_A* 3mp4_A 3mp5_A* Back     alignment and structure
>1dbt_A Orotidine 5'-phosphate decarboxylase; UMP, TIM barrel, lyase; HET: U5P; 2.40A {Bacillus subtilis} SCOP: c.1.2.3 Back     alignment and structure
>3t6c_A RSPA, putative MAND family dehydratase; enolase, mannonate dehydratase related protein, enzyme funct intitiative, lyase, hydro-lyases; HET: GCO; 1.60A {Pantoea ananatis} PDB: 3tw9_A 3twa_A 3twb_A* Back     alignment and structure
>3ro6_B Putative chloromuconate cycloisomerase; TIM barrel; 2.20A {Methylococcus capsulatus} PDB: 3rit_A Back     alignment and structure
>3dg3_A Muconate cycloisomerase; muconate lactonizing enzyme, muconolactone binding; 1.60A {Mycobacterium smegmatis} PDB: 3dg6_A* 3dg7_A* Back     alignment and structure
>1vhn_A Putative flavin oxidoreducatase; structural genomics, unknown function; HET: FMN; 1.59A {Thermotoga maritima} SCOP: c.1.4.1 Back     alignment and structure
>3jr2_A Hexulose-6-phosphate synthase SGBH; 3-keto-L-gulonate-6-phosphate decarboxylase, ULAD, niaid,CSG bound, biosynthetic protein; HET: MSE; 1.80A {Vibrio cholerae} SCOP: c.1.2.0 PDB: 3ieb_A* Back     alignment and structure
>1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* Back     alignment and structure
>3s5s_A Mandelate racemase/muconate lactonizing enzyme FA protein; PSI-biology, structural genomics, NEW YORK structural genomi research consortium; 2.40A {Sorangium cellulosum} Back     alignment and structure
>3ldv_A Orotidine 5'-phosphate decarboxylase; structural genomics, infectious diseases; 1.77A {Vibrio cholerae o1 biovar el tor} PDB: 3uwq_A* Back     alignment and structure
>1vhc_A Putative KHG/KDPG aldolase; structural genomics, unknown function; HET: MSE; 1.89A {Haemophilus influenzae} SCOP: c.1.10.1 Back     alignment and structure
>3qw4_B UMP synthase; N-terminal orotidine monophosphate decarboxylase domain C-TE orotate phosphoribosyltransferase domain, transferase, LYAS; HET: U5P; 3.00A {Leishmania donovani} Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>4hnl_A Mandelate racemase/muconate lactonizing enzyme; dehydratase, magnesium binding, enzyme function initiative,; 1.48A {Enterococcus gallinarum EG2} PDB: 3s47_A Back     alignment and structure
>2agk_A 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide...; TIM alpha/beta barrel; HET: CIT; 1.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3r4e_A Mandelate racemase/muconate lactonizing enzyme; enolase fold, mannonate dehydratase, D-mannonate, lyase; HET: CS2; 1.65A {Novosphingobium aromaticivorans} PDB: 2qjj_A 2qjn_A* 2qjm_A* Back     alignment and structure
>3vcn_A Mannonate dehydratase; enolase, magnesium binding site, enzyme function initiative, lyase; 1.45A {Caulobacter crescentus} PDB: 4gme_A* 4fi4_A 3thu_A Back     alignment and structure
>1tv5_A Dhodehase, dihydroorotate dehydrogenase homolog, mitochondri, dihydroorotate; alpha-beta barrel, TIM barrel, oxidoreductase; HET: A26 FMN ORO N8E; 2.40A {Plasmodium falciparum} SCOP: c.1.4.1 Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>2nzl_A Hydroxyacid oxidase 1; HAOX1, glycolate oxidase, GOX, GOX1, structural genomics, structural genom consortium, SGC, oxidoreductase; HET: FMN; 1.35A {Homo sapiens} PDB: 2rdu_A* 2rdt_A* 2rdw_A* 2w0u_A* Back     alignment and structure
>3l5l_A Xenobiotic reductase A; TIM barrel, oxidoreductase; HET: BU3 FMN; 1.03A {Pseudomonas putida} SCOP: c.1.4.0 PDB: 3l5m_A* 3n19_B* 3n16_A* 3l68_A* 3l67_A* 3l65_A* 3l66_A* 3n14_A* 2h8z_A* 2h90_A* 2h8x_A* Back     alignment and structure
>2nx9_A Oxaloacetate decarboxylase 2, subunit alpha; carboxyltransferase structure, B enzymes, Zn2+ binding site, TIM-barrel fold, lyase; 1.70A {Vibrio cholerae} Back     alignment and structure
>3oa3_A Aldolase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, pathogenic fungus; 1.60A {Coccidioides immitis} Back     alignment and structure
>3p3b_A Mandelate racemase/muconate lactonizing protein; enolase superfamily fold, galacturonate dehydratase, D-tartr galacturonate, lyase; HET: TAR; 1.65A {Geobacillus SP} PDB: 3ops_A* 3n4f_A* 3qpe_A* Back     alignment and structure
>4a35_A Mitochondrial enolase superfamily member 1; isomerase; 1.74A {Homo sapiens} Back     alignment and structure
>3glc_A Aldolase LSRF; TIM barrel, lyase, schiff base; HET: R5P; 2.50A {Escherichia coli} PDB: 3gnd_A* 3gkf_O Back     alignment and structure
>3vdg_A Probable glucarate dehydratase; enolase, magnesium binding site, lyase; 1.90A {Mycobacterium smegmatis str} PDB: 3vfc_A* Back     alignment and structure
>3v3w_A Starvation sensing protein RSPA; enolase, enzyme function initiative, EFI, lyase; HET: NHE; 1.40A {Cellvibrio japonicus} PDB: 3v4b_A* 4f4r_A 3qkf_A* 3qke_A* 3p93_A* 3ow1_A 3pk7_A* 3rgt_A* 3bsm_A Back     alignment and structure
>2isw_A Putative fructose-1,6-bisphosphate aldolase; class II fructose-1,6-bisphosphate aldolase, glycolytic pathway, giardia lamblia, drug target; HET: PGH; 1.75A {Giardia intestinalis} PDB: 2isv_A* 3ohi_A* 3gay_A* 3gak_A* 3gb6_A* Back     alignment and structure
>3iv3_A Tagatose 1,6-diphosphate aldolase 2; TIM barrel, phosphate binding, tagatose-bisphosphate aldolas tagatose-1,6-bisphosphate aldolase; HET: MSE; 1.80A {Streptococcus mutans} PDB: 3mhf_A 3mhg_A 3jrk_A 3kao_A* 3myp_A 3myo_A Back     alignment and structure
>1l6s_A Porphobilinogen synthase; dehydratase, lyase; HET: CME DSB; 1.70A {Escherichia coli} SCOP: c.1.10.3 PDB: 1i8j_A* 1l6y_A* 1b4e_A Back     alignment and structure
>3my9_A Muconate cycloisomerase; structural genomics, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics, nysgx; 2.20A {Azorhizobium caulinodans} Back     alignment and structure
>3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* Back     alignment and structure
>1tqj_A Ribulose-phosphate 3-epimerase; beta-alpha barrel epimerase, isomerase; 1.60A {Synechocystis SP} SCOP: c.1.2.2 Back     alignment and structure
>1ub3_A Aldolase protein; schiff base, deoxyribose phosphate, carbinolamine, structural genomics, riken structural genomics/proteomics initiative; HET: HPD; 1.40A {Thermus thermophilus} SCOP: c.1.10.1 PDB: 1j2w_A* Back     alignment and structure
>1ydo_A HMG-COA lyase; TIM-barrel protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG,; 2.71A {Bacillus subtilis subsp} Back     alignment and structure
>3va8_A Probable dehydratase; enolase, magnesium binding site, lyase; 2.00A {Gibberella zeae} Back     alignment and structure
>4h1z_A Enolase Q92ZS5; dehydratase, magnesium binding site, enzyme function initiat isomerase; 2.01A {Sinorhizobium meliloti} PDB: 2ppg_A Back     alignment and structure
>1xm3_A Thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI, NESG, northeast structural genomics consortium; 1.80A {Bacillus subtilis} SCOP: c.1.31.1 PDB: 1tyg_A Back     alignment and structure
>3ble_A Citramalate synthase from leptospira interrogans; TIM barrel, licmsn, substrate specificity, acyltransferase, amino-acid biosynthesis; 2.00A {Leptospira interrogans} PDB: 3blf_A 3bli_A* Back     alignment and structure
>3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* Back     alignment and structure
>2yw3_A 4-hydroxy-2-oxoglutarate aldolase/2-deydro-3- deoxyphosphogluconate aldolase; structural genomics, NPPSFA; 1.67A {Thermus thermophilus} PDB: 2yw4_A Back     alignment and structure
>1vqt_A Orotidine 5'-phosphate decarboxylase; TM0332, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.00A {Thermotoga maritima} SCOP: c.1.2.3 Back     alignment and structure
>1rqb_A Transcarboxylase 5S subunit; TIM-barrel, carbamylated lysine, transfera; HET: KCX; 1.90A {Propionibacterium freudenreichii subspshermanii} SCOP: a.5.7.2 c.1.10.5 PDB: 1rqe_A 1rqh_A* 1rr2_A* 1u5j_A* 1s3h_A* Back     alignment and structure
>2pge_A MENC; OSBS, NYSGXRC, PSI-II, structural genomics, protein structure initiative; 1.60A {Desulfotalea psychrophila LSV54} Back     alignment and structure
>1rpx_A Protein (ribulose-phosphate 3-epimerase); chloroplast, calvin cycle, oxidative pentose PH pathway; 2.30A {Solanum tuberosum} SCOP: c.1.2.2 Back     alignment and structure
>2gou_A Oxidoreductase, FMN-binding; OLD yeallow enzyme, flavoenzyme; HET: BOG FMN PE4; 1.40A {Shewanella oneidensis} PDB: 2gq8_A* 2gq9_A* 2gqa_A* Back     alignment and structure
>2ozt_A TLR1174 protein; structural genomics, O-succinylbenzoate synthase, PSI, protein structure initiative; 1.42A {Synechococcus elongatus} PDB: 3h7v_A Back     alignment and structure
>1n7k_A Deoxyribose-phosphate aldolase; A.pernix, tetramer, alpha-beta TIM barrel, riken S genomics/proteomics initiative, RSGI, structural genomics,; 2.00A {Aeropyrum pernix} SCOP: c.1.10.1 Back     alignment and structure
>3ceu_A Thiamine phosphate pyrophosphorylase; TIM barrel-like protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>2nzl_A Hydroxyacid oxidase 1; HAOX1, glycolate oxidase, GOX, GOX1, structural genomics, structural genom consortium, SGC, oxidoreductase; HET: FMN; 1.35A {Homo sapiens} PDB: 2rdu_A* 2rdt_A* 2rdw_A* 2w0u_A* Back     alignment and structure
>3rmj_A 2-isopropylmalate synthase; LEUA, truncation, neisseria MENI TIM barrel, catalytic domain, dimer, leucine biosynthesis, ketoisovalerate; 1.95A {Neisseria meningitidis} Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>2v82_A 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; lyase, kdpgal; HET: KDP; 2.1A {Escherichia coli} PDB: 2v81_A* Back     alignment and structure
>3noy_A 4-hydroxy-3-methylbut-2-EN-1-YL diphosphate synth; iron-sulfur protein, non-mevalonate pathway, terpene biosynt isoprenoid biosynthesis; 2.70A {Aquifex aeolicus} Back     alignment and structure
>3fcp_A L-Ala-D/L-Glu epimerase, A muconate lactonizing enzyme; structural genomics, nysgrc,target 9450E, PSI-2; 1.80A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1nvm_A HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: a.5.7.1 c.1.10.5 Back     alignment and structure
>1q6o_A Humps, 3-keto-L-gulonate 6-phosphate decarboxylase, D-; beta barrel, lyase; HET: LG6; 1.20A {Escherichia coli} SCOP: c.1.2.3 PDB: 1kw1_A* 1q6l_A* 1kv8_A* 1q6q_A* 1q6r_A* 1xbv_A* 1so5_A* 1so4_A* 1xby_A* 1so3_A* 1so6_A* 1xbz_A* 1xbx_A* Back     alignment and structure
>1yad_A Regulatory protein TENI; TIM barrel, transcription; 2.10A {Bacillus subtilis} PDB: 3qh2_A* Back     alignment and structure
>2htm_A Thiazole biosynthesis protein THIG; thiamin biosynthesis, THIG, thermus thermophilus HB8, structural genomics, NPPSFA; 2.30A {Thermus thermophilus} Back     alignment and structure
>1w1z_A Delta-aminolevulinic acid dehydratase; synthase, tetrapyrrole biosynthesis, ALAD, porphyrin biosynt heme biosynthesis, lyase; 2.6A {Prosthecochloris vibrioformis} SCOP: c.1.10.3 PDB: 2c1h_A* Back     alignment and structure
>3tji_A Mandelate racemase/muconate lactonizing enzyme, N domain protein; enolase, dehydratase, enzyme function initiative, EFI, lyase; 1.80A {Enterobacter SP} Back     alignment and structure
>1kbi_A Cytochrome B2, L-LCR; flavocytochrome B2, electron transfer, oxidoreductase; HET: HEM FMN; 2.30A {Saccharomyces cerevisiae} SCOP: c.1.4.1 d.120.1.1 PDB: 1fcb_A* 1lco_A* 1ldc_A* 1sze_A* 2oz0_A* 1szf_A* 1szg_A* 1ltd_A* 1kbj_A* 1qcw_A* 3ks0_A* Back     alignment and structure
>3nl6_A Thiamine biosynthetic bifunctional enzyme; thiamin biosynthesis, eukaryoyes, transferase; HET: TPS ACP; 2.61A {Candida glabrata} PDB: 3nl2_A* 3nl5_A* 3nl3_A* 3nm3_A* 3nm1_A* Back     alignment and structure
>1sjd_A N-acylamino acid racemase; lyase, isomerase; HET: NPG; 1.87A {Amycolatopsis SP} SCOP: c.1.11.2 d.54.1.1 PDB: 1sja_A* 1sjb_A* 1sjc_A* Back     alignment and structure
>2gjl_A Hypothetical protein PA1024; 2-nitropropane dioxygenase, 2-nitropropane, FMN, oxidoreduct; HET: FMN; 2.00A {Pseudomonas aeruginosa PAO1} PDB: 2gjn_A* Back     alignment and structure
>4ab4_A Xenobiotic reductase B; oxidoreductase, OLD yellow enzyme; HET: FMN TNL EDO; 1.50A {Pseudomonas putida KT2440} Back     alignment and structure
>3r12_A Deoxyribose-phosphate aldolase; TIM beta/alpha-barrel, structural genomics, joint center for structural genomics, JCSG; HET: MSE CIT; 1.75A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 1o0y_A* 3r13_A* Back     alignment and structure
>3elf_A Fructose-bisphosphate aldolase; zinc enzyme, dihydroxyacetone, glyceraldehyd phosphate, aldol condensation, glycolysis, lyase; HET: 2FP; 1.31A {Mycobacterium tuberculosis} PDB: 3ekz_A* 3ekl_A* 4a22_A* 4a21_A* Back     alignment and structure
>1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* Back     alignment and structure
>1vyr_A Pentaerythritol tetranitrate reductase; oxidoreductase, flavoenzyme, explosive degradation, steroid binding; HET: FMN TNF; 0.9A {Enterobacter cloacae} SCOP: c.1.4.1 PDB: 1gvq_A* 1gvr_A* 1gvs_A* 1h50_A* 1h51_A* 1h60_A* 1h61_A* 1h62_A* 1h63_A* 1gvo_A* 2aba_A* 3f03_K* 3kft_A* 3p7y_A* 3p80_A* 3p81_A* 3p62_A* 3p8i_A* 2abb_A* 3p67_A* ... Back     alignment and structure
>1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 Back     alignment and structure
>1o5k_A DHDPS, dihydrodipicolinate synthase; TM1521, structural genomics, J protein structure initiative, joint center for structural G lyase; HET: MCL; 1.80A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 3pb2_A 3pb0_A Back     alignment and structure
>1p4c_A L(+)-mandelate dehydrogenase; TIM barrel, hydroxy acid oxidizing enzyme, oxidoreductase; HET: FMN MES; 1.35A {Pseudomonas putida} SCOP: c.1.4.1 PDB: 1huv_A* 1p5b_A* 3giy_A* 2a7p_A* 2a85_A* 2a7n_A* Back     alignment and structure
>4af0_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase, GTP biosynthesis, drug resistance; HET: MOA IMP; 2.20A {Cryptococcus neoformans} PDB: 4af0_B* Back     alignment and structure
>3l0g_A Nicotinate-nucleotide pyrophosphorylase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography; 2.05A {Ehrlichia chaffeensis} Back     alignment and structure
>1mzh_A Deoxyribose-phosphate aldolase; alpha-beta barrel, structural genomics, PSI, protein structure initiative; 2.00A {Aquifex aeolicus} SCOP: c.1.10.1 Back     alignment and structure
>3u9i_A Mandelate racemase/muconate lactonizing enzyme, C domain protein; structural genomics, PSI-biology; 2.90A {Roseiflexus SP} Back     alignment and structure
>2ztj_A Homocitrate synthase; (beta/alpha)8 TIM barrel, substrate complex, amino-acid BIOS lysine biosynthesis, transferase; HET: AKG; 1.80A {Thermus thermophilus} PDB: 2ztk_A* 2zyf_A* 3a9i_A* Back     alignment and structure
>3tqv_A Nicotinate-nucleotide pyrophosphorylase; glycosyltransferase, transferase; 2.62A {Francisella tularensis subsp} Back     alignment and structure
>4e38_A Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho aldolase; lyase; 1.64A {Vibrionales bacterium swat-3} Back     alignment and structure
>4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} Back     alignment and structure
>1w5q_A Delta-aminolevulinic acid dehydratase; synthase, evolution, metalloenzyme, porphobilinogen synthase, protein engineering,; 1.4A {Pseudomonas aeruginosa} PDB: 1w5p_A* 1w5o_A 1w5n_A 1w56_A 1w5m_A 1w54_A 1gzg_A* 1b4k_A 2woq_A* 2c14_A* 2c16_A* 2c19_A* 2c15_A* 2c18_A* 2c13_A* Back     alignment and structure
>3dip_A Enolase; structural genomics, isomerase, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics, NYSGXRC, lyase; HET: SIC; 2.50A {Unidentified} Back     alignment and structure
>1twd_A Copper homeostasis protein CUTC; TIM-like protein, structural genomics, PSI, protein structure initiative; 1.70A {Shigella flexneri} SCOP: c.1.30.1 PDB: 1x7i_A 1x8c_A Back     alignment and structure
>3bw2_A 2-nitropropane dioxygenase; TIM barrel, oxidoreductase; HET: FMN; 2.10A {Streptomyces ansochromogenes} PDB: 3bw4_A* 3bw3_A* Back     alignment and structure
>3o63_A Probable thiamine-phosphate pyrophosphorylase; thiamin biosynthesis, TIM barrel, transferase; 2.35A {Mycobacterium tuberculosis} Back     alignment and structure
>1p0k_A Isopentenyl-diphosphate delta-isomerase; terpene biosynthesis, dimethylallyl diphosphate, flavoprotein; 1.90A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1p0n_A* Back     alignment and structure
>2ekc_A AQ_1548, tryptophan synthase alpha chain; structural genomics, lyase, NPPSFA, national project on PROT structural and functional analyses; 2.00A {Aquifex aeolicus} Back     alignment and structure
>4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>2qr6_A IMP dehydrogenase/GMP reductase; NP_599840.1, G reductase domain, structural genomics, joint center for STR genomics, JCSG; HET: MSE; 1.50A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3gka_A N-ethylmaleimide reductase; decode biostructures, ssgcid, niaid, targetdb bupsa00093A, structural genomics; HET: FMN; 2.30A {Burkholderia pseudomallei} SCOP: c.1.4.0 Back     alignment and structure
>1n8f_A DAHP synthetase; (beta/alpha)8 barrel, metal binding protein; HET: PEP; 1.75A {Escherichia coli} SCOP: c.1.10.4 PDB: 1gg1_A 1kfl_A* 1qr7_A* Back     alignment and structure
>1vcf_A Isopentenyl-diphosphate delta-isomerase; TIM barrel, structural genomics, riken structural genomics/P initiative, RSGI; HET: FMN; 2.60A {Thermus thermophilus} SCOP: c.1.4.1 PDB: 1vcg_A* 3dh7_A* Back     alignment and structure
>1ep3_A Dihydroorotate dehydrogenase B (PYRD subunit); heterotetramer, alpha-beta barrel, beta sandwich, FAD domain alpha/beta NADP domain; HET: FMN FAD; 2.10A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ep2_A* 1ep1_A* Back     alignment and structure
>3dgb_A Muconate cycloisomerase; muconate lactonizing enzyme, muconolactone binding, isomeras structural genomics, PSI-2; HET: MUC; 1.70A {Pseudomonas fluorescens} PDB: 3ct2_A* 3fj4_A* 1muc_A 1bkh_A 3muc_A 2muc_A 1f9c_A Back     alignment and structure
>3n3m_A Orotidine 5'-phosphate decarboxylase; P. falciparum, 5'-monophosphate decarboxylase, 6- UMP, lyase; HET: PGE NUP; 1.47A {Plasmodium falciparum} SCOP: c.1.2.3 PDB: 2qaf_A* 3bar_A* 2q8z_A* 3mwa_A* 3n2m_A* 3bpw_A* 3n34_A* 3s9y_A* 2f84_A 2q8l_A 2za1_A* 2za2_A 2za3_A* 2zcg_A 3vi2_A* Back     alignment and structure
>3ngj_A Deoxyribose-phosphate aldolase; lyase, structural genomics, structural genomics center for infectious disease, ssgcid; 1.70A {Entamoeba histolytica} Back     alignment and structure
>3i65_A Dihydroorotate dehydrogenase homolog, mitochondrial; triazolopyrimidine,inhibitor, DSM1, FAD, flavoprotein, membrane, mitochondrion; HET: JZ8 FMN ORO LDA; 2.00A {Plasmodium falciparum 3D7} PDB: 3i68_A* 3i6r_A* 3o8a_A* 3sfk_A* Back     alignment and structure
>1eye_A DHPS 1, dihydropteroate synthase I; alpha-beta barrel, transferase; HET: PMM; 1.70A {Mycobacterium tuberculosis H37RV} SCOP: c.1.21.1 Back     alignment and structure
>1ydn_A Hydroxymethylglutaryl-COA lyase; TIM-barrel protein, structural genomics, PSI, protein struct initiative; 2.30A {Brucella melitensis} Back     alignment and structure
>1qop_A Tryptophan synthase alpha chain; lyase, carbon-oxygen lyase, tryptophan biosynthesis, pyridoxal phosphate; HET: IPL PLP; 1.4A {Salmonella typhimurium} SCOP: c.1.2.4 PDB: 1k8x_A* 1wbj_A* 2clk_A* 2j9z_A* 3cep_A* 1k8y_A* 1a5s_A* 1a50_A* 1c29_A* 1c8v_A* 1c9d_A* 1bks_A* 1cx9_A* 1fuy_A* 1cw2_A* 1k7e_A* 1k7f_A* 1k7x_A* 1k3u_A* 1k8z_A* ... Back     alignment and structure
>4djd_D C/Fe-SP, corrinoid/iron-sulfur protein small subunit; TIM barrel, rossmann fold, B12-dependent methyltransferase; HET: B12; 2.38A {Moorella thermoacetica} PDB: 4dje_D* 4djf_D* Back     alignment and structure
>3qz6_A HPCH/HPAI aldolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.00A {Desulfitobacterium hafniense} SCOP: c.1.12.0 Back     alignment and structure
>2ehh_A DHDPS, dihydrodipicolinate synthase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.90A {Aquifex aeolicus} Back     alignment and structure
>3sbf_A Mandelate racemase / muconate lactonizing enzyme; enolase fold, acid sugar dehydratase, D-araninonate, isomera; HET: EPE D8T; 1.50A {Vibrionales bacterium swat-3} PDB: 3r25_A 3dfh_A 4gis_A 4gir_A 4ggh_A 3gy1_A Back     alignment and structure
>3tcs_A Racemase, putative; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, TIM barrel; HET: PG4; 1.88A {Roseobacter denitrificans} PDB: 3u4f_A 3t9p_A 3t8q_A Back     alignment and structure
>1i4n_A Indole-3-glycerol phosphate synthase; thermostable TIM-barrel protein, salt bridges, electrostatic interactions, lyase; 2.50A {Thermotoga maritima} SCOP: c.1.2.4 PDB: 1j5t_A Back     alignment and structure
>3bo9_A Putative nitroalkan dioxygenase; TM0800, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE 2PE; 2.71A {Thermotoga maritima MSB8} Back     alignment and structure
>1dos_A Aldolase class II; lyase, classii fructose 1,6-bisphosphate aldolase, glycolysis; 1.67A {Escherichia coli} SCOP: c.1.10.2 PDB: 1b57_A* 1gyn_A 1zen_A Back     alignment and structure
>1eep_A Inosine 5'-monophosphate dehydrogenase; alpha-beta barrel, TIM barrel, IMPDH, IMP dehydrogenase, LOO purine biosynthesis, oxidoreductase; 2.40A {Borrelia burgdorferi} SCOP: c.1.5.1 Back     alignment and structure
>1wbh_A KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} SCOP: c.1.10.1 PDB: 2c0a_A 1wau_A 1eua_A 1eun_A 1fq0_A* 1fwr_A* Back     alignment and structure
>1qwg_A PSL synthase;, (2R)-phospho-3-sulfolactate synthase; beta-alpha-barrel, lyase; 1.60A {Methanocaldococcus jannaschii} SCOP: c.1.27.1 Back     alignment and structure
>1mxs_A KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate aldolase, sulfate, beta-BA lyase; 2.20A {Pseudomonas putida} SCOP: c.1.10.1 Back     alignment and structure
>3w01_A Heptaprenylglyceryl phosphate synthase; biosynthesis, prenyltransferases, enzyme catalysis, transfer; HET: PGE; 1.54A {Staphylococcus aureus} PDB: 3w02_A Back     alignment and structure
>1gox_A (S)-2-hydroxy-acid oxidase, peroxisomal; oxidoreductase (oxygen(A)); HET: FMN; 2.00A {Spinacia oleracea} SCOP: c.1.4.1 PDB: 1gyl_A* 1al8_A* 1al7_A* 2cdh_0 Back     alignment and structure
>2chr_A Chloromuconate cycloisomerase; 3.00A {Cupriavidus necator} SCOP: c.1.11.2 d.54.1.1 Back     alignment and structure
>1to3_A Putative aldolase YIHT; beta-alpha barrel, structural genomics, PSI, protein structure initiative; 2.70A {Salmonella typhimurium} SCOP: c.1.10.1 Back     alignment and structure
>1yxy_A Putative N-acetylmannosamine-6-phosphate 2-epimer; structural genomics, epimerase, PSI, structure initiative; 1.60A {Streptococcus pyogenes} SCOP: c.1.2.5 Back     alignment and structure
>1xi3_A Thiamine phosphate pyrophosphorylase; structural genomics, southeast collaboratory for structural genomics, hyperthermophIle; 1.70A {Pyrococcus furiosus} SCOP: c.1.3.1 Back     alignment and structure
>3mzn_A Glucarate dehydratase; lyase, structural genomics, protein structure initiative, PS nysgrc; 1.85A {Chromohalobacter salexigens} PDB: 3nfu_A Back     alignment and structure
>2vc6_A MOSA, dihydrodipicolinate synthase; DHDPS, TIM barrel, schiff base, lyase; HET: MCL; 1.95A {Sinorhizobium meliloti} Back     alignment and structure
>3ewb_X 2-isopropylmalate synthase; LEUA, structural genomics, unknown function, amino-acid biosynthesis; 2.10A {Listeria monocytogenes str} Back     alignment and structure
>2r14_A Morphinone reductase; H-tunnelling, flavoprotein, NADH, hydride transfer, oxidoreductase; HET: FMN TXD; 1.40A {Pseudomonas putida} PDB: 3gx9_A* 1gwj_A* Back     alignment and structure
>2vp8_A Dihydropteroate synthase 2; RV1207 transferase, folate biosynthesis, antibiotic resistance; 2.64A {Mycobacterium tuberculosis} Back     alignment and structure
>1aj0_A DHPS, dihydropteroate synthase; antibiotic, resistance, transferase, folate, biosynthesis; HET: PH2 SAN; 2.00A {Escherichia coli} SCOP: c.1.21.1 PDB: 1aj2_A* 1ajz_A 3tyz_A* 3tyu_A* 3tzf_A* 3tzn_A Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>3i6e_A Muconate cycloisomerase I; structural genomics, NYSGXRC, targer 9468A, muconate lactonizing enzyme, PSI-2, protein structure initiative; 1.70A {Ruegeria pomeroyi} PDB: 3i6t_A Back     alignment and structure
>3ve9_A Orotidine-5'-phosphate decarboxylase; TIM barrel fold, orotidine 5'-monopho decarboxylase, lyase; 1.45A {Metallosphaera sedula} PDB: 3ve7_A Back     alignment and structure
>3exr_A RMPD (hexulose-6-phosphate synthase); beta barrel, lyase; 1.70A {Streptococcus mutans} SCOP: c.1.2.3 PDB: 3exs_A* 3ext_A Back     alignment and structure
>4dye_A Isomerase; enolase family protein, EFI, enzym function initiative; 1.60A {Streptomyces coelicolor} PDB: 2oqh_A Back     alignment and structure
>3tha_A Tryptophan synthase alpha chain; structural genomics, center for structural genomics of infec diseases, csgid, lyase; 2.37A {Campylobacter jejuni} Back     alignment and structure
>3o07_A Pyridoxine biosynthesis protein SNZ1; (beta/alpha)8-barrel, pyridoxal 5-phosphate synthase, PLP G3 SNO1, biosynthetic protein; HET: 1GP; 1.80A {Saccharomyces cerevisiae} PDB: 3o06_A 3o05_A* 3fem_A Back     alignment and structure
>3sr7_A Isopentenyl-diphosphate delta-isomerase; isopentenyl pyrophosphate isomerase, TIM-barrel; 2.04A {Streptococcus mutans} Back     alignment and structure
>3ndo_A Deoxyribose-phosphate aldolase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography; HET: GOL; 1.25A {Mycobacterium smegmatis} PDB: 3ng3_A Back     alignment and structure
>3rmj_A 2-isopropylmalate synthase; LEUA, truncation, neisseria MENI TIM barrel, catalytic domain, dimer, leucine biosynthesis, ketoisovalerate; 1.95A {Neisseria meningitidis} Back     alignment and structure
>3ovp_A Ribulose-phosphate 3-epimerase; iron binding, isomerase; HET: XPE; 1.70A {Homo sapiens} SCOP: c.1.2.0 PDB: 3ovq_A* 3ovr_A* 3qc3_A Back     alignment and structure
>3ewb_X 2-isopropylmalate synthase; LEUA, structural genomics, unknown function, amino-acid biosynthesis; 2.10A {Listeria monocytogenes str} Back     alignment and structure
>4hpn_A Putative uncharacterized protein; enolase, enzyme function initiative, EFI, structural genomic isomerase; 1.60A {Agrobacterium tumefaciens} PDB: 4ggb_A Back     alignment and structure
>3qm3_A Fructose-bisphosphate aldolase; structural genomics, center for structural genomics of infec diseases, csgid, TIM beta/alpha-barrel, lyase; 1.85A {Campylobacter jejuni} SCOP: c.1.10.2 Back     alignment and structure
>2yyu_A Orotidine 5'-phosphate decarboxylase; TIM barrel, structural genomics, NPPSFA, national project on structural and functional analyses; HET: C5P; 2.20A {Geobacillus kaustophilus} PDB: 2yyt_A* Back     alignment and structure
>3fa4_A 2,3-dimethylmalate lyase; alpha/beta barrel, helix swapping; 2.18A {Aspergillus niger} PDB: 3fa3_A Back     alignment and structure
>1q7z_A 5-methyltetrahydrofolate S-homocysteine methyltransferase; methionine, cobalamin, vitamin B12; 1.70A {Thermotoga maritima} SCOP: c.1.21.2 c.1.26.1 PDB: 1q7q_A 1q7m_A 1q85_A 1q8a_A 1q8j_A* 3bof_A 3bol_A Back     alignment and structure
>1icp_A OPR1, 12-oxophytodienoate reductase 1; beta-alpha-barrel, protein-FMN-PEG complex, oxidoreductase; HET: FMN 2PE; 1.90A {Solanum lycopersicum} SCOP: c.1.4.1 PDB: 1icq_A* 1ics_A* 3hgr_A* 1vji_A* 2q3r_A* Back     alignment and structure
>1tx2_A DHPS, dihydropteroate synthase; folate biosynthesis, pterine, MA transferase; HET: 680; 1.83A {Bacillus anthracis} SCOP: c.1.21.1 PDB: 1tww_A* 1twz_A* 1tx0_A* 1tws_A* 3h21_A* 3h22_A* 3h23_A* 3h24_A* 3h26_A* 3h2a_A* 3h2c_A* 3h2e_A* 3h2f_A* 3h2m_A* 3h2n_A* 3h2o_A* 3tya_A* 3tyb_A* 3tyc_A* 3tyd_A* ... Back     alignment and structure
>2hsa_B 12-oxophytodienoate reductase 3; alpha beta 8 barrel, flavoprotein, jasmonate biosynthesis, oxidoreductase; HET: FMN; 1.50A {Solanum lycopersicum} PDB: 2hs6_A* 3hgs_A* 2hs8_A* 3hgo_A* 1q45_A* 2g5w_A* 2q3o_A* Back     alignment and structure
>2qiw_A PEP phosphonomutase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: P6G; 1.80A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3iv3_A Tagatose 1,6-diphosphate aldolase 2; TIM barrel, phosphate binding, tagatose-bisphosphate aldolas tagatose-1,6-bisphosphate aldolase; HET: MSE; 1.80A {Streptococcus mutans} PDB: 3mhf_A 3mhg_A 3jrk_A 3kao_A* 3myp_A 3myo_A Back     alignment and structure
>2v9d_A YAGE; dihydrodipicolinic acid synthase, N-acetyl neuraminate lyase, NAL, lyase, DHDPS, prophage; 2.15A {Escherichia coli} PDB: 2v8z_A 3nev_A* 3n2x_A* Back     alignment and structure
>2zbt_A Pyridoxal biosynthesis lyase PDXS; pyridoxine biosynthesis, structural genomics, NPPSFA; 1.65A {Thermus thermophilus} PDB: 2iss_A* Back     alignment and structure
>1chr_A Chloromuconate cycloisomerase; 3.00A {Ralstonia eutropha} PDB: 2chr_A Back     alignment and structure
>2cw6_A Hydroxymethylglutaryl-COA lyase, mitochondrial; HMG-COA lyase, ketogenic enzyme; HET: 3HG; 2.10A {Homo sapiens} PDB: 3mp3_A* 3mp4_A 3mp5_A* Back     alignment and structure
>3vnd_A TSA, tryptophan synthase alpha chain; psychrophilic enzyme, cold adaptation; HET: PE8; 2.60A {Shewanella frigidimarina} Back     alignment and structure
>1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 Back     alignment and structure
>3r2g_A Inosine 5'-monophosphate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.94A {Legionella pneumophila subsp} Back     alignment and structure
>2pgw_A Muconate cycloisomerase; enolase superfamily, octamer, small metabolism, PSI-II, NYSGXRC, structural genomics, PR structure initiative; 1.95A {Sinorhizobium meliloti} Back     alignment and structure
>1qpo_A Quinolinate acid phosphoribosyl transferase; type II prtase, de novo NAD biosynthesis, PRPP, phosphoribos transferase; 2.40A {Mycobacterium tuberculosis H37RV} SCOP: c.1.17.1 d.41.2.1 PDB: 1qpn_A 1qpq_A* 1qpr_A* Back     alignment and structure
>3oix_A Putative dihydroorotate dehydrogenase; dihydrooro oxidase; TIM barrel, oxidoreductase; HET: MLY FMN; 2.40A {Streptococcus mutans} Back     alignment and structure
>3mwc_A Mandelate racemase/muconate lactonizing protein; enolase, structural genomics, protein structure initiative, nysgrc; 1.80A {Kosmotoga olearia} Back     alignment and structure
>3tdn_A FLR symmetric alpha-beta TIM barrel; symmetric superfold, de novo protein; 1.40A {Synthetic construct} PDB: 3og3_A 3tdm_A Back     alignment and structure
>2rdx_A Mandelate racemase/muconate lactonizing enzyme, P; enolase, structural genomics, PSI, protein structu initiative, nysgrc; 2.00A {Roseovarius nubinhibens} Back     alignment and structure
>3obk_A Delta-aminolevulinic acid dehydratase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, lyase; HET: PBG; 2.50A {Toxoplasma gondii ME49} Back     alignment and structure
>2fli_A Ribulose-phosphate 3-epimerase; (beta/alpha)8-barrel, D- xylitol 5-phosphate, isomerase; HET: DX5; 1.80A {Streptococcus pyogenes} SCOP: c.1.2.2 Back     alignment and structure
>3p0w_A Mandelate racemase/muconate lactonizing protein; structural genomics, PSI-2, protein structure initiative; HET: GKR; 1.71A {Ralstonia pickettii} PDB: 4hn8_A 3nxl_A Back     alignment and structure
>2agk_A 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide...; TIM alpha/beta barrel; HET: CIT; 1.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3ivs_A Homocitrate synthase, mitochondrial; TIM barrel, metalloprotein, transferase, claisen condensatio acid biosynthesis; 2.24A {Schizosaccharomyces pombe} PDB: 3ivt_A* 3ivu_A* 3mi3_A* Back     alignment and structure
>1zlp_A PSR132, petal death protein; TIM-barrel, helix swapping,2-ethyl-3-methylmalate lyase, 2-P methylmalate lyase, lyase/PEP mutase superfamily; 2.70A {Dianthus caryophyllus} Back     alignment and structure
>3cyj_A Mandelate racemase/muconate lactonizing enzyme-LI protein; structural genomics, isomerase, PSI-2; 2.30A {Rubrobacter xylanophilus dsm 9941} Back     alignment and structure
>2ftp_A Hydroxymethylglutaryl-COA lyase; structural genomics, PSI, protein structure initiativ midwest center for structural genomics, MCSG; 2.40A {Pseudomonas aeruginosa} Back     alignment and structure
>3ble_A Citramalate synthase from leptospira interrogans; TIM barrel, licmsn, substrate specificity, acyltransferase, amino-acid biosynthesis; 2.00A {Leptospira interrogans} PDB: 3blf_A 3bli_A* Back     alignment and structure
>2r91_A 2-keto-3-deoxy-(6-phospho-)gluconate aldolase; TIM barrel, thermophilic, lyase; 2.00A {Thermoproteus tenax} PDB: 2r94_A Back     alignment and structure
>2qjg_A Putative aldolase MJ0400; beta-alpha barrel, lyase; HET: F2P; 2.60A {Methanocaldococcus jannaschii} PDB: 2qjh_A 2qji_A Back     alignment and structure
>2tps_A Protein (thiamin phosphate synthase); thiamin biosynthesis, TIM barrel; HET: TPS; 1.25A {Bacillus subtilis} SCOP: c.1.3.1 PDB: 1g4t_A* 3o15_A* 1g6c_A* 1g4e_A* 1g69_A* 3o16_A 1g4s_A* 1g4p_A* 1g67_A* Back     alignment and structure
>2opj_A O-succinylbenzoate-COA synthase; TIM barrel, structural genomics, protein structure initiative; 1.60A {Thermobifida fusca} PDB: 2qvh_A* Back     alignment and structure
>2bdq_A Copper homeostasis protein CUTC; alpha beta protein, structural genomics, PSI, protein structure initiative; 2.30A {Streptococcus agalactiae} Back     alignment and structure
>2w6r_A Imidazole glycerol phosphate synthase subunit HISF; lyase, fusion protein, cobalamin, precorrin, novel fold, VIT; 2.10A {Thermotoga maritima} Back     alignment and structure
>1xg4_A Probable methylisocitrate lyase; 2-methylisocitrate lyase/inhibitor complex, isocitrate lyase superfamily; HET: ICT; 1.60A {Escherichia coli} PDB: 1xg3_A* 1mum_A 1oqf_A 1ujq_A 1o5q_A Back     alignment and structure
>2wqp_A Polysialic acid capsule biosynthesis protein SIAC; NEUB, inhibitor, TIM barrel, sialic acid synthase, transfera; HET: WQP; 1.75A {Neisseria meningitidis} PDB: 2zdr_A 1xuz_A* 1xuu_A 3cm4_A Back     alignment and structure
>3pfr_A Mandelate racemase/muconate lactonizing protein; emolase superfamily fold, D-glucarate dehydratase, D-glucara isomerase; HET: GKR; 1.90A {Actinobacillus succinogenes} PDB: 3n6j_A 3n6h_A* 4gyp_C* Back     alignment and structure
>3bg3_A Pyruvate carboxylase, mitochondrial; TIM barrel, ATP-binding, biotin, disease mutation, gluconeogenesis, ligase, lipid synthesis, manganese; HET: KCX BTI; 2.80A {Homo sapiens} PDB: 3bg9_A Back     alignment and structure
>3gnn_A Nicotinate-nucleotide pyrophosphorylase; decode biostructures, ssgcid, niaid, SBRI, UWPPG, glycosyltransferase, transferase, structural genomics; 2.25A {Burkholderia pseudomallei} Back     alignment and structure
>2yzr_A Pyridoxal biosynthesis lyase PDXS; redox protein, pyridoxal phosphate, structural genomi NPPSFA; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>1thf_D HISF protein; thermophIle, TIM-barrel, histidine biosynthesis, lyase, phosphate-binding sites; 1.45A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2wjz_A 2a0n_A* 1gpw_A 1vh7_A 2rkx_A 3iio_A 3iip_A* 3iiv_A Back     alignment and structure
>3vkj_A Isopentenyl-diphosphate delta-isomerase; type 2 isopentenyl diphosphate isomerase; HET: FNR; 1.70A {Sulfolobus shibatae} PDB: 2zrv_A* 2zrw_A* 2zrx_A* 2zry_A* 2zrz_A* 3b03_A* 3b04_A* 3b05_A* 3b06_A* 2zru_A* Back     alignment and structure
>1nvm_A HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: a.5.7.1 c.1.10.5 Back     alignment and structure
>2dqw_A Dihydropteroate synthase; dimer, structural genomics; 1.65A {Thermus thermophilus} PDB: 2dza_A* 2dzb_A* Back     alignment and structure
>2y5s_A DHPS, dihydropteroate synthase; transferase, folate biosynthesis; HET: 78H; 1.95A {Burkholderia cenocepacia} PDB: 2y5j_A* Back     alignment and structure
>1vli_A Spore coat polysaccharide biosynthesis protein SP; 2636322, JCSG, protein structure initiative, BS SPSE, PSI; 2.38A {Bacillus subtilis} SCOP: b.85.1.1 c.1.10.6 Back     alignment and structure
>2ffc_A Orotidine 5-monophosphate decarboxylase; PV-PF10_0225, SGC, structural genomics, struc genomics consortium, lyase; HET: U5P; 1.70A {Plasmodium vivax} SCOP: c.1.2.3 PDB: 2guu_A* Back     alignment and structure
>3qja_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, T structural genomics consortium, TBSGC, lyase; 1.29A {Mycobacterium tuberculosis} PDB: 3t40_A* 3t44_A* 3t55_A* 3t78_A* 4fb7_A* Back     alignment and structure
>3eoo_A Methylisocitrate lyase; seattle structural genomics center for infectious disease, ssgcid; 2.90A {Burkholderia pseudomallei 1655} SCOP: c.1.12.7 Back     alignment and structure
>1p4c_A L(+)-mandelate dehydrogenase; TIM barrel, hydroxy acid oxidizing enzyme, oxidoreductase; HET: FMN MES; 1.35A {Pseudomonas putida} SCOP: c.1.4.1 PDB: 1huv_A* 1p5b_A* 3giy_A* 2a7p_A* 2a85_A* 2a7n_A* Back     alignment and structure
>2qr6_A IMP dehydrogenase/GMP reductase; NP_599840.1, G reductase domain, structural genomics, joint center for STR genomics, JCSG; HET: MSE; 1.50A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2y88_A Phosphoribosyl isomerase A; aromatic amino acid biosynthesis, TIM-barrel, His biosynthesis, tryptophan biosynthesis; HET: 2ER; 1.33A {Mycobacterium tuberculosis} PDB: 2y89_A 2y85_A* Back     alignment and structure
>2z6i_A Trans-2-enoyl-ACP reductase II; fatty acid synthesis, antibiotics, oxidoreductase, flavoprotein; HET: FMN; 1.70A {Streptococcus pneumoniae} PDB: 2z6j_A* Back     alignment and structure
>3nav_A Tryptophan synthase alpha chain; alpha subunit, structural genomics, CSG center for structural genomics of infectious diseases; 2.10A {Vibrio cholerae o1 biovar el tor} SCOP: c.1.2.4 Back     alignment and structure
>1vzw_A Phosphoribosyl isomerase A; histidine biosynthesis, tryptophan biosynthesis; 1.8A {Streptomyces coelicolor} SCOP: c.1.2.1 PDB: 2vep_A 2x30_A Back     alignment and structure
>1o4u_A Type II quinolic acid phosphoribosyltransferase; structural genomics, joint center for structural genomics, J protein structure initiative; 2.50A {Thermotoga maritima} SCOP: c.1.17.1 d.41.2.1 Back     alignment and structure
>3inp_A D-ribulose-phosphate 3-epimerase; IDP02542, isomerase, struc genomics, center for structural genomics of infectious DISE csgid; 2.05A {Francisella tularensis subsp} Back     alignment and structure
>4gj1_A 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide...; HISA, csgid, niaid,; 2.15A {Campylobacter jejuni subsp} Back     alignment and structure
>4hb7_A Dihydropteroate synthase; transferase; 1.95A {Staphylococcus aureus} PDB: 1ad1_A 1ad4_A* Back     alignment and structure
>4h83_A Mandelate racemase/muconate lactonizing enzyme; structural genomics, enzyme function initiative; 2.09A {Marine actinobacterium PHSC20C1} PDB: 3no1_A 3msy_A Back     alignment and structure
>3fok_A Uncharacterized protein CGL0159; CGL0159 ,brevibacterium flavum., structural genomics, PSI-2, protein structure initiative; 2.50A {Corynebacterium glutamicum} Back     alignment and structure
>4e4f_A Mannonate dehydratase; magnesium binding, enzyme function initiative, isomerase; 2.00A {Pectobacterium carotovorum subsp} Back     alignment and structure
>1w3i_A EDA, 2-keto-3-deoxy gluconate aldolase; archaeal metabolism, pyruvate; 1.7A {Sulfolobus solfataricus} SCOP: c.1.10.1 PDB: 1w37_A 1w3n_A* 1w3t_A* 2yda_A* Back     alignment and structure
>3tsm_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, ssgcid, seattle structural GE center for infectious disease, lyase; 2.15A {Brucella melitensis} SCOP: c.1.2.0 Back     alignment and structure
>3eeg_A 2-isopropylmalate synthase; 11106D, beta barrel, PSI-II, structural genomics, protein structure initiative; 2.78A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>4a29_A Engineered retro-aldol enzyme RA95.0; de novo protein, engineered enzyme, retro-aldolase, directed evolution; HET: 3NK MLT; 1.10A {Synthetic construct} PDB: 4a2s_A* 4a2r_A* 3tc7_A 3tc6_A 3nl8_A* 3nxf_A* 3o6y_X 3ud6_A* 1igs_A 1juk_A 1jul_A* 3hoj_A 1a53_A* 1lbf_A* 1lbl_A* 3nyz_A 3nz1_A* 3uy7_A 3uxd_A* 3uxa_A* ... Back     alignment and structure
>3paj_A Nicotinate-nucleotide pyrophosphorylase, carboxyl; TIM barrel, pyridin dicarboxylate, 5-phospho-alpha-D-ribose 1-diphosphate; 2.00A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>2uva_G Fatty acid synthase beta subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; HET: FMN; 3.10A {Thermomyces lanuginosus} PDB: 2uvc_G* Back     alignment and structure
>4dxk_A Mandelate racemase / muconate lactonizing enzyme protein; enolase, mandelate racemase subgroup, enzyme function initia EFI; 1.25A {Agrobacterium tumefaciens} PDB: 4dx3_A 2pod_A Back     alignment and structure
>1q7z_A 5-methyltetrahydrofolate S-homocysteine methyltransferase; methionine, cobalamin, vitamin B12; 1.70A {Thermotoga maritima} SCOP: c.1.21.2 c.1.26.1 PDB: 1q7q_A 1q7m_A 1q85_A 1q8a_A 1q8j_A* 3bof_A 3bol_A Back     alignment and structure
>2fds_A Orotidine-monophosphate-decarboxylase; TIM barrel, structural genomics, structural genomics consortium, SGC, unknown function; 1.72A {Plasmodium berghei} SCOP: c.1.2.3 PDB: 2aqw_A Back     alignment and structure
>2nx9_A Oxaloacetate decarboxylase 2, subunit alpha; carboxyltransferase structure, B enzymes, Zn2+ binding site, TIM-barrel fold, lyase; 1.70A {Vibrio cholerae} Back     alignment and structure
>3ivs_A Homocitrate synthase, mitochondrial; TIM barrel, metalloprotein, transferase, claisen condensatio acid biosynthesis; 2.24A {Schizosaccharomyces pombe} PDB: 3ivt_A* 3ivu_A* 3mi3_A* Back     alignment and structure
>1s2w_A Phosphoenolpyruvate phosphomutase; phosphonopyruvate, phosphonate biosynthesis pathway, isomera; 1.69A {Mytilus edulis} SCOP: c.1.12.7 PDB: 1m1b_A 1s2t_A 1s2v_A 1pym_A 1s2u_A Back     alignment and structure
>3aty_A Tcoye, prostaglandin F2A synthase; alpha/beta barrel, oxidoreductase, flavin mononucleotide; HET: FMN; 1.70A {Trypanosoma cruzi} PDB: 3atz_A* Back     alignment and structure
>2h9a_B CO dehydrogenase/acetyl-COA synthase, iron- sulfur protein; heterodimer, beta-alpha-barrels, oxidoreductase; HET: B12; 1.90A {Carboxydothermus hydrogenoformans} PDB: 2ycl_B* Back     alignment and structure
>1tv5_A Dhodehase, dihydroorotate dehydrogenase homolog, mitochondri, dihydroorotate; alpha-beta barrel, TIM barrel, oxidoreductase; HET: A26 FMN ORO N8E; 2.40A {Plasmodium falciparum} SCOP: c.1.4.1 Back     alignment and structure
>1wbh_A KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} SCOP: c.1.10.1 PDB: 2c0a_A 1wau_A 1eua_A 1eun_A 1fq0_A* 1fwr_A* Back     alignment and structure
>1wa3_A 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, pyruvate, lyase; 1.9A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 1vlw_A Back     alignment and structure
>4e38_A Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho aldolase; lyase; 1.64A {Vibrionales bacterium swat-3} Back     alignment and structure
>1vc4_A Indole-3-glycerol phosphate synthase; lyase, tryptophan biosynthesis, riken structural genomics/PR initiative, RSGI, structural genomics; 1.80A {Thermus thermophilus} SCOP: c.1.2.4 Back     alignment and structure
>1rqb_A Transcarboxylase 5S subunit; TIM-barrel, carbamylated lysine, transfera; HET: KCX; 1.90A {Propionibacterium freudenreichii subspshermanii} SCOP: a.5.7.2 c.1.10.5 PDB: 1rqe_A 1rqh_A* 1rr2_A* 1u5j_A* 1s3h_A* Back     alignment and structure
>3gnn_A Nicotinate-nucleotide pyrophosphorylase; decode biostructures, ssgcid, niaid, SBRI, UWPPG, glycosyltransferase, transferase, structural genomics; 2.25A {Burkholderia pseudomallei} Back     alignment and structure
>1u83_A Phosphosulfolactate synthase; structural genomics, phosphosulfolactate PSI, protein structure initiative, midwest center for struc genomics; 2.20A {Bacillus subtilis} SCOP: c.1.27.1 Back     alignment and structure
>1vcf_A Isopentenyl-diphosphate delta-isomerase; TIM barrel, structural genomics, riken structural genomics/P initiative, RSGI; HET: FMN; 2.60A {Thermus thermophilus} SCOP: c.1.4.1 PDB: 1vcg_A* 3dh7_A* Back     alignment and structure
>1kbi_A Cytochrome B2, L-LCR; flavocytochrome B2, electron transfer, oxidoreductase; HET: HEM FMN; 2.30A {Saccharomyces cerevisiae} SCOP: c.1.4.1 d.120.1.1 PDB: 1fcb_A* 1lco_A* 1ldc_A* 1sze_A* 2oz0_A* 1szf_A* 1szg_A* 1ltd_A* 1kbj_A* 1qcw_A* 3ks0_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 456
d1muma_289 c.1.12.7 (A:) 2-methylisocitrate lyase {Escherichi 6e-73
d1f61a_418 c.1.12.7 (A:) Isocitrate lyase {Mycobacterium tube 7e-62
d1igwa_416 c.1.12.7 (A:) Isocitrate lyase {Escherichia coli [ 3e-53
d1s2wa_275 c.1.12.7 (A:) Phosphoenolpyruvate mutase {Blue mus 2e-51
d2p10a1197 c.1.12.9 (A:8-204) Uncharacterized protein Mll9387 1e-42
d1dqua_519 c.1.12.7 (A:) Isocitrate lyase {Aspergillus nidula 7e-37
>d1muma_ c.1.12.7 (A:) 2-methylisocitrate lyase {Escherichia coli [TaxId: 562]} Length = 289 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Phosphoenolpyruvate/pyruvate domain
family: Phosphoenolpyruvate mutase/Isocitrate lyase-like
domain: 2-methylisocitrate lyase
species: Escherichia coli [TaxId: 562]

 Score =  229 bits (585), Expect = 6e-73
 Identities = 98/291 (33%), Positives = 157/291 (53%), Gaps = 8/291 (2%)

Query: 76  SPAKSLRQILELPGVHQGPACFDALSAKLVEKSGFSFCFTSGFSISAARLALPDTGFISY 135
           SP K+ R  L      Q     +A  A L +++G+   + SG  ++A  L LPD G  + 
Sbjct: 3   SPGKAFRAALTKENPLQIVGTINANHALLAQRAGYQAIYLSGGGVAAGSLGLPDLGISTL 62

Query: 136 GEMVDQGQLITQAVSIPVIGDGDNGYGNA-MNVKRTVKGYIKAGFAGIILEDQVSPKGCG 194
            +++   + IT   S+P++ D D G+G++  NV RTVK  IKAG AG+ +EDQV  K CG
Sbjct: 63  DDVLTDIRRITDVCSLPLLVDADIGFGSSAFNVARTVKSMIKAGAAGLHIEDQVGAKRCG 122

Query: 195 HTRGRKVVSREEAVMRIKAAVDARKESGSDIVIVARTDSRQALSLEESLRRSRAFADAGA 254
           H   + +VS+EE V RI+AAVDA+     D VI+ARTD+     L+ ++ R++A+ +AGA
Sbjct: 123 HRPNKAIVSKEEMVDRIRAAVDAKT--DPDFVIMARTDALAVEGLDAAIERAQAYVEAGA 180

Query: 255 DVLFIDALASKEEMKAFCEISPLVPKMANMLEGGGKTPILNPLELEELGFKLVAYPLSLI 314
           ++LF +A+      + F +    VP +AN+ E  G TP+    EL      +  YPLS  
Sbjct: 181 EMLFPEAITELAMYRQFADAVQ-VPILANITE-FGATPLFTTDELRSAHVAMALYPLSAF 238

Query: 315 GVSVRAMQDALTAIK--GGRIPSPGSMPSFQEIKETLGFNTYYEE-EKRYA 362
               RA +     ++  G +     +M +  E+ E++ +  Y E+ +  +A
Sbjct: 239 RAMNRAAEHVYNVLRQEGTQKSVIDTMQTRNELYESINYYQYEEKLDNLFA 289
>d1f61a_ c.1.12.7 (A:) Isocitrate lyase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 418 Back     information, alignment and structure
>d1igwa_ c.1.12.7 (A:) Isocitrate lyase {Escherichia coli [TaxId: 562]} Length = 416 Back     information, alignment and structure
>d1s2wa_ c.1.12.7 (A:) Phosphoenolpyruvate mutase {Blue mussel (Mytilus edulis) [TaxId: 6550]} Length = 275 Back     information, alignment and structure
>d2p10a1 c.1.12.9 (A:8-204) Uncharacterized protein Mll9387 {Mesorhizobium loti [TaxId: 381]} Length = 197 Back     information, alignment and structure
>d1dqua_ c.1.12.7 (A:) Isocitrate lyase {Aspergillus nidulans [TaxId: 162425]} Length = 519 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query456
d1muma_289 2-methylisocitrate lyase {Escherichia coli [TaxId: 100.0
d1f61a_418 Isocitrate lyase {Mycobacterium tuberculosis [TaxI 100.0
d1igwa_416 Isocitrate lyase {Escherichia coli [TaxId: 562]} 100.0
d1s2wa_275 Phosphoenolpyruvate mutase {Blue mussel (Mytilus e 100.0
d1dqua_519 Isocitrate lyase {Aspergillus nidulans [TaxId: 162 100.0
d2p10a1197 Uncharacterized protein Mll9387 {Mesorhizobium lot 100.0
d1m3ua_262 Ketopantoate hydroxymethyltransferase PanB {Escher 99.92
d1oy0a_262 Ketopantoate hydroxymethyltransferase PanB {Mycoba 99.89
d1o66a_260 Ketopantoate hydroxymethyltransferase PanB {Neisse 99.88
d1xxxa1296 Dihydrodipicolinate synthase {Mycobacterium tuberc 97.4
d1o5ka_295 Dihydrodipicolinate synthase {Thermotoga maritima 97.33
d1xkya1292 Dihydrodipicolinate synthase {Bacillus anthracis [ 97.29
d1hl2a_295 N-acetylneuraminate lyase {Escherichia coli [TaxId 97.28
d2a6na1292 Dihydrodipicolinate synthase {Escherichia coli [Ta 97.18
d1f74a_293 N-acetylneuraminate lyase {Haemophilus influenzae 96.87
d1w3ia_293 2-keto-3-deoxy gluconate aldolase Eda {Sulfolobus 96.8
d1rvka1255 Hypothetical protein Atu3453 {Agrobacterium tumefa 96.7
d1xm3a_251 Thiazole biosynthesis protein ThiG {Bacillus subti 96.63
d1izca_299 Macrophomate synthase {Macrophoma commelinae [TaxI 96.58
d1m3ua_262 Ketopantoate hydroxymethyltransferase PanB {Escher 96.33
d1y0ea_222 Putative N-acetylmannosamine-6-phosphate 2-epimera 96.28
d1gvfa_284 Tagatose-1,6-bisphosphate aldolase {Escherichia co 96.19
d1dxea_253 2-dehydro-3-deoxy-galactarate aldolase {Escherichi 96.16
d1yxya1230 Putative N-acetylmannosamine-6-phosphate 2-epimera 96.13
d1gtea2312 Dihydropyrimidine dehydrogenase, domain 4 {Pig (Su 96.09
d1vr6a1338 3-deoxy-D-arabino-heptulosonate-7-phosphate syntha 96.08
d1jpma1234 L-Ala-D/L-Glu epimerase {Bacillus subtilis [TaxId: 95.9
d1o66a_260 Ketopantoate hydroxymethyltransferase PanB {Neisse 95.78
d2gl5a1278 Putative dehydratase protein STM2273 {Salmonella t 95.62
d1wv2a_243 Thiazole biosynthesis protein ThiG {Pseudomonas ae 95.34
d1rvga_305 Fructose-bisphosphate aldolase (FBP aldolase) {The 95.2
d1yxya1230 Putative N-acetylmannosamine-6-phosphate 2-epimera 95.18
d1xi3a_206 Thiamin phosphate synthase {Archaeon (Pyrococcus f 94.69
d1tzza1247 Hypothetical protein Bll6730 {Bradyrhizobium japon 94.63
d1yeya1252 RTS beta protein {Xanthomonas campestris pv. campe 94.58
d1ps9a1330 2,4-dienoyl-CoA reductase, N-terminal domain {Esch 94.48
d1ojxa_251 Archaeal fructose 1,6-bisphosphate aldolase {Archa 94.43
d2chra1244 Chlormuconate cycloisomerase {Alcaligenes eutrophu 94.42
d1h7na_340 5-aminolaevulinate dehydratase, ALAD (porphobilino 94.39
d1gtea2312 Dihydropyrimidine dehydrogenase, domain 4 {Pig (Su 93.99
d2tpsa_226 Thiamin phosphate synthase {Bacillus subtilis [Tax 93.99
d1vrda1330 Inosine monophosphate dehydrogenase (IMPDH) {Therm 93.98
d1y0ea_222 Putative N-acetylmannosamine-6-phosphate 2-epimera 93.9
d1jr1a1378 Inosine monophosphate dehydrogenase (IMPDH) {Chine 93.88
d1oy0a_262 Ketopantoate hydroxymethyltransferase PanB {Mycoba 93.48
d1geha1307 Ribulose 1,5-bisphosphate carboxylase-oxygenase {A 93.24
d1gzga_329 5-aminolaevulinate dehydratase, ALAD (porphobilino 93.2
d1xm3a_251 Thiazole biosynthesis protein ThiG {Bacillus subti 93.14
d1lt7a_361 Betaine-homocysteine S-methyltransferase {Human (H 93.06
d1z41a1337 NADPH dehydrogenase NamA {Bacillus subtilis [TaxId 93.04
d1zfja1365 Inosine monophosphate dehydrogenase (IMPDH) {Strep 92.92
d1muca1242 Muconate-lactonizing enzyme {Pseudomonas putida [T 92.67
d2gdqa1256 Hypothetical protein YitF {Bacillus subtilis [TaxI 92.23
d1nu5a1243 Chlormuconate cycloisomerase {Pseudomonas sp. p51 92.19
d2mnra1227 Mandelate racemase {Pseudomonas putida [TaxId: 303 91.97
d1jfla1115 Aspartate racemase {Archaeon Pyrococcus horikoshii 91.75
d1vhna_305 Putative flavin oxidoreducatase TM0096 {Thermotoga 91.73
d1wdda1325 Ribulose 1,5-bisphosphate carboxylase-oxygenase {R 91.64
d1izca_299 Macrophomate synthase {Macrophoma commelinae [TaxI 91.24
d1pv8a_320 5-aminolaevulinate dehydratase, ALAD (porphobilino 91.19
d1eepa_388 Inosine monophosphate dehydrogenase (IMPDH) {Lyme 91.15
d1twda_247 Copper homeostasis protein CutC {Shigella flexneri 91.12
d2d69a1291 Ribulose 1,5-bisphosphate carboxylase-oxygenase {A 90.54
d2c1ha1319 5-aminolaevulinate dehydratase, ALAD (porphobilino 90.54
d1l6sa_323 5-aminolaevulinate dehydratase, ALAD (porphobilino 90.06
d1dxea_253 2-dehydro-3-deoxy-galactarate aldolase {Escherichi 90.01
d1km4a_212 Orotidine 5'-monophosphate decarboxylase (OMP deca 89.77
d1mxsa_216 KDPG aldolase {Pseudomonas putida [TaxId: 303]} 89.58
d1pvna1362 Inosine monophosphate dehydrogenase (IMPDH) {Tritr 89.51
d3bofa2300 Cobalamin-dependent methionine synthase MetH, N-te 88.62
d1ps9a1330 2,4-dienoyl-CoA reductase, N-terminal domain {Esch 88.43
d1z41a1337 NADPH dehydrogenase NamA {Bacillus subtilis [TaxId 88.38
d1qwga_251 (2r)-phospho-3-sulfolactate synthase ComA {Archaeo 87.67
d1p0ka_329 Isopentenyl-diphosphate delta-isomerase {Bacillus 87.66
d2a21a1263 3-deoxy-D-manno-octulosonate 8-phosphate synthase 87.58
d1sjda1242 N-acylamino acid racemase {Amycolatopsis sp. [TaxI 87.47
d1q6oa_213 3-keto-L-gulonate 6-phosphate decarboxylase {Esche 87.37
d1geqa_248 Trp synthase alpha-subunit {Archaeon Pyrococcus fu 87.34
d1wv2a_243 Thiazole biosynthesis protein ThiG {Pseudomonas ae 87.17
d1jpdx1208 L-Ala-D/L-Glu epimerase {Escherichia coli [TaxId: 86.61
d1rd5a_261 Trp synthase alpha-subunit {Maize (Zea mays) [TaxI 86.34
d1ub3a_211 Deoxyribose-phosphate aldolase DeoC {Thermus therm 86.27
d1bwva1328 Ribulose 1,5-bisphosphate carboxylase-oxygenase {G 86.04
d1lt7a_361 Betaine-homocysteine S-methyltransferase {Human (H 85.65
d1twda_247 Copper homeostasis protein CutC {Shigella flexneri 85.31
d1ykwa1283 Ribulose 1,5-bisphosphate carboxylase-oxygenase {C 85.09
d1juba_311 Dihydroorotate dehydrogenase {Lactococcus lactis, 84.56
d1p0ka_329 Isopentenyl-diphosphate delta-isomerase {Bacillus 84.42
d1xkya1292 Dihydrodipicolinate synthase {Bacillus anthracis [ 84.07
d1zfja1365 Inosine monophosphate dehydrogenase (IMPDH) {Strep 83.72
d1gqna_252 Type I 3-dehydroquinate dehydratase {Salmonella ty 83.5
d1h5ya_252 Cyclase subunit (or domain) of imidazoleglycerolph 83.38
d1mzha_225 Deoxyribose-phosphate aldolase DeoC {Aquifex aeoli 82.72
d1n7ka_234 Deoxyribose-phosphate aldolase DeoC {Archaeon Aero 82.5
d2tpsa_226 Thiamin phosphate synthase {Bacillus subtilis [Tax 82.3
d1vhca_212 Hypothetical protein HI0047 {Haemophilus influenza 82.07
d1a53a_247 Indole-3-glycerophosphate synthase, IPGS {Archaeon 81.87
d1ep3a_311 Dihydroorotate dehydrogenase {Lactococcus lactis, 81.48
d1tx2a_273 Dihydropteroate synthetase {Bacillus anthracis [Ta 81.42
d1qapa1167 Quinolinic acid phosphoribosyltransferase (Nicotin 81.41
d1hl2a_295 N-acetylneuraminate lyase {Escherichia coli [TaxId 81.38
d1eyea_270 Dihydropteroate synthetase {Mycobacterium tubercul 81.24
d1r6wa1221 O-succinylbenzoate synthase {Escherichia coli [Tax 81.18
d1vcfa1310 Isopentenyl-diphosphate delta-isomerase {Thermus t 81.14
d1dosa_358 Fructose-bisphosphate aldolase (FBP aldolase) {Esc 80.69
d1ep3a_311 Dihydroorotate dehydrogenase {Lactococcus lactis, 80.09
>d1muma_ c.1.12.7 (A:) 2-methylisocitrate lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Phosphoenolpyruvate/pyruvate domain
family: Phosphoenolpyruvate mutase/Isocitrate lyase-like
domain: 2-methylisocitrate lyase
species: Escherichia coli [TaxId: 562]

Probab=100.00  E-value=4e-72  Score=554.24  Aligned_cols=283  Identities=35%  Similarity=0.555  Sum_probs=268.2

Q ss_pred             cHHHHHHHHHhCCCceeecccCChHHHHHHHHhCCcEEEecchHHhhhhcccCCCCCCCHHHHHHHHHHHHhccCCcEEE
Q 012815           76 SPAKSLRQILELPGVHQGPACFDALSAKLVEKSGFSFCFTSGFSISAARLALPDTGFISYGEMVDQGQLITQAVSIPVIG  155 (456)
Q Consensus        76 ~~a~~Lr~ll~~~~~lv~pgayDalSArl~e~aGfdAI~vSG~avSas~lG~PD~~~lt~~Eml~~~r~I~ra~~iPVIa  155 (456)
                      +++++||++|+.++++++||+||++||+++|++||+++|+||+++|++++|+||.+++|++||++++++|++++++||||
T Consensus         3 ~~~~~lr~ll~~~~~~~~~~~~D~~sA~~~e~~Gf~a~~~sg~~~sa~~~G~pD~~~~~~~e~~~~~~~i~~a~~~Pvi~   82 (289)
T d1muma_           3 SPGKAFRAALTKENPLQIVGTINANHALLAQRAGYQAIYLSGGGVAAGSLGLPDLGISTLDDVLTDIRRITDVCSLPLLV   82 (289)
T ss_dssp             CHHHHHHHHHHHCSSEEEEECSSHHHHHHHHHTTCSCEEECHHHHHHTTSCCCSSSCCCHHHHHHHHHHHHHHCCSCEEE
T ss_pred             CHHHHHHHHHhCCCCEEeecCCCHHHHHHHHHcCCCEEEhhHHHHHHHccCCCCCCCCChHHHHHHHHHHhcccCCCeee
Confidence            57899999999999999999999999999999999999999999998789999999999999999999999999999999


Q ss_pred             eCCCCCCC-HHHHHHHHHHHHHhCccEEEeCCCCCCCCccCCCCccccCHHHHHHHHHHHHHHhHhhCCCeEEEEecchh
Q 012815          156 DGDNGYGN-AMNVKRTVKGYIKAGFAGIILEDQVSPKGCGHTRGRKVVSREEAVMRIKAAVDARKESGSDIVIVARTDSR  234 (456)
Q Consensus       156 D~DtGYG~-~~nv~rtVk~l~~AGaaGI~IEDq~~pK~CGH~~gk~lvp~ee~v~kI~AA~~Ar~~~G~dfvIiARTDA~  234 (456)
                      |+|+|||+ ++||+++|++|+++||+|||||||.+||+|||.+++.++|.+|++.||+||++++.  ++||+|+||||++
T Consensus        83 D~d~GyG~~~~~v~~~v~~~~~aGvagi~iEDq~~pk~~g~~~~~~~~~~~e~~~ki~aa~~a~~--~~d~~IiARTDa~  160 (289)
T d1muma_          83 DADIGFGSSAFNVARTVKSMIKAGAAGLHIEDQVGAKRCGHRPNKAIVSKEEMVDRIRAAVDAKT--DPDFVIMARTDAL  160 (289)
T ss_dssp             ECTTCSSSSHHHHHHHHHHHHHHTCSEEEEECBCCCSSTTCCSCCCBCCHHHHHHHHHHHHHTCS--STTSEEEEEECCH
T ss_pred             cccccccccchHHHHHHHHHHHCCCCEEEecCcccccccccccccceecHHHHHHHHHHHHHhcC--Ccchhheeccccc
Confidence            99999997 68999999999999999999999999999999999999999999999999999987  4799999999999


Q ss_pred             hcccHHHHHHHHHHhHhcCCCEEEeccCCCHHHHHHHHHhCCCCceeeeeeccCCCCCCCCHHHHHhcCCCEEeccchHH
Q 012815          235 QALSLEESLRRSRAFADAGADVLFIDALASKEEMKAFCEISPLVPKMANMLEGGGKTPILNPLELEELGFKLVAYPLSLI  314 (456)
Q Consensus       235 ~~~~ldeAI~RakAy~eAGAD~Ifie~~~s~eei~~i~~~v~~vP~~~N~~~~~g~tp~lt~~eL~elGv~~Vs~p~~ll  314 (456)
                      ...++||||+|+++|++||||+||++++++.+++++++++++ +|+++|++++ +++|.++.+||.++||++++||++++
T Consensus       161 ~~~g~~eAi~R~~aY~eAGAD~vf~~~~~~~~~~~~~~~~~~-~Pl~~~~~~~-~~~p~~s~~eL~~~Gv~~v~~~~~~~  238 (289)
T d1muma_         161 AVEGLDAAIERAQAYVEAGAEMLFPEAITELAMYRQFADAVQ-VPILANITEF-GATPLFTTDELRSAHVAMALYPLSAF  238 (289)
T ss_dssp             HHHCHHHHHHHHHHHHHTTCSEEEETTCCCHHHHHHHHHHHC-SCBEEECCSS-SSSCCCCHHHHHHTTCSEEEESSHHH
T ss_pred             cccCHHHHHHHHHHhhhcCCcEEEecCCCCHHHHHHHHHhcC-CCEEEeecCc-CCCccchHHHHHHhccceEEechHHH
Confidence            989999999999999999999999999999999999999998 7999999986 77899999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHc-CCCC-CCCCCCCHHHHHHhcCcccHHH-HHHccc
Q 012815          315 GVSVRAMQDALTAIKG-GRIP-SPGSMPSFQEIKETLGFNTYYE-EEKRYA  362 (456)
Q Consensus       315 ~aa~~A~~~~l~~i~~-g~~~-~~~~~~~~~e~~~lvg~~~~~~-~e~~y~  362 (456)
                      +++++||+++++.|++ |... ..+.|.+++|+++++||++|++ ++++|.
T Consensus       239 ~aa~~a~~~~~~~l~~~G~~~~~~~~m~~~~el~~l~g~~~~ee~~~~~~a  289 (289)
T d1muma_         239 RAMNRAAEHVYNVLRQEGTQKSVIDTMQTRNELYESINYYQYEEKLDNLFA  289 (289)
T ss_dssp             HHHHHHHHHHHHHHHHHSSSGGGGGGSCCHHHHHHHTTTHHHHHHHHHHCC
T ss_pred             HHHHHHHHHHHHHHHHcCCcccchhcccCHHHHHHhcCHHHHHHHHHhhcC
Confidence            9999999999999986 4433 3567889999999999999987 687774
>d1f61a_ c.1.12.7 (A:) Isocitrate lyase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1igwa_ c.1.12.7 (A:) Isocitrate lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s2wa_ c.1.12.7 (A:) Phosphoenolpyruvate mutase {Blue mussel (Mytilus edulis) [TaxId: 6550]} Back     information, alignment and structure
>d1dqua_ c.1.12.7 (A:) Isocitrate lyase {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d2p10a1 c.1.12.9 (A:8-204) Uncharacterized protein Mll9387 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1m3ua_ c.1.12.8 (A:) Ketopantoate hydroxymethyltransferase PanB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oy0a_ c.1.12.8 (A:) Ketopantoate hydroxymethyltransferase PanB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1o66a_ c.1.12.8 (A:) Ketopantoate hydroxymethyltransferase PanB {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1xxxa1 c.1.10.1 (A:5-300) Dihydrodipicolinate synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1o5ka_ c.1.10.1 (A:) Dihydrodipicolinate synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xkya1 c.1.10.1 (A:1-292) Dihydrodipicolinate synthase {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
>d1hl2a_ c.1.10.1 (A:) N-acetylneuraminate lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a6na1 c.1.10.1 (A:1-292) Dihydrodipicolinate synthase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f74a_ c.1.10.1 (A:) N-acetylneuraminate lyase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1w3ia_ c.1.10.1 (A:) 2-keto-3-deoxy gluconate aldolase Eda {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1rvka1 c.1.11.2 (A:127-381) Hypothetical protein Atu3453 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1xm3a_ c.1.31.1 (A:) Thiazole biosynthesis protein ThiG {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1izca_ c.1.12.5 (A:) Macrophomate synthase {Macrophoma commelinae [TaxId: 108330]} Back     information, alignment and structure
>d1m3ua_ c.1.12.8 (A:) Ketopantoate hydroxymethyltransferase PanB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y0ea_ c.1.2.5 (A:) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1gvfa_ c.1.10.2 (A:) Tagatose-1,6-bisphosphate aldolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dxea_ c.1.12.5 (A:) 2-dehydro-3-deoxy-galactarate aldolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yxya1 c.1.2.5 (A:4-233) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1gtea2 c.1.4.1 (A:533-844) Dihydropyrimidine dehydrogenase, domain 4 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1vr6a1 c.1.10.4 (A:1-338) 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHP synthase, AroG) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jpma1 c.1.11.2 (A:126-359) L-Ala-D/L-Glu epimerase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1o66a_ c.1.12.8 (A:) Ketopantoate hydroxymethyltransferase PanB {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d2gl5a1 c.1.11.2 (A:123-400) Putative dehydratase protein STM2273 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1wv2a_ c.1.31.1 (A:) Thiazole biosynthesis protein ThiG {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1rvga_ c.1.10.2 (A:) Fructose-bisphosphate aldolase (FBP aldolase) {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1yxya1 c.1.2.5 (A:4-233) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1xi3a_ c.1.3.1 (A:) Thiamin phosphate synthase {Archaeon (Pyrococcus furiosus) [TaxId: 2261]} Back     information, alignment and structure
>d1tzza1 c.1.11.2 (A:1146-1392) Hypothetical protein Bll6730 {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d1yeya1 c.1.11.2 (A:184-435) RTS beta protein {Xanthomonas campestris pv. campestris [TaxId: 340]} Back     information, alignment and structure
>d1ps9a1 c.1.4.1 (A:1-330) 2,4-dienoyl-CoA reductase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ojxa_ c.1.10.1 (A:) Archaeal fructose 1,6-bisphosphate aldolase {Archaeon Thermoproteus tenax [TaxId: 2271]} Back     information, alignment and structure
>d2chra1 c.1.11.2 (A:127-370) Chlormuconate cycloisomerase {Alcaligenes eutrophus [TaxId: 106590]} Back     information, alignment and structure
>d1h7na_ c.1.10.3 (A:) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gtea2 c.1.4.1 (A:533-844) Dihydropyrimidine dehydrogenase, domain 4 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2tpsa_ c.1.3.1 (A:) Thiamin phosphate synthase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vrda1 c.1.5.1 (A:1-85,A:213-457) Inosine monophosphate dehydrogenase (IMPDH) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1y0ea_ c.1.2.5 (A:) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1jr1a1 c.1.5.1 (A:17-112,A:233-514) Inosine monophosphate dehydrogenase (IMPDH) {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1oy0a_ c.1.12.8 (A:) Ketopantoate hydroxymethyltransferase PanB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1geha1 c.1.14.1 (A:137-443) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Archaeon Thermococcus kodakaraensis [TaxId: 311400]} Back     information, alignment and structure
>d1gzga_ c.1.10.3 (A:) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1xm3a_ c.1.31.1 (A:) Thiazole biosynthesis protein ThiG {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1lt7a_ c.1.26.1 (A:) Betaine-homocysteine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z41a1 c.1.4.1 (A:2-338) NADPH dehydrogenase NamA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1zfja1 c.1.5.1 (A:2-94,A:221-492) Inosine monophosphate dehydrogenase (IMPDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1muca1 c.1.11.2 (A:131-372) Muconate-lactonizing enzyme {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2gdqa1 c.1.11.2 (A:119-374) Hypothetical protein YitF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1nu5a1 c.1.11.2 (A:127-369) Chlormuconate cycloisomerase {Pseudomonas sp. p51 [TaxId: 65067]} Back     information, alignment and structure
>d2mnra1 c.1.11.2 (A:133-359) Mandelate racemase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1jfla1 c.78.2.1 (A:1-115) Aspartate racemase {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1vhna_ c.1.4.1 (A:) Putative flavin oxidoreducatase TM0096 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wdda1 c.1.14.1 (A:151-475) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1izca_ c.1.12.5 (A:) Macrophomate synthase {Macrophoma commelinae [TaxId: 108330]} Back     information, alignment and structure
>d1pv8a_ c.1.10.3 (A:) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eepa_ c.1.5.1 (A:) Inosine monophosphate dehydrogenase (IMPDH) {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]} Back     information, alignment and structure
>d1twda_ c.1.30.1 (A:) Copper homeostasis protein CutC {Shigella flexneri [TaxId: 623]} Back     information, alignment and structure
>d2d69a1 c.1.14.1 (A:134-424) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2c1ha1 c.1.10.3 (A:10-328) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Prosthecochloris vibrioformis [TaxId: 1098]} Back     information, alignment and structure
>d1l6sa_ c.1.10.3 (A:) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dxea_ c.1.12.5 (A:) 2-dehydro-3-deoxy-galactarate aldolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1km4a_ c.1.2.3 (A:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1mxsa_ c.1.10.1 (A:) KDPG aldolase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1pvna1 c.1.5.1 (A:2-99,A:231-494) Inosine monophosphate dehydrogenase (IMPDH) {Tritrichomonas foetus [TaxId: 5724]} Back     information, alignment and structure
>d3bofa2 c.1.26.1 (A:1-300) Cobalamin-dependent methionine synthase MetH, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ps9a1 c.1.4.1 (A:1-330) 2,4-dienoyl-CoA reductase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z41a1 c.1.4.1 (A:2-338) NADPH dehydrogenase NamA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1qwga_ c.1.27.1 (A:) (2r)-phospho-3-sulfolactate synthase ComA {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1p0ka_ c.1.4.1 (A:) Isopentenyl-diphosphate delta-isomerase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2a21a1 c.1.10.4 (A:1002-1264) 3-deoxy-D-manno-octulosonate 8-phosphate synthase (KDO8P synthase) {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1sjda1 c.1.11.2 (A:126-367) N-acylamino acid racemase {Amycolatopsis sp. [TaxId: 37632]} Back     information, alignment and structure
>d1q6oa_ c.1.2.3 (A:) 3-keto-L-gulonate 6-phosphate decarboxylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1geqa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1wv2a_ c.1.31.1 (A:) Thiazole biosynthesis protein ThiG {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1jpdx1 c.1.11.2 (X:114-321) L-Ala-D/L-Glu epimerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rd5a_ c.1.2.4 (A:) Trp synthase alpha-subunit {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1ub3a_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1bwva1 c.1.14.1 (A:150-478) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Galdieria partita [TaxId: 83374]} Back     information, alignment and structure
>d1lt7a_ c.1.26.1 (A:) Betaine-homocysteine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1twda_ c.1.30.1 (A:) Copper homeostasis protein CutC {Shigella flexneri [TaxId: 623]} Back     information, alignment and structure
>d1ykwa1 c.1.14.1 (A:146-428) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1juba_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Lactococcus lactis, isozyme A [TaxId: 1358]} Back     information, alignment and structure
>d1p0ka_ c.1.4.1 (A:) Isopentenyl-diphosphate delta-isomerase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1xkya1 c.1.10.1 (A:1-292) Dihydrodipicolinate synthase {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
>d1zfja1 c.1.5.1 (A:2-94,A:221-492) Inosine monophosphate dehydrogenase (IMPDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1gqna_ c.1.10.1 (A:) Type I 3-dehydroquinate dehydratase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1h5ya_ c.1.2.1 (A:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1mzha_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1n7ka_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2tpsa_ c.1.3.1 (A:) Thiamin phosphate synthase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vhca_ c.1.10.1 (A:) Hypothetical protein HI0047 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1a53a_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1ep3a_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Lactococcus lactis, isozyme B [TaxId: 1358]} Back     information, alignment and structure
>d1tx2a_ c.1.21.1 (A:) Dihydropteroate synthetase {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
>d1qapa1 c.1.17.1 (A:130-296) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1hl2a_ c.1.10.1 (A:) N-acetylneuraminate lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1eyea_ c.1.21.1 (A:) Dihydropteroate synthetase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1r6wa1 c.1.11.2 (A:100-320) O-succinylbenzoate synthase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vcfa1 c.1.4.1 (A:23-332) Isopentenyl-diphosphate delta-isomerase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1dosa_ c.1.10.2 (A:) Fructose-bisphosphate aldolase (FBP aldolase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ep3a_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Lactococcus lactis, isozyme B [TaxId: 1358]} Back     information, alignment and structure