Citrus Sinensis ID: 012817
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 456 | ||||||
| 224103999 | 458 | predicted protein [Populus trichocarpa] | 0.986 | 0.982 | 0.811 | 0.0 | |
| 296082668 | 461 | unnamed protein product [Vitis vinifera] | 0.993 | 0.982 | 0.827 | 0.0 | |
| 359494464 | 463 | PREDICTED: translation initiation factor | 0.993 | 0.978 | 0.827 | 0.0 | |
| 356525249 | 459 | PREDICTED: translation initiation factor | 0.989 | 0.982 | 0.783 | 0.0 | |
| 356512489 | 468 | PREDICTED: translation initiation factor | 0.995 | 0.970 | 0.758 | 0.0 | |
| 449452670 | 461 | PREDICTED: translation initiation factor | 0.993 | 0.982 | 0.771 | 0.0 | |
| 357518837 | 565 | Translation initiation factor eIF-2B sub | 0.982 | 0.792 | 0.771 | 0.0 | |
| 224059672 | 508 | predicted protein [Populus trichocarpa] | 0.986 | 0.885 | 0.736 | 0.0 | |
| 79328173 | 456 | translation initiation factor eIF-2B gam | 0.986 | 0.986 | 0.732 | 0.0 | |
| 297812131 | 456 | acyltransferase [Arabidopsis lyrata subs | 0.986 | 0.986 | 0.732 | 0.0 |
| >gi|224103999|ref|XP_002313277.1| predicted protein [Populus trichocarpa] gi|222849685|gb|EEE87232.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 773 bits (1997), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 375/462 (81%), Positives = 414/462 (89%), Gaps = 12/462 (2%)
Query: 1 MDFQVVVLAGGTSKKLVPLVSKEVPKALLPVANRPVLSYVLEQLELSNIKDLIVVVEGAD 60
MDFQVVVLAGGT KKL+PLVSK+VPKALLPVANRPVLSYVLEQLELSN+KDLIVVVEG D
Sbjct: 1 MDFQVVVLAGGTCKKLLPLVSKDVPKALLPVANRPVLSYVLEQLELSNLKDLIVVVEGED 60
Query: 61 AALRVGGWISAAYVDRLHVEVATVPEDVGTAGALRAIAHHLTAKDVLVVSGDLVSDVPPG 120
AAL VGGWIS AYVDRLHVEVA VPEDVGTAGALRAIAHHLTA D+LVVSGDLVSD+PPG
Sbjct: 61 AALHVGGWISNAYVDRLHVEVAAVPEDVGTAGALRAIAHHLTANDILVVSGDLVSDIPPG 120
Query: 121 AVTAAHRRHDAVVTAMICSVPVSGLSEAGSSGAKDKTKKPGRYNIIGMDPTKQFLLHIAT 180
A+ A HR+HDAVVT M+CS PVSG +E+GSSG KDK KKP R+NIIG+DP+KQFLLHIAT
Sbjct: 121 ALAAVHRQHDAVVTTMLCSAPVSGPTESGSSGGKDKIKKPRRHNIIGLDPSKQFLLHIAT 180
Query: 181 GAELEKDTRIRKSILRAVGQMDIRADLMDAHMYAFNRSVLQEVLDQKDKFQSLKQDVLPY 240
GAE+EK+ RI+KSILRAV QM+IRADLMDAHMYAF RSVLQEVLD+KDKF+SLK+D+LPY
Sbjct: 181 GAEVEKEIRIQKSILRAVDQMEIRADLMDAHMYAFKRSVLQEVLDEKDKFRSLKEDMLPY 240
Query: 241 LVRSQLKSEILINGAPQGQQAKENGNDKVS--------YRILANASTPSFHELYALGPNG 292
LVRSQ+KSE+L+NGAPQ + NGN+KVS RIL NASTPSFH+LYA N
Sbjct: 241 LVRSQMKSEVLLNGAPQAK----NGNEKVSSQNNQAVVSRILTNASTPSFHDLYASSNND 296
Query: 293 SAPVRRTHKCCVYIASNSKYCVRLNSIQAFMDINRDVIGEANHLSGYNFSAQNNIIHPSA 352
S+ VRR HKCC YIAS S+YC RLNSIQAF DINRDVIG+A+HLSGY+FS+ NNIIHPSA
Sbjct: 297 SSLVRRIHKCCAYIASESRYCQRLNSIQAFSDINRDVIGDASHLSGYSFSSHNNIIHPSA 356
Query: 353 ELGSKTTVGPHCMLGEGSQMGDKCSVKRSVIGRHCRIGSNVKVVNSVVMNHVTIGDGCSI 412
+LGS+TTVGPHCML EGSQMGDKCSVKRSVIGRHCRIGSNVKVVNSV+MNHVTIGDGCSI
Sbjct: 357 QLGSRTTVGPHCMLWEGSQMGDKCSVKRSVIGRHCRIGSNVKVVNSVIMNHVTIGDGCSI 416
Query: 413 QGSVICSNAQLQERVALKDCQVGQGYVVSAGCEYKGESLARK 454
QGSVICSNAQLQER LKDCQVG G+VV+AG E+KGESLARK
Sbjct: 417 QGSVICSNAQLQERAVLKDCQVGAGFVVTAGSEHKGESLARK 458
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|296082668|emb|CBI21673.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359494464|ref|XP_002266884.2| PREDICTED: translation initiation factor eIF-2B subunit gamma [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356525249|ref|XP_003531239.1| PREDICTED: translation initiation factor eIF-2B subunit gamma-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356512489|ref|XP_003524951.1| PREDICTED: translation initiation factor eIF-2B subunit gamma-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449452670|ref|XP_004144082.1| PREDICTED: translation initiation factor eIF-2B subunit gamma-like [Cucumis sativus] gi|449493530|ref|XP_004159334.1| PREDICTED: translation initiation factor eIF-2B subunit gamma-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|357518837|ref|XP_003629707.1| Translation initiation factor eIF-2B subunit gamma [Medicago truncatula] gi|355523729|gb|AET04183.1| Translation initiation factor eIF-2B subunit gamma [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|224059672|ref|XP_002299963.1| predicted protein [Populus trichocarpa] gi|222847221|gb|EEE84768.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|79328173|ref|NP_001031908.1| translation initiation factor eIF-2B gamma subunit [Arabidopsis thaliana] gi|98961849|gb|ABF59254.1| unknown protein [Arabidopsis thaliana] gi|332005333|gb|AED92716.1| translation initiation factor eIF-2B gamma subunit [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297812131|ref|XP_002873949.1| acyltransferase [Arabidopsis lyrata subsp. lyrata] gi|297319786|gb|EFH50208.1| acyltransferase [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 456 | ||||||
| TAIR|locus:1009023495 | 456 | AT5G19485 [Arabidopsis thalian | 0.984 | 0.984 | 0.698 | 6.2e-165 | |
| UNIPROTKB|F1P4Z9 | 437 | EIF2B3 "Uncharacterized protei | 0.910 | 0.949 | 0.293 | 2.2e-41 | |
| DICTYBASE|DDB_G0290693 | 440 | eif2b3 "eukaryotic translation | 0.896 | 0.929 | 0.270 | 2.8e-41 | |
| UNIPROTKB|Q4R6T3 | 452 | EIF2B3 "Translation initiation | 0.953 | 0.962 | 0.289 | 3.6e-41 | |
| UNIPROTKB|Q9NR50 | 452 | EIF2B3 "Translation initiation | 0.953 | 0.962 | 0.285 | 6.8e-40 | |
| RGD|620821 | 452 | Eif2b3 "eukaryotic translation | 0.953 | 0.962 | 0.285 | 8.7e-40 | |
| UNIPROTKB|P70541 | 452 | Eif2b3 "Translation initiation | 0.953 | 0.962 | 0.285 | 8.7e-40 | |
| UNIPROTKB|A5PJI7 | 452 | EIF2B3 "Translation initiation | 0.925 | 0.933 | 0.279 | 6.1e-39 | |
| UNIPROTKB|F1NBJ8 | 418 | EIF2B3 "Uncharacterized protei | 0.883 | 0.964 | 0.290 | 3.4e-38 | |
| UNIPROTKB|E2RBJ1 | 452 | EIF2B3 "Uncharacterized protei | 0.953 | 0.962 | 0.268 | 1.9e-37 |
| TAIR|locus:1009023495 AT5G19485 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1605 (570.0 bits), Expect = 6.2e-165, P = 6.2e-165
Identities = 322/461 (69%), Positives = 367/461 (79%)
Query: 1 MDFQVVVLAGGTSKKLVPLVSKEVPKALLPVANRPVLSYVLEQLELSNIKDLIVVVEGAD 60
MDFQVV+LAGG S LVPLV+KEVPKALLPVANRPVLSYVL+ LE SN+KDLIVVVEG D
Sbjct: 1 MDFQVVILAGGFSSYLVPLVAKEVPKALLPVANRPVLSYVLDLLESSNLKDLIVVVEGED 60
Query: 61 AALRVGGWISAAYVDRLHVEVATVPEDVGTAGALRAIAHHLTAKXXXXXXXXXXXXXPPG 120
AAL+VGGWIS+A VDRLHVEVA V E+VGTAGALRAIAHHLTAK PPG
Sbjct: 61 AALKVGGWISSACVDRLHVEVAAVAENVGTAGALRAIAHHLTAKDILIVSGDIVSDIPPG 120
Query: 121 AVTAAHRRHDAVVTAMICSVPVSGLSEAGSSGAKDKTKKPGRYNIIGMDPTKQFLLHIAT 180
AV A HRRHDA VT M+C+ PVSG SE+G SG KDKTKKP +IIG+D KQFLL+IA
Sbjct: 121 AVAATHRRHDAAVTVMLCAQPVSGPSESGGSGGKDKTKKPACDDIIGLDSLKQFLLYIAK 180
Query: 181 GAELEKDTRIRKSILRAVGQMDIRADLMDAHMYAFNRSVLQEVLDQKDKFQSLKQDVLPY 240
G E++KDTR++KSIL A G+M+IR+DLMD+H+YAF R+VLQEVLDQK F+SLKQDVLPY
Sbjct: 181 GTEIKKDTRVKKSILCAAGKMEIRSDLMDSHIYAFKRAVLQEVLDQKPAFRSLKQDVLPY 240
Query: 241 LVRSQLKSEILI-------NGAPQGQQAKENGNDKVSYRILANASTPSFHELYALGPNGS 293
LVR+QL+S++ NG G+ +N N+ V +IL+NAS PSFH++Y G
Sbjct: 241 LVRTQLRSDVFSDQSNVEENGNGNGKNNMQN-NEVVLSQILSNASMPSFHQVYESGLG-- 297
Query: 294 APVRRTHKCCVYIASNSKYCVRLNSIQAFMDINRDVIGEANHLSGYNFSAQNNIIHPSAE 353
R+THKCCVYIA SKY VRLNSIQAFMD+NRDVIGE+NHLSGY+FSA +NI+HPSAE
Sbjct: 298 --TRKTHKCCVYIADESKYFVRLNSIQAFMDVNRDVIGESNHLSGYSFSAHHNIVHPSAE 355
Query: 354 LGSKTTVGPHCMLGEGSQMGDKCSVKRSVIGRHCRIGSXXXXXXXXXXXXXTIGDGCSIQ 413
LGSKTTVGPHCMLGEGSQ+GDKCSVKRSVIGRHCRIGS TIGDGCSIQ
Sbjct: 356 LGSKTTVGPHCMLGEGSQVGDKCSVKRSVIGRHCRIGSNVKIVNSVVMDHATIGDGCSIQ 415
Query: 414 GSVICSNAQLQERVALKDCQVGQGYVVSAGCEYKGESLARK 454
GSVICSNAQLQERV L+DCQV GYVV AG E+KGE+ ARK
Sbjct: 416 GSVICSNAQLQERVTLRDCQVEAGYVVCAGSEHKGETFARK 456
|
|
| UNIPROTKB|F1P4Z9 EIF2B3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0290693 eif2b3 "eukaryotic translation initiation factor 2B, subunit 3 gamma" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q4R6T3 EIF2B3 "Translation initiation factor eIF-2B subunit gamma" [Macaca fascicularis (taxid:9541)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9NR50 EIF2B3 "Translation initiation factor eIF-2B subunit gamma" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| RGD|620821 Eif2b3 "eukaryotic translation initiation factor 2B, subunit 3" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P70541 Eif2b3 "Translation initiation factor eIF-2B subunit gamma" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A5PJI7 EIF2B3 "Translation initiation factor eIF-2B subunit gamma" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NBJ8 EIF2B3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RBJ1 EIF2B3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| estExt_fgenesh4_pg.C_LG_IX0932 | hypothetical protein (458 aa) | ||||||||||
(Populus trichocarpa) | |||||||||||
| grail3.0022009302 | • | • | 0.820 | ||||||||
| estExt_fgenesh4_pm.C_LG_VIII0284 | • | • | 0.819 | ||||||||
| eugene3.00030772 | • | 0.816 | |||||||||
| estExt_Genewise1_v1.C_290097 | • | 0.816 | |||||||||
| estExt_fgenesh4_pm.C_LG_XIII0470 | • | • | 0.810 | ||||||||
| fgenesh4_pg.C_scaffold_1866000002 | • | 0.800 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 456 | |||
| cd04198 | 214 | cd04198, eIF-2B_gamma_N, The N-terminal domain of | 1e-64 | |
| cd02507 | 216 | cd02507, eIF-2B_gamma_N_like, The N-terminal of eI | 1e-49 | |
| cd04652 | 81 | cd04652, LbH_eIF2B_gamma_C, eIF-2B gamma subunit, | 2e-34 | |
| COG1208 | 358 | COG1208, GCD1, Nucleoside-diphosphate-sugar pyroph | 2e-32 | |
| cd04181 | 217 | cd04181, NTP_transferase, NTP_transferases catalyz | 5e-25 | |
| cd03356 | 79 | cd03356, LbH_G1P_AT_C_like, Left-handed parallel b | 7e-21 | |
| cd05787 | 79 | cd05787, LbH_eIF2B_epsilon, eIF-2B epsilon subunit | 7e-20 | |
| cd06915 | 223 | cd06915, NTP_transferase_WcbM_like, WcbM_like is a | 1e-18 | |
| cd04197 | 217 | cd04197, eIF-2B_epsilon_N, The N-terminal domain o | 7e-16 | |
| pfam00483 | 247 | pfam00483, NTP_transferase, Nucleotidyl transferas | 5e-14 | |
| COG1208 | 358 | COG1208, GCD1, Nucleoside-diphosphate-sugar pyroph | 3e-13 | |
| TIGR03992 | 393 | TIGR03992, Arch_glmU, UDP-N-acetylglucosamine diph | 1e-12 | |
| cd06422 | 221 | cd06422, NTP_transferase_like_1, NTP_transferase_l | 2e-11 | |
| COG1209 | 286 | COG1209, RfbA, dTDP-glucose pyrophosphorylase [Cel | 4e-11 | |
| PRK00892 | 343 | PRK00892, lpxD, UDP-3-O-[3-hydroxymyristoyl] gluco | 7e-11 | |
| cd06425 | 233 | cd06425, M1P_guanylylT_B_like_N, N-terminal domain | 8e-11 | |
| cd04651 | 104 | cd04651, LbH_G1P_AT_C, Glucose-1-phosphate adenyly | 3e-10 | |
| cd06426 | 220 | cd06426, NTP_transferase_like_2, NTP_trnasferase_l | 4e-10 | |
| TIGR02091 | 361 | TIGR02091, glgC, glucose-1-phosphate adenylyltrans | 5e-10 | |
| cd03356 | 79 | cd03356, LbH_G1P_AT_C_like, Left-handed parallel b | 3e-09 | |
| cd04189 | 236 | cd04189, G1P_TT_long, G1P_TT_long represents the l | 6e-09 | |
| COG0448 | 393 | COG0448, GlgC, ADP-glucose pyrophosphorylase [Carb | 8e-09 | |
| cd03352 | 205 | cd03352, LbH_LpxD, UDP-3-O-acyl-glucosamine N-acyl | 1e-08 | |
| cd06428 | 257 | cd06428, M1P_guanylylT_A_like_N, N-terminal domain | 1e-08 | |
| TIGR01173 | 451 | TIGR01173, glmU, UDP-N-acetylglucosamine diphospho | 2e-08 | |
| COG1207 | 460 | COG1207, GlmU, N-acetylglucosamine-1-phosphate uri | 4e-08 | |
| PRK05293 | 380 | PRK05293, glgC, glucose-1-phosphate adenylyltransf | 4e-08 | |
| TIGR03570 | 193 | TIGR03570, NeuD_NnaD, sugar O-acyltransferase, sia | 5e-08 | |
| cd03360 | 197 | cd03360, LbH_AT_putative, Putative Acyltransferase | 5e-08 | |
| PRK05289 | 262 | PRK05289, PRK05289, UDP-N-acetylglucosamine acyltr | 5e-08 | |
| COG1044 | 338 | COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl] | 1e-07 | |
| cd03351 | 254 | cd03351, LbH_UDP-GlcNAc_AT, UDP-N-acetylglucosamin | 1e-07 | |
| pfam12804 | 178 | pfam12804, NTP_transf_3, MobA-like NTP transferase | 2e-07 | |
| cd02523 | 229 | cd02523, PC_cytidylyltransferase, Phosphocholine c | 2e-07 | |
| cd02540 | 229 | cd02540, GT2_GlmU_N_bac, N-terminal domain of bact | 5e-07 | |
| PRK14353 | 446 | PRK14353, glmU, bifunctional N-acetylglucosamine-1 | 7e-07 | |
| PRK14354 | 458 | PRK14354, glmU, bifunctional N-acetylglucosamine-1 | 2e-06 | |
| COG4750 | 231 | COG4750, LicC, CTP:phosphocholine cytidylyltransfe | 2e-06 | |
| PRK14360 | 450 | PRK14360, glmU, bifunctional N-acetylglucosamine-1 | 2e-06 | |
| PRK12461 | 255 | PRK12461, PRK12461, UDP-N-acetylglucosamine acyltr | 2e-06 | |
| COG1213 | 239 | COG1213, COG1213, Predicted sugar nucleotidyltrans | 3e-06 | |
| TIGR01852 | 254 | TIGR01852, lipid_A_lpxA, acyl-[acyl-carrier-protei | 3e-06 | |
| COG0746 | 192 | COG0746, MobA, Molybdopterin-guanine dinucleotide | 4e-06 | |
| cd04651 | 104 | cd04651, LbH_G1P_AT_C, Glucose-1-phosphate adenyly | 6e-06 | |
| COG1044 | 338 | COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl] | 6e-06 | |
| cd02538 | 240 | cd02538, G1P_TT_short, G1P_TT_short is the short f | 6e-06 | |
| COG1208 | 358 | COG1208, GCD1, Nucleoside-diphosphate-sugar pyroph | 7e-06 | |
| PRK14354 | 458 | PRK14354, glmU, bifunctional N-acetylglucosamine-1 | 7e-06 | |
| cd02503 | 181 | cd02503, MobA, MobA catalyzes the formation of mol | 7e-06 | |
| PRK02862 | 429 | PRK02862, glgC, glucose-1-phosphate adenylyltransf | 8e-06 | |
| PRK14355 | 459 | PRK14355, glmU, bifunctional N-acetylglucosamine-1 | 8e-06 | |
| cd02516 | 218 | cd02516, CDP-ME_synthetase, CDP-ME synthetase is i | 1e-05 | |
| TIGR01853 | 324 | TIGR01853, lipid_A_lpxD, UDP-3-O-[3-hydroxymyristo | 1e-05 | |
| COG1044 | 338 | COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl] | 2e-05 | |
| PRK00844 | 407 | PRK00844, glgC, glucose-1-phosphate adenylyltransf | 2e-05 | |
| TIGR01208 | 353 | TIGR01208, rmlA_long, glucose-1-phosphate thymidyl | 3e-05 | |
| PRK15480 | 292 | PRK15480, PRK15480, glucose-1-phosphate thymidylyl | 3e-05 | |
| cd03353 | 193 | cd03353, LbH_GlmU_C, N-acetyl-glucosamine-1-phosph | 3e-05 | |
| cd03358 | 119 | cd03358, LbH_WxcM_N_like, WcxM-like, Left-handed p | 4e-05 | |
| TIGR01207 | 286 | TIGR01207, rmlA, glucose-1-phosphate thymidylyltra | 6e-05 | |
| cd04182 | 186 | cd04182, GT_2_like_f, GT_2_like_f is a subfamily o | 6e-05 | |
| TIGR01853 | 324 | TIGR01853, lipid_A_lpxD, UDP-3-O-[3-hydroxymyristo | 7e-05 | |
| TIGR02623 | 254 | TIGR02623, G1P_cyt_trans, glucose-1-phosphate cyti | 9e-05 | |
| PRK14354 | 458 | PRK14354, glmU, bifunctional N-acetylglucosamine-1 | 1e-04 | |
| cd02541 | 267 | cd02541, UGPase_prokaryotic, Prokaryotic UGPase ca | 1e-04 | |
| cd04651 | 104 | cd04651, LbH_G1P_AT_C, Glucose-1-phosphate adenyly | 2e-04 | |
| COG1207 | 460 | COG1207, GlmU, N-acetylglucosamine-1-phosphate uri | 2e-04 | |
| COG1210 | 291 | COG1210, GalU, UDP-glucose pyrophosphorylase [Cell | 2e-04 | |
| cd05824 | 80 | cd05824, LbH_M1P_guanylylT_C, Mannose-1-phosphate | 2e-04 | |
| TIGR00453 | 217 | TIGR00453, ispD, 2-C-methyl-D-erythritol 4-phospha | 2e-04 | |
| COG1043 | 260 | COG1043, LpxA, Acyl-[acyl carrier protein] | 2e-04 | |
| cd05636 | 163 | cd05636, LbH_G1P_TT_C_like, Putative glucose-1-pho | 2e-04 | |
| cd03358 | 119 | cd03358, LbH_WxcM_N_like, WcxM-like, Left-handed p | 4e-04 | |
| TIGR03992 | 393 | TIGR03992, Arch_glmU, UDP-N-acetylglucosamine diph | 5e-04 | |
| PRK00155 | 227 | PRK00155, ispD, 2-C-methyl-D-erythritol 4-phosphat | 5e-04 | |
| COG1211 | 230 | COG1211, IspD, 4-diphosphocytidyl-2-methyl-D-erith | 5e-04 | |
| PRK09382 | 378 | PRK09382, ispDF, bifunctional 2-C-methyl-D-erythri | 6e-04 | |
| cd04647 | 109 | cd04647, LbH_MAT_like, Maltose O-acyltransferase ( | 7e-04 | |
| PRK14358 | 481 | PRK14358, glmU, bifunctional N-acetylglucosamine-1 | 7e-04 | |
| COG0110 | 190 | COG0110, WbbJ, Acetyltransferase (isoleucine patch | 8e-04 | |
| COG1044 | 338 | COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl] | 9e-04 | |
| PRK00725 | 425 | PRK00725, glgC, glucose-1-phosphate adenylyltransf | 9e-04 | |
| PRK14357 | 448 | PRK14357, glmU, bifunctional N-acetylglucosamine-1 | 9e-04 | |
| cd05824 | 80 | cd05824, LbH_M1P_guanylylT_C, Mannose-1-phosphate | 0.001 | |
| TIGR01105 | 297 | TIGR01105, galF, UTP-glucose-1-phosphate uridylylt | 0.001 | |
| COG2068 | 199 | COG2068, COG2068, Uncharacterized MobA-related pro | 0.001 | |
| TIGR01173 | 451 | TIGR01173, glmU, UDP-N-acetylglucosamine diphospho | 0.002 | |
| pfam00132 | 36 | pfam00132, Hexapep, Bacterial transferase hexapept | 0.002 | |
| cd04645 | 153 | cd04645, LbH_gamma_CA_like, Gamma carbonic anhydra | 0.002 | |
| PLN02241 | 436 | PLN02241, PLN02241, glucose-1-phosphate adenylyltr | 0.004 |
| >gnl|CDD|133041 cd04198, eIF-2B_gamma_N, The N-terminal domain of gamma subunit of the eIF-2B is a subfamily of glycosyltransferase 2 | Back alignment and domain information |
|---|
Score = 207 bits (528), Expect = 1e-64
Identities = 86/220 (39%), Positives = 126/220 (57%), Gaps = 8/220 (3%)
Query: 3 FQVVVLAGGTSKKLVPLVSKEVPKALLPVANRPVLSYVLEQLELSNIKDLIVVVEGADAA 62
FQ V+LAGG +L PL +PKALLPVAN+P++ Y L+ LE + +D+IVVV + A
Sbjct: 1 FQAVILAGGGGSRLYPLTDN-IPKALLPVANKPMIWYPLDWLEKAGFEDVIVVVPEEEQA 59
Query: 63 LRVGGWISA--AYVDRLHVEVATVPEDVGTAGALRAIAHHLTAKDVLVVSGDLVSDVPPG 120
S +L + ED+GTA +LR I + KD LV+S DL++D+P
Sbjct: 60 EISTYLRSFPLNLKQKLDEVTIVLDEDMGTADSLRHIRKKIK-KDFLVLSCDLITDLPLI 118
Query: 121 AVTAAHRRHDAVVTAMICSVPVSGLSEAGSSGAKDKTKKPGRYNIIGMDPTKQFLLHIAT 180
+ HR HDA +T ++ PVS + G K K+KK ++IG+D Q LL I +
Sbjct: 119 ELVDLHRSHDASLTVLLYPPPVSSEQK----GGKGKSKKADERDVIGLDEKTQRLLFITS 174
Query: 181 GAELEKDTRIRKSILRAVGQMDIRADLMDAHMYAFNRSVL 220
+L++D +RKS+L+ ++ I L+DAH+Y F R VL
Sbjct: 175 EEDLDEDLELRKSLLKRHPRVTITTKLLDAHVYIFKRWVL 214
|
N-terminal domain of gamma subunit of the eukaryotic translation initiation factor 2B (eIF-2B): eIF-2B is a guanine nucleotide-exchange factor which mediates the exchange of GDP (bound to initiation factor eIF2) for GTP, generating active eIF2.GTP complex. EIF2B is a complex multimeric protein consisting of five subunits named alpha, beta, gamma, delta and epsilon. Subunit gamma shares sequence similarity with epsilon subunit, and with a family of bifunctional nucleotide-binding enzymes such as ADP-glucose pyrophosphorylase, suggesting that epsilon subunit may play roles in nucleotide binding activity. In yeast, eIF2B gamma enhances the activity of eIF2B-epsilon leading to the idea that these subunits form the catalytic subcomplex. Length = 214 |
| >gnl|CDD|133001 cd02507, eIF-2B_gamma_N_like, The N-terminal of eIF-2B_gamma_like is predicted to have glycosyltransferase activity | Back alignment and domain information |
|---|
| >gnl|CDD|100057 cd04652, LbH_eIF2B_gamma_C, eIF-2B gamma subunit, C-terminal Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) | Back alignment and domain information |
|---|
| >gnl|CDD|224129 COG1208, GCD1, Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis, outer membrane / Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|133024 cd04181, NTP_transferase, NTP_transferases catalyze the transfer of nucleotides onto phosphosugars | Back alignment and domain information |
|---|
| >gnl|CDD|100046 cd03356, LbH_G1P_AT_C_like, Left-handed parallel beta-Helix (LbH) domain of a group of proteins with similarity to glucose-1-phosphate adenylyltransferase: Included in this family are glucose-1-phosphate adenylyltransferase, mannose-1-phosphate guanylyltransferase, and the eukaryotic translation initiation factor eIF-2B subunits, epsilon and gamma | Back alignment and domain information |
|---|
| >gnl|CDD|100061 cd05787, LbH_eIF2B_epsilon, eIF-2B epsilon subunit, central Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) | Back alignment and domain information |
|---|
| >gnl|CDD|133065 cd06915, NTP_transferase_WcbM_like, WcbM_like is a subfamily of nucleotidyl transferases | Back alignment and domain information |
|---|
| >gnl|CDD|133040 cd04197, eIF-2B_epsilon_N, The N-terminal domain of epsilon subunit of the eIF-2B is a subfamily of glycosyltransferase 2 | Back alignment and domain information |
|---|
| >gnl|CDD|215940 pfam00483, NTP_transferase, Nucleotidyl transferase | Back alignment and domain information |
|---|
| >gnl|CDD|224129 COG1208, GCD1, Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis, outer membrane / Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|234433 TIGR03992, Arch_glmU, UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|133044 cd06422, NTP_transferase_like_1, NTP_transferase_like_1 is a member of the nucleotidyl transferase family | Back alignment and domain information |
|---|
| >gnl|CDD|224130 COG1209, RfbA, dTDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|234858 PRK00892, lpxD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|133047 cd06425, M1P_guanylylT_B_like_N, N-terminal domain of the M1P-guanylyltransferase B-isoform like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|100056 cd04651, LbH_G1P_AT_C, Glucose-1-phosphate adenylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Glucose-1-phosphate adenylyltransferase is also known as ADP-glucose synthase or ADP-glucose pyrophosphorylase | Back alignment and domain information |
|---|
| >gnl|CDD|133048 cd06426, NTP_transferase_like_2, NTP_trnasferase_like_2 is a member of the nucleotidyl transferase family | Back alignment and domain information |
|---|
| >gnl|CDD|233720 TIGR02091, glgC, glucose-1-phosphate adenylyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|100046 cd03356, LbH_G1P_AT_C_like, Left-handed parallel beta-Helix (LbH) domain of a group of proteins with similarity to glucose-1-phosphate adenylyltransferase: Included in this family are glucose-1-phosphate adenylyltransferase, mannose-1-phosphate guanylyltransferase, and the eukaryotic translation initiation factor eIF-2B subunits, epsilon and gamma | Back alignment and domain information |
|---|
| >gnl|CDD|133032 cd04189, G1P_TT_long, G1P_TT_long represents the long form of glucose-1-phosphate thymidylyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|223525 COG0448, GlgC, ADP-glucose pyrophosphorylase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|100043 cd03352, LbH_LpxD, UDP-3-O-acyl-glucosamine N-acyltransferase (LpxD): The enzyme catalyzes the transfer of 3-hydroxymyristic acid or 3-hydroxy-arachidic acid, depending on the organism, from the acyl carrier protein (ACP) to UDP-3-O-acyl-glucosamine to produce UDP-2,3-diacyl-GlcNAc | Back alignment and domain information |
|---|
| >gnl|CDD|133050 cd06428, M1P_guanylylT_A_like_N, N-terminal domain of M1P_guanylyl_A_ like proteins are likely to be a isoform of GDP-mannose pyrophosphorylase | Back alignment and domain information |
|---|
| >gnl|CDD|233299 TIGR01173, glmU, UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|224128 COG1207, GlmU, N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|179997 PRK05293, glgC, glucose-1-phosphate adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234265 TIGR03570, NeuD_NnaD, sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family | Back alignment and domain information |
|---|
| >gnl|CDD|100050 cd03360, LbH_AT_putative, Putative Acyltransferase (AT), Left-handed parallel beta-Helix (LbH) domain; This group is composed of mostly uncharacterized proteins containing an N-terminal helical subdomain followed by a LbH domain | Back alignment and domain information |
|---|
| >gnl|CDD|235390 PRK05289, PRK05289, UDP-N-acetylglucosamine acyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223974 COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl] | Back alignment and domain information |
|---|
| >gnl|CDD|100042 cd03351, LbH_UDP-GlcNAc_AT, UDP-N-acetylglucosamine O-acyltransferase (UDP-GlcNAc acyltransferase): Proteins in this family catalyze the transfer of (R)-3-hydroxymyristic acid from its acyl carrier protein thioester to UDP-GlcNAc | Back alignment and domain information |
|---|
| >gnl|CDD|221780 pfam12804, NTP_transf_3, MobA-like NTP transferase domain | Back alignment and domain information |
|---|
| >gnl|CDD|133014 cd02523, PC_cytidylyltransferase, Phosphocholine cytidylyltransferases catalyze the synthesis of CDP-choline | Back alignment and domain information |
|---|
| >gnl|CDD|133020 cd02540, GT2_GlmU_N_bac, N-terminal domain of bacterial GlmU | Back alignment and domain information |
|---|
| >gnl|CDD|184642 PRK14353, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184643 PRK14354, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227093 COG4750, LicC, CTP:phosphocholine cytidylyltransferase involved in choline phosphorylation for cell surface LPS epitopes [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|184646 PRK14360, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183539 PRK12461, PRK12461, UDP-N-acetylglucosamine acyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224134 COG1213, COG1213, Predicted sugar nucleotidyltransferases [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|188173 TIGR01852, lipid_A_lpxA, acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|223817 COG0746, MobA, Molybdopterin-guanine dinucleotide biosynthesis protein A [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|100056 cd04651, LbH_G1P_AT_C, Glucose-1-phosphate adenylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Glucose-1-phosphate adenylyltransferase is also known as ADP-glucose synthase or ADP-glucose pyrophosphorylase | Back alignment and domain information |
|---|
| >gnl|CDD|223974 COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl] | Back alignment and domain information |
|---|
| >gnl|CDD|133019 cd02538, G1P_TT_short, G1P_TT_short is the short form of glucose-1-phosphate thymidylyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|224129 COG1208, GCD1, Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis, outer membrane / Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|184643 PRK14354, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|133000 cd02503, MobA, MobA catalyzes the formation of molybdopterin guanine dinucleotide | Back alignment and domain information |
|---|
| >gnl|CDD|179486 PRK02862, glgC, glucose-1-phosphate adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237685 PRK14355, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|133009 cd02516, CDP-ME_synthetase, CDP-ME synthetase is involved in mevalonate-independent isoprenoid production | Back alignment and domain information |
|---|
| >gnl|CDD|233599 TIGR01853, lipid_A_lpxD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|223974 COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl] | Back alignment and domain information |
|---|
| >gnl|CDD|234846 PRK00844, glgC, glucose-1-phosphate adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233311 TIGR01208, rmlA_long, glucose-1-phosphate thymidylylransferase, long form | Back alignment and domain information |
|---|
| >gnl|CDD|185377 PRK15480, PRK15480, glucose-1-phosphate thymidylyltransferase RfbA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|100044 cd03353, LbH_GlmU_C, N-acetyl-glucosamine-1-phosphate uridyltransferase (GlmU), C-terminal left-handed beta-helix (LbH) acetyltransferase domain: GlmU is also known as UDP-N-acetylglucosamine pyrophosphorylase | Back alignment and domain information |
|---|
| >gnl|CDD|100048 cd03358, LbH_WxcM_N_like, WcxM-like, Left-handed parallel beta-Helix (LbH) N-terminal domain: This group is composed of Xanthomonas campestris WcxM and proteins with similarity to the WcxM N-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|130274 TIGR01207, rmlA, glucose-1-phosphate thymidylyltransferase, short form | Back alignment and domain information |
|---|
| >gnl|CDD|133025 cd04182, GT_2_like_f, GT_2_like_f is a subfamily of the glycosyltransferase family 2 (GT-2) with unknown function | Back alignment and domain information |
|---|
| >gnl|CDD|233599 TIGR01853, lipid_A_lpxD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|131672 TIGR02623, G1P_cyt_trans, glucose-1-phosphate cytidylyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|184643 PRK14354, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|133021 cd02541, UGPase_prokaryotic, Prokaryotic UGPase catalyses the synthesis of UDP-glucose | Back alignment and domain information |
|---|
| >gnl|CDD|100056 cd04651, LbH_G1P_AT_C, Glucose-1-phosphate adenylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Glucose-1-phosphate adenylyltransferase is also known as ADP-glucose synthase or ADP-glucose pyrophosphorylase | Back alignment and domain information |
|---|
| >gnl|CDD|224128 COG1207, GlmU, N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|224131 COG1210, GalU, UDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|100062 cd05824, LbH_M1P_guanylylT_C, Mannose-1-phosphate guanylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Mannose-1-phosphate guanylyltransferase is also known as GDP-mannose pyrophosphorylase | Back alignment and domain information |
|---|
| >gnl|CDD|213532 TIGR00453, ispD, 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|223973 COG1043, LpxA, Acyl-[acyl carrier protein] | Back alignment and domain information |
|---|
| >gnl|CDD|100060 cd05636, LbH_G1P_TT_C_like, Putative glucose-1-phosphate thymidylyltransferase, C-terminal Left-handed parallel beta-Helix (LbH) domain: Proteins in this family show simlarity to glucose-1-phosphate adenylyltransferases in that they contain N-terminal catalytic domains that resemble a dinucleotide-binding Rossmann fold and C-terminal LbH fold domains | Back alignment and domain information |
|---|
| >gnl|CDD|100048 cd03358, LbH_WxcM_N_like, WcxM-like, Left-handed parallel beta-Helix (LbH) N-terminal domain: This group is composed of Xanthomonas campestris WcxM and proteins with similarity to the WcxM N-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|234433 TIGR03992, Arch_glmU, UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|234670 PRK00155, ispD, 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|224132 COG1211, IspD, 4-diphosphocytidyl-2-methyl-D-erithritol synthase [Lipid metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|236492 PRK09382, ispDF, bifunctional 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase/2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|100053 cd04647, LbH_MAT_like, Maltose O-acyltransferase (MAT)-like: This family is composed of maltose O-acetyltransferase, galactoside O-acetyltransferase (GAT), xenobiotic acyltransferase (XAT) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|237688 PRK14358, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223188 COG0110, WbbJ, Acetyltransferase (isoleucine patch superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|223974 COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl] | Back alignment and domain information |
|---|
| >gnl|CDD|234824 PRK00725, glgC, glucose-1-phosphate adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237687 PRK14357, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|100062 cd05824, LbH_M1P_guanylylT_C, Mannose-1-phosphate guanylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Mannose-1-phosphate guanylyltransferase is also known as GDP-mannose pyrophosphorylase | Back alignment and domain information |
|---|
| >gnl|CDD|130175 TIGR01105, galF, UTP-glucose-1-phosphate uridylyltransferase, non-catalytic GalF subunit | Back alignment and domain information |
|---|
| >gnl|CDD|224979 COG2068, COG2068, Uncharacterized MobA-related protein [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|233299 TIGR01173, glmU, UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|189409 pfam00132, Hexapep, Bacterial transferase hexapeptide (six repeats) | Back alignment and domain information |
|---|
| >gnl|CDD|100051 cd04645, LbH_gamma_CA_like, Gamma carbonic anhydrase-like: This family is composed of gamma carbonic anhydrase (CA), Ferripyochelin Binding Protein (FBP), E | Back alignment and domain information |
|---|
| >gnl|CDD|215133 PLN02241, PLN02241, glucose-1-phosphate adenylyltransferase | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 456 | |||
| KOG1462 | 433 | consensus Translation initiation factor 2B, gamma | 100.0 | |
| COG0448 | 393 | GlgC ADP-glucose pyrophosphorylase [Carbohydrate t | 100.0 | |
| KOG1322 | 371 | consensus GDP-mannose pyrophosphorylase/mannose-1- | 100.0 | |
| COG1208 | 358 | GCD1 Nucleoside-diphosphate-sugar pyrophosphorylas | 100.0 | |
| PRK05293 | 380 | glgC glucose-1-phosphate adenylyltransferase; Prov | 100.0 | |
| KOG1461 | 673 | consensus Translation initiation factor 2B, epsilo | 100.0 | |
| PRK00844 | 407 | glgC glucose-1-phosphate adenylyltransferase; Prov | 100.0 | |
| PRK02862 | 429 | glgC glucose-1-phosphate adenylyltransferase; Prov | 100.0 | |
| PLN02241 | 436 | glucose-1-phosphate adenylyltransferase | 100.0 | |
| PRK00725 | 425 | glgC glucose-1-phosphate adenylyltransferase; Prov | 100.0 | |
| KOG1460 | 407 | consensus GDP-mannose pyrophosphorylase [Carbohydr | 100.0 | |
| TIGR01208 | 353 | rmlA_long glucose-1-phosphate thymidylylransferase | 100.0 | |
| TIGR02091 | 361 | glgC glucose-1-phosphate adenylyltransferase. This | 100.0 | |
| TIGR02092 | 369 | glgD glucose-1-phosphate adenylyltransferase, GlgD | 100.0 | |
| COG1207 | 460 | GlmU N-acetylglucosamine-1-phosphate uridyltransfe | 100.0 | |
| PRK14358 | 481 | glmU bifunctional N-acetylglucosamine-1-phosphate | 100.0 | |
| PRK14355 | 459 | glmU bifunctional N-acetylglucosamine-1-phosphate | 100.0 | |
| PRK14352 | 482 | glmU bifunctional N-acetylglucosamine-1-phosphate | 100.0 | |
| PRK14356 | 456 | glmU bifunctional N-acetylglucosamine-1-phosphate | 100.0 | |
| PRK09451 | 456 | glmU bifunctional N-acetylglucosamine-1-phosphate | 100.0 | |
| TIGR01173 | 451 | glmU UDP-N-acetylglucosamine diphosphorylase/gluco | 100.0 | |
| PRK14353 | 446 | glmU bifunctional N-acetylglucosamine-1-phosphate | 100.0 | |
| PRK14354 | 458 | glmU bifunctional N-acetylglucosamine-1-phosphate | 100.0 | |
| PRK14359 | 430 | glmU bifunctional N-acetylglucosamine-1-phosphate | 100.0 | |
| PRK14357 | 448 | glmU bifunctional N-acetylglucosamine-1-phosphate | 100.0 | |
| PRK14360 | 450 | glmU bifunctional N-acetylglucosamine-1-phosphate | 100.0 | |
| COG1209 | 286 | RfbA dTDP-glucose pyrophosphorylase [Cell envelope | 100.0 | |
| TIGR01105 | 297 | galF UTP-glucose-1-phosphate uridylyltransferase, | 100.0 | |
| PF00483 | 248 | NTP_transferase: Nucleotidyl transferase This Pros | 100.0 | |
| cd06425 | 233 | M1P_guanylylT_B_like_N N-terminal domain of the M1 | 99.97 | |
| cd06428 | 257 | M1P_guanylylT_A_like_N N-terminal domain of M1P_gu | 99.97 | |
| PRK15480 | 292 | glucose-1-phosphate thymidylyltransferase RfbA; Pr | 99.97 | |
| PRK10122 | 297 | GalU regulator GalF; Provisional | 99.97 | |
| cd04198 | 214 | eIF-2B_gamma_N The N-terminal domain of gamma subu | 99.97 | |
| cd02538 | 240 | G1P_TT_short G1P_TT_short is the short form of glu | 99.97 | |
| TIGR01207 | 286 | rmlA glucose-1-phosphate thymidylyltransferase, sh | 99.97 | |
| cd04197 | 217 | eIF-2B_epsilon_N The N-terminal domain of epsilon | 99.97 | |
| TIGR02623 | 254 | G1P_cyt_trans glucose-1-phosphate cytidylyltransfe | 99.97 | |
| cd02541 | 267 | UGPase_prokaryotic Prokaryotic UGPase catalyses th | 99.96 | |
| cd04189 | 236 | G1P_TT_long G1P_TT_long represents the long form o | 99.96 | |
| TIGR01099 | 260 | galU UTP-glucose-1-phosphate uridylyltransferase. | 99.96 | |
| cd06422 | 221 | NTP_transferase_like_1 NTP_transferase_like_1 is a | 99.96 | |
| PRK13389 | 302 | UTP--glucose-1-phosphate uridylyltransferase subun | 99.96 | |
| cd02524 | 253 | G1P_cytidylyltransferase G1P_cytidylyltransferase | 99.95 | |
| cd02507 | 216 | eIF-2B_gamma_N_like The N-terminal of eIF-2B_gamma | 99.95 | |
| cd06426 | 220 | NTP_transferase_like_2 NTP_trnasferase_like_2 is a | 99.95 | |
| cd04181 | 217 | NTP_transferase NTP_transferases catalyze the tran | 99.95 | |
| cd06915 | 223 | NTP_transferase_WcbM_like WcbM_like is a subfamily | 99.95 | |
| cd04183 | 231 | GT2_BcE_like GT2_BcbE_like is likely involved in t | 99.92 | |
| COG1210 | 291 | GalU UDP-glucose pyrophosphorylase [Cell envelope | 99.92 | |
| cd02508 | 200 | ADP_Glucose_PP ADP-glucose pyrophosphorylase is in | 99.91 | |
| cd02509 | 274 | GDP-M1P_Guanylyltransferase GDP-M1P_Guanylyltransf | 99.91 | |
| cd02523 | 229 | PC_cytidylyltransferase Phosphocholine cytidylyltr | 99.91 | |
| TIGR01479 | 468 | GMP_PMI mannose-1-phosphate guanylyltransferase/ma | 99.87 | |
| cd02540 | 229 | GT2_GlmU_N_bac N-terminal domain of bacterial GlmU | 99.87 | |
| COG0836 | 333 | {ManC} Mannose-1-phosphate guanylyltransferase [Ce | 99.83 | |
| cd02517 | 239 | CMP-KDO-Synthetase CMP-KDO synthetase catalyzes th | 99.83 | |
| PRK05450 | 245 | 3-deoxy-manno-octulosonate cytidylyltransferase; P | 99.82 | |
| PRK15460 | 478 | cpsB mannose-1-phosphate guanyltransferase; Provis | 99.79 | |
| PRK13368 | 238 | 3-deoxy-manno-octulosonate cytidylyltransferase; P | 99.79 | |
| COG1213 | 239 | Predicted sugar nucleotidyltransferases [Cell enve | 99.69 | |
| PLN02917 | 293 | CMP-KDO synthetase | 99.66 | |
| TIGR03532 | 231 | DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxyla | 99.65 | |
| cd05636 | 163 | LbH_G1P_TT_C_like Putative glucose-1-phosphate thy | 99.63 | |
| cd05636 | 163 | LbH_G1P_TT_C_like Putative glucose-1-phosphate thy | 99.62 | |
| PF12804 | 160 | NTP_transf_3: MobA-like NTP transferase domain; PD | 99.61 | |
| COG4750 | 231 | LicC CTP:phosphocholine cytidylyltransferase invol | 99.57 | |
| TIGR00454 | 183 | conserved hypothetical protein TIGR00454. At this | 99.56 | |
| cd04745 | 155 | LbH_paaY_like paaY-like: This group is composed by | 99.56 | |
| TIGR02287 | 192 | PaaY phenylacetic acid degradation protein PaaY. M | 99.56 | |
| cd04652 | 81 | LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal | 99.56 | |
| PRK00155 | 227 | ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyl | 99.54 | |
| cd03351 | 254 | LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltr | 99.54 | |
| COG1044 | 338 | LpxD UDP-3-O-[3-hydroxymyristoyl] | 99.54 | |
| PRK13627 | 196 | carnitine operon protein CaiE; Provisional | 99.54 | |
| cd03351 | 254 | LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltr | 99.53 | |
| TIGR00453 | 217 | ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyl | 99.53 | |
| cd03353 | 193 | LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyl | 99.53 | |
| TIGR00466 | 238 | kdsB 3-deoxy-D-manno-octulosonate cytidylyltransfe | 99.53 | |
| TIGR01853 | 324 | lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosam | 99.52 | |
| COG0663 | 176 | PaaY Carbonic anhydrases/acetyltransferases, isole | 99.52 | |
| cd04646 | 164 | LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynact | 99.52 | |
| TIGR01852 | 254 | lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-ac | 99.51 | |
| TIGR01852 | 254 | lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-ac | 99.5 | |
| cd02516 | 218 | CDP-ME_synthetase CDP-ME synthetase is involved in | 99.49 | |
| cd04652 | 81 | LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal | 99.49 | |
| PLN02296 | 269 | carbonate dehydratase | 99.49 | |
| COG1044 | 338 | LpxD UDP-3-O-[3-hydroxymyristoyl] | 99.49 | |
| cd00710 | 167 | LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbo | 99.48 | |
| cd00710 | 167 | LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbo | 99.48 | |
| PRK05289 | 262 | UDP-N-acetylglucosamine acyltransferase; Provision | 99.48 | |
| cd04650 | 154 | LbH_FBP Ferripyochelin Binding Protein (FBP): FBP | 99.47 | |
| cd03356 | 79 | LbH_G1P_AT_C_like Left-handed parallel beta-Helix | 99.47 | |
| cd04182 | 186 | GT_2_like_f GT_2_like_f is a subfamily of the glyc | 99.46 | |
| PRK00892 | 343 | lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-ac | 99.46 | |
| cd03353 | 193 | LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyl | 99.45 | |
| cd04645 | 153 | LbH_gamma_CA_like Gamma carbonic anhydrase-like: T | 99.45 | |
| cd05824 | 80 | LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltr | 99.45 | |
| PRK05289 | 262 | UDP-N-acetylglucosamine acyltransferase; Provision | 99.44 | |
| PLN02472 | 246 | uncharacterized protein | 99.44 | |
| TIGR03308 | 204 | phn_thr-fam phosphonate metabolim protein, transfe | 99.44 | |
| PRK09382 | 378 | ispDF bifunctional 2-C-methyl-D-erythritol 4-phosp | 99.44 | |
| TIGR03310 | 188 | matur_ygfJ molybdenum hydroxylase accessory protei | 99.44 | |
| PRK14353 | 446 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.43 | |
| COG2266 | 177 | GTP:adenosylcobinamide-phosphate guanylyltransfera | 99.43 | |
| PRK00892 | 343 | lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-ac | 99.43 | |
| cd04651 | 104 | LbH_G1P_AT_C Glucose-1-phosphate adenylyltransfera | 99.43 | |
| PRK13385 | 230 | 2-C-methyl-D-erythritol 4-phosphate cytidylyltrans | 99.42 | |
| cd04745 | 155 | LbH_paaY_like paaY-like: This group is composed by | 99.42 | |
| cd05787 | 79 | LbH_eIF2B_epsilon eIF-2B epsilon subunit, central | 99.42 | |
| PRK12461 | 255 | UDP-N-acetylglucosamine acyltransferase; Provision | 99.42 | |
| cd02513 | 223 | CMP-NeuAc_Synthase CMP-NeuAc_Synthase activates N- | 99.42 | |
| cd04646 | 164 | LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynact | 99.42 | |
| TIGR01853 | 324 | lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosam | 99.41 | |
| cd03356 | 79 | LbH_G1P_AT_C_like Left-handed parallel beta-Helix | 99.4 | |
| COG1212 | 247 | KdsB CMP-2-keto-3-deoxyoctulosonic acid synthetase | 99.4 | |
| PRK12461 | 255 | UDP-N-acetylglucosamine acyltransferase; Provision | 99.39 | |
| cd04650 | 154 | LbH_FBP Ferripyochelin Binding Protein (FBP): FBP | 99.39 | |
| COG0663 | 176 | PaaY Carbonic anhydrases/acetyltransferases, isole | 99.39 | |
| TIGR02287 | 192 | PaaY phenylacetic acid degradation protein PaaY. M | 99.39 | |
| PLN02296 | 269 | carbonate dehydratase | 99.39 | |
| KOG1461 | 673 | consensus Translation initiation factor 2B, epsilo | 99.39 | |
| cd02503 | 181 | MobA MobA catalyzes the formation of molybdopterin | 99.39 | |
| COG1207 | 460 | GlmU N-acetylglucosamine-1-phosphate uridyltransfe | 99.38 | |
| TIGR01173 | 451 | glmU UDP-N-acetylglucosamine diphosphorylase/gluco | 99.38 | |
| cd03350 | 139 | LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-d | 99.37 | |
| PLN02728 | 252 | 2-C-methyl-D-erythritol 4-phosphate cytidylyltrans | 99.37 | |
| COG1043 | 260 | LpxA Acyl-[acyl carrier protein] | 99.36 | |
| cd05824 | 80 | LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltr | 99.36 | |
| PLN02472 | 246 | uncharacterized protein | 99.35 | |
| TIGR03202 | 190 | pucB xanthine dehydrogenase accessory protein pucB | 99.35 | |
| cd03350 | 139 | LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-d | 99.35 | |
| cd03358 | 119 | LbH_WxcM_N_like WcxM-like, Left-handed parallel be | 99.35 | |
| PRK00317 | 193 | mobA molybdopterin-guanine dinucleotide biosynthes | 99.35 | |
| cd04651 | 104 | LbH_G1P_AT_C Glucose-1-phosphate adenylyltransfera | 99.35 | |
| PRK14358 | 481 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.34 | |
| PRK09451 | 456 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.34 | |
| cd03352 | 205 | LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferas | 99.34 | |
| TIGR00965 | 269 | dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate | 99.34 | |
| PRK02726 | 200 | molybdopterin-guanine dinucleotide biosynthesis pr | 99.34 | |
| TIGR03570 | 201 | NeuD_NnaD sugar O-acyltransferase, sialic acid O-a | 99.34 | |
| PF01128 | 221 | IspD: 2-C-methyl-D-erythritol 4-phosphate cytidyly | 99.33 | |
| PRK13627 | 196 | carnitine operon protein CaiE; Provisional | 99.33 | |
| cd05635 | 101 | LbH_unknown Uncharacterized proteins, Left-handed | 99.33 | |
| cd05787 | 79 | LbH_eIF2B_epsilon eIF-2B epsilon subunit, central | 99.32 | |
| cd03360 | 197 | LbH_AT_putative Putative Acyltransferase (AT), Lef | 99.32 | |
| TIGR00965 | 269 | dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate | 99.32 | |
| PRK14356 | 456 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.31 | |
| TIGR02665 | 186 | molyb_mobA molybdopterin-guanine dinucleotide bios | 99.31 | |
| cd04649 | 147 | LbH_THP_succinylT_putative Putative 2,3,4,5-tetrah | 99.3 | |
| cd04645 | 153 | LbH_gamma_CA_like Gamma carbonic anhydrase-like: T | 99.3 | |
| COG1211 | 230 | IspD 4-diphosphocytidyl-2-methyl-D-erithritol synt | 99.3 | |
| cd03359 | 161 | LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynact | 99.29 | |
| PRK14359 | 430 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.28 | |
| PRK14360 | 450 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.28 | |
| TIGR03532 | 231 | DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxyla | 99.28 | |
| TIGR03584 | 222 | PseF pseudaminic acid CMP-transferase. The sequenc | 99.27 | |
| PRK11830 | 272 | dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N- | 99.27 | |
| cd05635 | 101 | LbH_unknown Uncharacterized proteins, Left-handed | 99.26 | |
| cd03352 | 205 | LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferas | 99.26 | |
| KOG1462 | 433 | consensus Translation initiation factor 2B, gamma | 99.26 | |
| cd03360 | 197 | LbH_AT_putative Putative Acyltransferase (AT), Lef | 99.26 | |
| cd03359 | 161 | LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynact | 99.26 | |
| PRK11830 | 272 | dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N- | 99.25 | |
| PRK14357 | 448 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.25 | |
| TIGR03570 | 201 | NeuD_NnaD sugar O-acyltransferase, sialic acid O-a | 99.25 | |
| PRK14355 | 459 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.23 | |
| COG2068 | 199 | Uncharacterized MobA-related protein [General func | 99.23 | |
| PRK14352 | 482 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.22 | |
| cd04649 | 147 | LbH_THP_succinylT_putative Putative 2,3,4,5-tetrah | 99.22 | |
| PRK14354 | 458 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.18 | |
| COG0746 | 192 | MobA Molybdopterin-guanine dinucleotide biosynthes | 99.18 | |
| PRK14489 | 366 | putative bifunctional molybdopterin-guanine dinucl | 99.14 | |
| TIGR03308 | 204 | phn_thr-fam phosphonate metabolim protein, transfe | 99.12 | |
| cd03358 | 119 | LbH_WxcM_N_like WcxM-like, Left-handed parallel be | 99.12 | |
| PRK10092 | 183 | maltose O-acetyltransferase; Provisional | 99.11 | |
| TIGR03536 | 341 | DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxyl | 99.1 | |
| TIGR03536 | 341 | DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxyl | 99.1 | |
| COG1208 | 358 | GCD1 Nucleoside-diphosphate-sugar pyrophosphorylas | 99.09 | |
| PRK05293 | 380 | glgC glucose-1-phosphate adenylyltransferase; Prov | 99.07 | |
| PRK10191 | 146 | putative acyl transferase; Provisional | 99.06 | |
| TIGR02092 | 369 | glgD glucose-1-phosphate adenylyltransferase, GlgD | 99.06 | |
| COG0448 | 393 | GlgC ADP-glucose pyrophosphorylase [Carbohydrate t | 99.05 | |
| PRK00560 | 196 | molybdopterin-guanine dinucleotide biosynthesis pr | 99.04 | |
| PRK09527 | 203 | lacA galactoside O-acetyltransferase; Reviewed | 99.04 | |
| cd02518 | 233 | GT2_SpsF SpsF is a glycosyltrnasferase implicated | 99.04 | |
| TIGR02091 | 361 | glgC glucose-1-phosphate adenylyltransferase. This | 99.04 | |
| COG2171 | 271 | DapD Tetrahydrodipicolinate N-succinyltransferase | 99.02 | |
| PRK14490 | 369 | putative bifunctional molybdopterin-guanine dinucl | 99.02 | |
| TIGR03535 | 319 | DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarbo | 99.01 | |
| COG1043 | 260 | LpxA Acyl-[acyl carrier protein] | 99.0 | |
| cd03357 | 169 | LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and | 99.0 | |
| PLN02694 | 294 | serine O-acetyltransferase | 98.99 | |
| PRK10502 | 182 | putative acyl transferase; Provisional | 98.99 | |
| TIGR01172 | 162 | cysE serine O-acetyltransferase. Cysteine biosynth | 98.99 | |
| PRK14500 | 346 | putative bifunctional molybdopterin-guanine dinucl | 98.99 | |
| PRK11132 | 273 | cysE serine acetyltransferase; Provisional | 98.99 | |
| KOG1460 | 407 | consensus GDP-mannose pyrophosphorylase [Carbohydr | 98.98 | |
| TIGR03535 | 319 | DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarbo | 98.98 | |
| PRK10502 | 182 | putative acyl transferase; Provisional | 98.97 | |
| PLN02357 | 360 | serine acetyltransferase | 98.93 | |
| PRK11132 | 273 | cysE serine acetyltransferase; Provisional | 98.93 | |
| PRK00725 | 425 | glgC glucose-1-phosphate adenylyltransferase; Prov | 98.92 | |
| PRK09677 | 192 | putative lipopolysaccharide biosynthesis O-acetyl | 98.92 | |
| PRK00844 | 407 | glgC glucose-1-phosphate adenylyltransferase; Prov | 98.91 | |
| cd03354 | 101 | LbH_SAT Serine acetyltransferase (SAT): SAT cataly | 98.91 | |
| TIGR01208 | 353 | rmlA_long glucose-1-phosphate thymidylylransferase | 98.9 | |
| PLN02241 | 436 | glucose-1-phosphate adenylyltransferase | 98.9 | |
| PLN02694 | 294 | serine O-acetyltransferase | 98.88 | |
| PRK02862 | 429 | glgC glucose-1-phosphate adenylyltransferase; Prov | 98.88 | |
| COG1083 | 228 | NeuA CMP-N-acetylneuraminic acid synthetase [Cell | 98.88 | |
| cd04647 | 109 | LbH_MAT_like Maltose O-acyltransferase (MAT)-like: | 98.86 | |
| cd05825 | 107 | LbH_wcaF_like wcaF-like: This group is composed of | 98.86 | |
| cd00208 | 78 | LbetaH Left-handed parallel beta-Helix (LbetaH or | 98.86 | |
| KOG1322 | 371 | consensus GDP-mannose pyrophosphorylase/mannose-1- | 98.85 | |
| PRK10191 | 146 | putative acyl transferase; Provisional | 98.84 | |
| cd03354 | 101 | LbH_SAT Serine acetyltransferase (SAT): SAT cataly | 98.84 | |
| PRK09677 | 192 | putative lipopolysaccharide biosynthesis O-acetyl | 98.84 | |
| TIGR01172 | 162 | cysE serine O-acetyltransferase. Cysteine biosynth | 98.84 | |
| PLN02739 | 355 | serine acetyltransferase | 98.81 | |
| cd04647 | 109 | LbH_MAT_like Maltose O-acyltransferase (MAT)-like: | 98.8 | |
| PRK09527 | 203 | lacA galactoside O-acetyltransferase; Reviewed | 98.78 | |
| cd00208 | 78 | LbetaH Left-handed parallel beta-Helix (LbetaH or | 98.76 | |
| cd04180 | 266 | UGPase_euk_like Eukaryotic UGPase-like includes UD | 98.75 | |
| PLN02739 | 355 | serine acetyltransferase | 98.74 | |
| PF02348 | 217 | CTP_transf_3: Cytidylyltransferase; InterPro: IPR0 | 98.69 | |
| COG1045 | 194 | CysE Serine acetyltransferase [Amino acid transpor | 98.69 | |
| COG2171 | 271 | DapD Tetrahydrodipicolinate N-succinyltransferase | 98.68 | |
| PLN02357 | 360 | serine acetyltransferase | 98.65 | |
| KOG3121 | 184 | consensus Dynactin, subunit p25 [Cytoskeleton] | 98.63 | |
| cd05825 | 107 | LbH_wcaF_like wcaF-like: This group is composed of | 98.6 | |
| PRK10092 | 183 | maltose O-acetyltransferase; Provisional | 98.6 | |
| cd03357 | 169 | LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and | 98.59 | |
| COG1045 | 194 | CysE Serine acetyltransferase [Amino acid transpor | 98.58 | |
| KOG3121 | 184 | consensus Dynactin, subunit p25 [Cytoskeleton] | 98.5 | |
| cd04193 | 323 | UDPGlcNAc_PPase UDPGlcNAc pyrophosphorylase catala | 98.49 | |
| KOG4042 | 190 | consensus Dynactin subunit p27/WS-3, involved in t | 98.44 | |
| cd03349 | 145 | LbH_XAT Xenobiotic acyltransferase (XAT): The XAT | 98.44 | |
| COG1861 | 241 | SpsF Spore coat polysaccharide biosynthesis protei | 98.43 | |
| cd03349 | 145 | LbH_XAT Xenobiotic acyltransferase (XAT): The XAT | 98.31 | |
| PTZ00339 | 482 | UDP-N-acetylglucosamine pyrophosphorylase; Provisi | 98.24 | |
| KOG4750 | 269 | consensus Serine O-acetyltransferase [Amino acid t | 98.21 | |
| TIGR02353 | 695 | NRPS_term_dom non-ribosomal peptide synthetase ter | 98.16 | |
| KOG4042 | 190 | consensus Dynactin subunit p27/WS-3, involved in t | 98.11 | |
| TIGR02353 | 695 | NRPS_term_dom non-ribosomal peptide synthetase ter | 98.09 | |
| COG0110 | 190 | WbbJ Acetyltransferase (isoleucine patch superfami | 98.03 | |
| PLN02474 | 469 | UTP--glucose-1-phosphate uridylyltransferase | 97.98 | |
| KOG4750 | 269 | consensus Serine O-acetyltransferase [Amino acid t | 97.88 | |
| COG0110 | 190 | WbbJ Acetyltransferase (isoleucine patch superfami | 97.81 | |
| PRK00576 | 178 | molybdopterin-guanine dinucleotide biosynthesis pr | 97.72 | |
| COG4801 | 277 | Predicted acyltransferase [General function predic | 97.7 | |
| cd00897 | 300 | UGPase_euk Eukaryotic UGPase catalyses the synthes | 97.52 | |
| COG4801 | 277 | Predicted acyltransferase [General function predic | 97.34 | |
| PF14602 | 34 | Hexapep_2: Hexapeptide repeat of succinyl-transfer | 97.08 | |
| PLN02435 | 493 | probable UDP-N-acetylglucosamine pyrophosphorylase | 96.78 | |
| PRK13412 | 974 | fkp bifunctional fucokinase/L-fucose-1-P-guanylylt | 96.72 | |
| PF01704 | 420 | UDPGP: UTP--glucose-1-phosphate uridylyltransferas | 96.71 | |
| TIGR03552 | 195 | F420_cofC 2-phospho-L-lactate guanylyltransferase | 96.55 | |
| cd06424 | 315 | UGGPase UGGPase catalyzes the synthesis of UDP-Glu | 96.22 | |
| COG4284 | 472 | UDP-glucose pyrophosphorylase [Carbohydrate transp | 96.19 | |
| PF07959 | 414 | Fucokinase: L-fucokinase; InterPro: IPR012887 In t | 96.03 | |
| PLN02830 | 615 | UDP-sugar pyrophosphorylase | 95.59 | |
| cd00761 | 156 | Glyco_tranf_GTA_type Glycosyltransferase family A | 95.55 | |
| PF07959 | 414 | Fucokinase: L-fucokinase; InterPro: IPR012887 In t | 95.21 | |
| PF00535 | 169 | Glycos_transf_2: Glycosyl transferase family 2; In | 94.38 | |
| cd04195 | 201 | GT2_AmsE_like GT2_AmsE_like is involved in exopoly | 88.0 | |
| cd04186 | 166 | GT_2_like_c Subfamily of Glycosyltransferase Famil | 87.92 | |
| PF01983 | 217 | CofC: Guanylyl transferase CofC like; InterPro: IP | 87.84 | |
| cd04179 | 185 | DPM_DPG-synthase_like DPM_DPG-synthase_like is a m | 87.26 | |
| PRK13412 | 974 | fkp bifunctional fucokinase/L-fucose-1-P-guanylylt | 86.78 | |
| cd06423 | 180 | CESA_like CESA_like is the cellulose synthase supe | 85.05 | |
| cd04188 | 211 | DPG_synthase DPG_synthase is involved in protein N | 83.54 | |
| cd06439 | 251 | CESA_like_1 CESA_like_1 is a member of the cellulo | 83.51 | |
| cd06442 | 224 | DPM1_like DPM1_like represents putative enzymes si | 83.11 | |
| PF04519 | 101 | Bactofilin: Polymer-forming cytoskeletal; InterPro | 83.08 | |
| PRK10073 | 328 | putative glycosyl transferase; Provisional | 81.61 | |
| cd06427 | 241 | CESA_like_2 CESA_like_2 is a member of the cellulo | 81.52 | |
| cd04184 | 202 | GT2_RfbC_Mx_like Myxococcus xanthus RfbC like prot | 80.93 |
| >KOG1462 consensus Translation initiation factor 2B, gamma subunit (eIF-2Bgamma/GCD1) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
Probab=100.00 E-value=4.5e-56 Score=411.94 Aligned_cols=414 Identities=33% Similarity=0.575 Sum_probs=322.6
Q ss_pred CCceEEEEecCCCCCCcCCCCCCCcccccccCCcchHHHHHHHHHHCCCCEEEEEecCchhhHHHHhhhhhhccCccceE
Q 012817 1 MDFQVVVLAGGTSKKLVPLVSKEVPKALLPVANRPVLSYVLEQLELSNIKDLIVVVEGADAALRVGGWISAAYVDRLHVE 80 (456)
Q Consensus 1 m~~~aiIlagG~g~rl~pl~~~~~pK~llpi~gkpli~~~l~~l~~~gi~~v~iv~~~~~~~~~i~~~~~~~~~~~~~i~ 80 (456)
|+|||||+|||.|+||--+ +...||||||++|+|||+|+|.+|.++|+++++|++.+.+ .+++++.+.+...-++..-
T Consensus 8 ~efqavV~a~~ggt~~p~~-~~~~pKaLLPIgn~PMi~YpL~~L~~~gfteiiVv~~e~e-~~~i~~al~~~~~l~~~~~ 85 (433)
T KOG1462|consen 8 SEFQAVVLAGGGGTRMPEV-TSRLPKALLPIGNKPMILYPLNSLEQAGFTEIIVVVNEDE-KLDIESALGSNIDLKKRPD 85 (433)
T ss_pred HHhhhheeecCCceechhh-hhhcchhhcccCCcceeeeehhHHHhcCCeEEEEEecHHH-HHHHHHHHhcCCccccccc
Confidence 3689999999999999666 8899999999999999999999999999999999998654 3577877765443333322
Q ss_pred EEEccC----CcChHHHHHHHHhcCCCCcEEEEcCCcccCCChhHHHHHHHhcCceEEEEEeecccCCCccCCCCCCccc
Q 012817 81 VATVPE----DVGTAGALRAIAHHLTAKDVLVVSGDLVSDVPPGAVTAAHRRHDAVVTAMICSVPVSGLSEAGSSGAKDK 156 (456)
Q Consensus 81 ~~~~~~----~~gt~~al~~~~~~l~~~~~lv~~~D~i~~~~l~~~l~~~~~~~a~~t~~~~~~~~~~~~~~~~~~~~~~ 156 (456)
++..+. ..||+++|+.....+..+||+++.||++++.++..++++++..++.+.+++.... +.....|.+.+
T Consensus 86 ~v~ip~~~~~d~gtadsLr~Iy~kikS~DflvlsCD~Vtdv~l~~lvd~FR~~d~slamli~~~~----s~~~~pgqk~k 161 (433)
T KOG1462|consen 86 YVEIPTDDNSDFGTADSLRYIYSKIKSEDFLVLSCDFVTDVPLQPLVDKFRATDASLAMLIGNAL----SEVPIPGQKGK 161 (433)
T ss_pred EEEeecccccccCCHHHHhhhhhhhccCCEEEEecccccCCCcHHHHHHHhccChhHhHHhcccc----ccccccCcccc
Confidence 333332 4699999999999998889999999999999999999999998888776666322 12222333322
Q ss_pred CCCCCcccEEEecCCCcEEEEeecccccccccccchHHHhhcceeEEecCCccceEEeechHHHHHHHhcCccccccccc
Q 012817 157 TKKPGRYNIIGMDPTKQFLLHIATGAELEKDTRIRKSILRAVGQMDIRADLMDAHMYAFNRSVLQEVLDQKDKFQSLKQD 236 (456)
Q Consensus 157 ~~~~~~~~iv~~d~~~~~l~~~~~~~~~~k~~~~~~~~~~~~~~~~~~~~~~~~giYi~~~~vl~~~~~~~~~~~s~~~d 236 (456)
+...+.++..+++++++.+.....+.++++.++..++|++|+++..+++.++++|+|++++++ ++.+.++..||+.|
T Consensus 162 --~k~~~d~igi~e~t~rl~y~~~~~d~~~~l~i~~slL~~~prltl~t~L~dahiY~~k~~v~d-~l~~~~sisSfk~~ 238 (433)
T KOG1462|consen 162 --KKQARDVIGINEDTERLAYSSDSADEEEPLVIRKSLLWNHPRLTLTTKLVDAHIYVFKHWVID-LLSEKESISSFKAD 238 (433)
T ss_pred --cccccceeeeccccceeEEeecCCcCCCceehhhhhhhcCCceEEeccccceeeeeeHHHHHH-HHhcCCcceeeccc
Confidence 234568899999999988887766788889999999999999999999999999999999996 56777788999999
Q ss_pred hhHHHhHhccccccccCCCCCCccccccCCCcchhhhhccCCCCcccccccCCCCCCCCCCcceeeEEEEecCcchhhcc
Q 012817 237 VLPYLVRSQLKSEILINGAPQGQQAKENGNDKVSYRILANASTPSFHELYALGPNGSAPVRRTHKCCVYIASNSKYCVRL 316 (456)
Q Consensus 237 ~l~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~yi~~~~~~~~~i 316 (456)
|+|++++.|++..+...+.-. .-. +.+... + +.|.-...+..+|++|..+....+.++
T Consensus 239 f~P~lvkkQ~q~~~~~~~~~~---------~~l--------~t~~~~-~----~d~~~~~~d~ik~y~~~~p~e~~~~ra 296 (433)
T KOG1462|consen 239 FLPYLVKKQFQKNPPLKKNET---------SIL--------PTPNLN-N----PDGIHSPDDRIKCYAYILPTESLFVRA 296 (433)
T ss_pred ccchhhhhhhhcCCCcccccc---------ccc--------CCcccc-C----cccccCcccceeeeEEEccCccceEEe
Confidence 999999999876544321100 000 000100 0 000000011368899999988888899
Q ss_pred cCHHHHHHHhHhh-hccccccCCCcccCCCceeCCCCEeCCCcEECCCCEECCCCEECCCCeEeeeEECCCCEECCCcEE
Q 012817 317 NSIQAFMDINRDV-IGEANHLSGYNFSAQNNIIHPSAELGSKTTVGPHCMLGEGSQMGDKCSVKRSVIGRHCRIGSNVKV 395 (456)
Q Consensus 317 ~~~~~y~~~~~~~-l~~~~~~~~~~~~~~~~~i~~~~~i~~~~~i~~~~~i~~~~~I~~~~~i~~s~Ig~~~~ig~~~~i 395 (456)
+++..|+++|++- +..-+ . ....+...+.. ...+|..++++++|.|++++.|+.|+||.+|.||+.++|
T Consensus 297 NtL~~y~eiN~~k~~~~l~---~-----e~~~~k~~~~~--~~l~g~d~iv~~~t~i~~~s~ik~SviG~nC~Ig~~~~v 366 (433)
T KOG1462|consen 297 NTLLSYMEINRDKKLKKLC---S-----EAKFVKNYVKK--VALVGADSIVGDNTQIGENSNIKRSVIGSNCDIGERVKV 366 (433)
T ss_pred cchHHHHhhhHHHHHHHhc---c-----ccccccchhhh--eeccchhhccCCCceecccceeeeeeecCCccccCCcEE
Confidence 9999999999632 11110 0 01111111111 145678899999999999999999999999999999999
Q ss_pred eCeEECCCCEECCCcEEcCeEECCCCEECCCcEecCeEECCCCEECCCcEEcCCeeeecc
Q 012817 396 VNSVVMNHVTIGDGCSIQGSVICSNAQLQERVALKDCQVGQGYVVSAGCEYKGESLARKE 455 (456)
Q Consensus 396 ~~s~i~~~~~ig~~~~i~~~ii~~~~~I~~~~~i~~~~i~~~~~v~~~~~~~~~~~~~~~ 455 (456)
.+|+||+||+||+++.|+|||||.++.||+|+.|.+|.||+|.+|.++....++++...+
T Consensus 367 ~nSilm~nV~vg~G~~IensIIg~gA~Ig~gs~L~nC~Ig~~yvVeak~~~~~ev~~~~~ 426 (433)
T KOG1462|consen 367 ANSILMDNVVVGDGVNIENSIIGMGAQIGSGSKLKNCIIGPGYVVEAKGKHGGEVLVSNE 426 (433)
T ss_pred EeeEeecCcEecCCcceecceecccceecCCCeeeeeEecCCcEEcccccccccEeeccc
Confidence 999999999999999999999999999999999999999999999999999999987654
|
|
| >COG0448 GlgC ADP-glucose pyrophosphorylase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1322 consensus GDP-mannose pyrophosphorylase/mannose-1-phosphate guanylyltransferase [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >COG1208 GCD1 Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis, outer membrane / Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK05293 glgC glucose-1-phosphate adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG1461 consensus Translation initiation factor 2B, epsilon subunit (eIF-2Bepsilon/GCD6) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK00844 glgC glucose-1-phosphate adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK02862 glgC glucose-1-phosphate adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02241 glucose-1-phosphate adenylyltransferase | Back alignment and domain information |
|---|
| >PRK00725 glgC glucose-1-phosphate adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG1460 consensus GDP-mannose pyrophosphorylase [Carbohydrate transport and metabolism; Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR01208 rmlA_long glucose-1-phosphate thymidylylransferase, long form | Back alignment and domain information |
|---|
| >TIGR02091 glgC glucose-1-phosphate adenylyltransferase | Back alignment and domain information |
|---|
| >TIGR02092 glgD glucose-1-phosphate adenylyltransferase, GlgD subunit | Back alignment and domain information |
|---|
| >COG1207 GlmU N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PRK14358 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14355 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14352 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14356 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK09451 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01173 glmU UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase | Back alignment and domain information |
|---|
| >PRK14353 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14354 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14359 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14357 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14360 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG1209 RfbA dTDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >TIGR01105 galF UTP-glucose-1-phosphate uridylyltransferase, non-catalytic GalF subunit | Back alignment and domain information |
|---|
| >PF00483 NTP_transferase: Nucleotidyl transferase This Prosite entry is only a sub-family of the Pfam entry | Back alignment and domain information |
|---|
| >cd06425 M1P_guanylylT_B_like_N N-terminal domain of the M1P-guanylyltransferase B-isoform like proteins | Back alignment and domain information |
|---|
| >cd06428 M1P_guanylylT_A_like_N N-terminal domain of M1P_guanylyl_A_ like proteins are likely to be a isoform of GDP-mannose pyrophosphorylase | Back alignment and domain information |
|---|
| >PRK15480 glucose-1-phosphate thymidylyltransferase RfbA; Provisional | Back alignment and domain information |
|---|
| >PRK10122 GalU regulator GalF; Provisional | Back alignment and domain information |
|---|
| >cd04198 eIF-2B_gamma_N The N-terminal domain of gamma subunit of the eIF-2B is a subfamily of glycosyltransferase 2 | Back alignment and domain information |
|---|
| >cd02538 G1P_TT_short G1P_TT_short is the short form of glucose-1-phosphate thymidylyltransferase | Back alignment and domain information |
|---|
| >TIGR01207 rmlA glucose-1-phosphate thymidylyltransferase, short form | Back alignment and domain information |
|---|
| >cd04197 eIF-2B_epsilon_N The N-terminal domain of epsilon subunit of the eIF-2B is a subfamily of glycosyltransferase 2 | Back alignment and domain information |
|---|
| >TIGR02623 G1P_cyt_trans glucose-1-phosphate cytidylyltransferase | Back alignment and domain information |
|---|
| >cd02541 UGPase_prokaryotic Prokaryotic UGPase catalyses the synthesis of UDP-glucose | Back alignment and domain information |
|---|
| >cd04189 G1P_TT_long G1P_TT_long represents the long form of glucose-1-phosphate thymidylyltransferase | Back alignment and domain information |
|---|
| >TIGR01099 galU UTP-glucose-1-phosphate uridylyltransferase | Back alignment and domain information |
|---|
| >cd06422 NTP_transferase_like_1 NTP_transferase_like_1 is a member of the nucleotidyl transferase family | Back alignment and domain information |
|---|
| >PRK13389 UTP--glucose-1-phosphate uridylyltransferase subunit GalU; Provisional | Back alignment and domain information |
|---|
| >cd02524 G1P_cytidylyltransferase G1P_cytidylyltransferase catalyzes the production of CDP-D-Glucose | Back alignment and domain information |
|---|
| >cd02507 eIF-2B_gamma_N_like The N-terminal of eIF-2B_gamma_like is predicted to have glycosyltransferase activity | Back alignment and domain information |
|---|
| >cd06426 NTP_transferase_like_2 NTP_trnasferase_like_2 is a member of the nucleotidyl transferase family | Back alignment and domain information |
|---|
| >cd04181 NTP_transferase NTP_transferases catalyze the transfer of nucleotides onto phosphosugars | Back alignment and domain information |
|---|
| >cd06915 NTP_transferase_WcbM_like WcbM_like is a subfamily of nucleotidyl transferases | Back alignment and domain information |
|---|
| >cd04183 GT2_BcE_like GT2_BcbE_like is likely involved in the biosynthesis of the polysaccharide capsule | Back alignment and domain information |
|---|
| >COG1210 GalU UDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >cd02508 ADP_Glucose_PP ADP-glucose pyrophosphorylase is involved in the biosynthesis of glycogen or starch | Back alignment and domain information |
|---|
| >cd02509 GDP-M1P_Guanylyltransferase GDP-M1P_Guanylyltransferase catalyzes the formation of GDP-Mannose | Back alignment and domain information |
|---|
| >cd02523 PC_cytidylyltransferase Phosphocholine cytidylyltransferases catalyze the synthesis of CDP-choline | Back alignment and domain information |
|---|
| >TIGR01479 GMP_PMI mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase | Back alignment and domain information |
|---|
| >cd02540 GT2_GlmU_N_bac N-terminal domain of bacterial GlmU | Back alignment and domain information |
|---|
| >COG0836 {ManC} Mannose-1-phosphate guanylyltransferase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >cd02517 CMP-KDO-Synthetase CMP-KDO synthetase catalyzes the activation of KDO which is an essential component of the lipopolysaccharide | Back alignment and domain information |
|---|
| >PRK05450 3-deoxy-manno-octulosonate cytidylyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK15460 cpsB mannose-1-phosphate guanyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK13368 3-deoxy-manno-octulosonate cytidylyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG1213 Predicted sugar nucleotidyltransferases [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PLN02917 CMP-KDO synthetase | Back alignment and domain information |
|---|
| >TIGR03532 DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase | Back alignment and domain information |
|---|
| >cd05636 LbH_G1P_TT_C_like Putative glucose-1-phosphate thymidylyltransferase, C-terminal Left-handed parallel beta-Helix (LbH) domain: Proteins in this family show simlarity to glucose-1-phosphate adenylyltransferases in that they contain N-terminal catalytic domains that resemble a dinucleotide-binding Rossmann fold and C-terminal LbH fold domains | Back alignment and domain information |
|---|
| >cd05636 LbH_G1P_TT_C_like Putative glucose-1-phosphate thymidylyltransferase, C-terminal Left-handed parallel beta-Helix (LbH) domain: Proteins in this family show simlarity to glucose-1-phosphate adenylyltransferases in that they contain N-terminal catalytic domains that resemble a dinucleotide-binding Rossmann fold and C-terminal LbH fold domains | Back alignment and domain information |
|---|
| >PF12804 NTP_transf_3: MobA-like NTP transferase domain; PDB: 3FWW_A 2XME_D 2XMH_C 2DPW_A 2WAW_A 2OI5_B 1HV9_B 1FWY_A 2OI6_A 2OI7_B | Back alignment and domain information |
|---|
| >COG4750 LicC CTP:phosphocholine cytidylyltransferase involved in choline phosphorylation for cell surface LPS epitopes [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >TIGR00454 conserved hypothetical protein TIGR00454 | Back alignment and domain information |
|---|
| >cd04745 LbH_paaY_like paaY-like: This group is composed by uncharacterized proteins with similarity to the protein product of the E | Back alignment and domain information |
|---|
| >TIGR02287 PaaY phenylacetic acid degradation protein PaaY | Back alignment and domain information |
|---|
| >cd04652 LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) | Back alignment and domain information |
|---|
| >PRK00155 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; Reviewed | Back alignment and domain information |
|---|
| >cd03351 LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltransferase (UDP-GlcNAc acyltransferase): Proteins in this family catalyze the transfer of (R)-3-hydroxymyristic acid from its acyl carrier protein thioester to UDP-GlcNAc | Back alignment and domain information |
|---|
| >COG1044 LpxD UDP-3-O-[3-hydroxymyristoyl] | Back alignment and domain information |
|---|
| >PRK13627 carnitine operon protein CaiE; Provisional | Back alignment and domain information |
|---|
| >cd03351 LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltransferase (UDP-GlcNAc acyltransferase): Proteins in this family catalyze the transfer of (R)-3-hydroxymyristic acid from its acyl carrier protein thioester to UDP-GlcNAc | Back alignment and domain information |
|---|
| >TIGR00453 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase | Back alignment and domain information |
|---|
| >cd03353 LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyltransferase (GlmU), C-terminal left-handed beta-helix (LbH) acetyltransferase domain: GlmU is also known as UDP-N-acetylglucosamine pyrophosphorylase | Back alignment and domain information |
|---|
| >TIGR00466 kdsB 3-deoxy-D-manno-octulosonate cytidylyltransferase | Back alignment and domain information |
|---|
| >TIGR01853 lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase | Back alignment and domain information |
|---|
| >COG0663 PaaY Carbonic anhydrases/acetyltransferases, isoleucine patch superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >cd04646 LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport | Back alignment and domain information |
|---|
| >TIGR01852 lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase | Back alignment and domain information |
|---|
| >TIGR01852 lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase | Back alignment and domain information |
|---|
| >cd02516 CDP-ME_synthetase CDP-ME synthetase is involved in mevalonate-independent isoprenoid production | Back alignment and domain information |
|---|
| >cd04652 LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) | Back alignment and domain information |
|---|
| >PLN02296 carbonate dehydratase | Back alignment and domain information |
|---|
| >COG1044 LpxD UDP-3-O-[3-hydroxymyristoyl] | Back alignment and domain information |
|---|
| >cd00710 LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbonic anhydrases are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism, involving the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide, followed by the regeneration of the active site by ionization of the zinc-bound water molecule and removal of a proton from the active site | Back alignment and domain information |
|---|
| >cd00710 LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbonic anhydrases are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism, involving the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide, followed by the regeneration of the active site by ionization of the zinc-bound water molecule and removal of a proton from the active site | Back alignment and domain information |
|---|
| >PRK05289 UDP-N-acetylglucosamine acyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd04650 LbH_FBP Ferripyochelin Binding Protein (FBP): FBP is an outer membrane protein which plays a role in iron acquisition | Back alignment and domain information |
|---|
| >cd03356 LbH_G1P_AT_C_like Left-handed parallel beta-Helix (LbH) domain of a group of proteins with similarity to glucose-1-phosphate adenylyltransferase: Included in this family are glucose-1-phosphate adenylyltransferase, mannose-1-phosphate guanylyltransferase, and the eukaryotic translation initiation factor eIF-2B subunits, epsilon and gamma | Back alignment and domain information |
|---|
| >cd04182 GT_2_like_f GT_2_like_f is a subfamily of the glycosyltransferase family 2 (GT-2) with unknown function | Back alignment and domain information |
|---|
| >PRK00892 lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd03353 LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyltransferase (GlmU), C-terminal left-handed beta-helix (LbH) acetyltransferase domain: GlmU is also known as UDP-N-acetylglucosamine pyrophosphorylase | Back alignment and domain information |
|---|
| >cd04645 LbH_gamma_CA_like Gamma carbonic anhydrase-like: This family is composed of gamma carbonic anhydrase (CA), Ferripyochelin Binding Protein (FBP), E | Back alignment and domain information |
|---|
| >cd05824 LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Mannose-1-phosphate guanylyltransferase is also known as GDP-mannose pyrophosphorylase | Back alignment and domain information |
|---|
| >PRK05289 UDP-N-acetylglucosamine acyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02472 uncharacterized protein | Back alignment and domain information |
|---|
| >TIGR03308 phn_thr-fam phosphonate metabolim protein, transferase hexapeptide repeat family | Back alignment and domain information |
|---|
| >PRK09382 ispDF bifunctional 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase/2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03310 matur_ygfJ molybdenum hydroxylase accessory protein, YgfJ family | Back alignment and domain information |
|---|
| >PRK14353 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG2266 GTP:adenosylcobinamide-phosphate guanylyltransferase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK00892 lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd04651 LbH_G1P_AT_C Glucose-1-phosphate adenylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Glucose-1-phosphate adenylyltransferase is also known as ADP-glucose synthase or ADP-glucose pyrophosphorylase | Back alignment and domain information |
|---|
| >PRK13385 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd04745 LbH_paaY_like paaY-like: This group is composed by uncharacterized proteins with similarity to the protein product of the E | Back alignment and domain information |
|---|
| >cd05787 LbH_eIF2B_epsilon eIF-2B epsilon subunit, central Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) | Back alignment and domain information |
|---|
| >PRK12461 UDP-N-acetylglucosamine acyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd02513 CMP-NeuAc_Synthase CMP-NeuAc_Synthase activates N-acetylneuraminic acid by adding CMP moiety | Back alignment and domain information |
|---|
| >cd04646 LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport | Back alignment and domain information |
|---|
| >TIGR01853 lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase | Back alignment and domain information |
|---|
| >cd03356 LbH_G1P_AT_C_like Left-handed parallel beta-Helix (LbH) domain of a group of proteins with similarity to glucose-1-phosphate adenylyltransferase: Included in this family are glucose-1-phosphate adenylyltransferase, mannose-1-phosphate guanylyltransferase, and the eukaryotic translation initiation factor eIF-2B subunits, epsilon and gamma | Back alignment and domain information |
|---|
| >COG1212 KdsB CMP-2-keto-3-deoxyoctulosonic acid synthetase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PRK12461 UDP-N-acetylglucosamine acyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd04650 LbH_FBP Ferripyochelin Binding Protein (FBP): FBP is an outer membrane protein which plays a role in iron acquisition | Back alignment and domain information |
|---|
| >COG0663 PaaY Carbonic anhydrases/acetyltransferases, isoleucine patch superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02287 PaaY phenylacetic acid degradation protein PaaY | Back alignment and domain information |
|---|
| >PLN02296 carbonate dehydratase | Back alignment and domain information |
|---|
| >KOG1461 consensus Translation initiation factor 2B, epsilon subunit (eIF-2Bepsilon/GCD6) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd02503 MobA MobA catalyzes the formation of molybdopterin guanine dinucleotide | Back alignment and domain information |
|---|
| >COG1207 GlmU N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >TIGR01173 glmU UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase | Back alignment and domain information |
|---|
| >cd03350 LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (also called THP succinyltransferase): THDP N-succinyltransferase catalyzes the conversion of tetrahydrodipicolinate and succinyl-CoA to N-succinyltetrahydrodipicolinate and CoA | Back alignment and domain information |
|---|
| >PLN02728 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase | Back alignment and domain information |
|---|
| >COG1043 LpxA Acyl-[acyl carrier protein] | Back alignment and domain information |
|---|
| >cd05824 LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Mannose-1-phosphate guanylyltransferase is also known as GDP-mannose pyrophosphorylase | Back alignment and domain information |
|---|
| >PLN02472 uncharacterized protein | Back alignment and domain information |
|---|
| >TIGR03202 pucB xanthine dehydrogenase accessory protein pucB | Back alignment and domain information |
|---|
| >cd03350 LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (also called THP succinyltransferase): THDP N-succinyltransferase catalyzes the conversion of tetrahydrodipicolinate and succinyl-CoA to N-succinyltetrahydrodipicolinate and CoA | Back alignment and domain information |
|---|
| >cd03358 LbH_WxcM_N_like WcxM-like, Left-handed parallel beta-Helix (LbH) N-terminal domain: This group is composed of Xanthomonas campestris WcxM and proteins with similarity to the WcxM N-terminal domain | Back alignment and domain information |
|---|
| >PRK00317 mobA molybdopterin-guanine dinucleotide biosynthesis protein MobA; Reviewed | Back alignment and domain information |
|---|
| >cd04651 LbH_G1P_AT_C Glucose-1-phosphate adenylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Glucose-1-phosphate adenylyltransferase is also known as ADP-glucose synthase or ADP-glucose pyrophosphorylase | Back alignment and domain information |
|---|
| >PRK14358 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK09451 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd03352 LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferase (LpxD): The enzyme catalyzes the transfer of 3-hydroxymyristic acid or 3-hydroxy-arachidic acid, depending on the organism, from the acyl carrier protein (ACP) to UDP-3-O-acyl-glucosamine to produce UDP-2,3-diacyl-GlcNAc | Back alignment and domain information |
|---|
| >TIGR00965 dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase | Back alignment and domain information |
|---|
| >PRK02726 molybdopterin-guanine dinucleotide biosynthesis protein A; Provisional | Back alignment and domain information |
|---|
| >TIGR03570 NeuD_NnaD sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family | Back alignment and domain information |
|---|
| >PF01128 IspD: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; InterPro: IPR001228 4-diphosphocytidyl-2C-methyl-D-erythritol synthase, a bacterial ispD protein, catalyzes the third step of the deoxyxylulose-5-phosphate pathway (DXP) of isoprenoid biosynthesis; the formation of 4-diphosphocytidyl-2C-methyl-D-erythritol from CTP and 2C-methyl-D-erythritol 4-phosphate [] | Back alignment and domain information |
|---|
| >PRK13627 carnitine operon protein CaiE; Provisional | Back alignment and domain information |
|---|
| >cd05635 LbH_unknown Uncharacterized proteins, Left-handed parallel beta-Helix (LbH) domain: Members in this group are uncharacterized bacterial proteins containing a LbH domain with multiple turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) | Back alignment and domain information |
|---|
| >cd05787 LbH_eIF2B_epsilon eIF-2B epsilon subunit, central Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) | Back alignment and domain information |
|---|
| >cd03360 LbH_AT_putative Putative Acyltransferase (AT), Left-handed parallel beta-Helix (LbH) domain; This group is composed of mostly uncharacterized proteins containing an N-terminal helical subdomain followed by a LbH domain | Back alignment and domain information |
|---|
| >TIGR00965 dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase | Back alignment and domain information |
|---|
| >PRK14356 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR02665 molyb_mobA molybdopterin-guanine dinucleotide biosynthesis protein A, proteobacterial | Back alignment and domain information |
|---|
| >cd04649 LbH_THP_succinylT_putative Putative 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (THP succinyltransferase), C-terminal left-handed parallel alpha-helix (LbH) domain: This group is composed of mostly uncharacterized proteins containing an N-terminal domain of unknown function and a C-terminal LbH domain with similarity to THP succinyltransferase LbH | Back alignment and domain information |
|---|
| >cd04645 LbH_gamma_CA_like Gamma carbonic anhydrase-like: This family is composed of gamma carbonic anhydrase (CA), Ferripyochelin Binding Protein (FBP), E | Back alignment and domain information |
|---|
| >COG1211 IspD 4-diphosphocytidyl-2-methyl-D-erithritol synthase [Lipid metabolism] | Back alignment and domain information |
|---|
| >cd03359 LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport | Back alignment and domain information |
|---|
| >PRK14359 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14360 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR03532 DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase | Back alignment and domain information |
|---|
| >TIGR03584 PseF pseudaminic acid CMP-transferase | Back alignment and domain information |
|---|
| >PRK11830 dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd05635 LbH_unknown Uncharacterized proteins, Left-handed parallel beta-Helix (LbH) domain: Members in this group are uncharacterized bacterial proteins containing a LbH domain with multiple turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) | Back alignment and domain information |
|---|
| >cd03352 LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferase (LpxD): The enzyme catalyzes the transfer of 3-hydroxymyristic acid or 3-hydroxy-arachidic acid, depending on the organism, from the acyl carrier protein (ACP) to UDP-3-O-acyl-glucosamine to produce UDP-2,3-diacyl-GlcNAc | Back alignment and domain information |
|---|
| >KOG1462 consensus Translation initiation factor 2B, gamma subunit (eIF-2Bgamma/GCD1) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd03360 LbH_AT_putative Putative Acyltransferase (AT), Left-handed parallel beta-Helix (LbH) domain; This group is composed of mostly uncharacterized proteins containing an N-terminal helical subdomain followed by a LbH domain | Back alignment and domain information |
|---|
| >cd03359 LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport | Back alignment and domain information |
|---|
| >PRK11830 dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14357 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR03570 NeuD_NnaD sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family | Back alignment and domain information |
|---|
| >PRK14355 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG2068 Uncharacterized MobA-related protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14352 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd04649 LbH_THP_succinylT_putative Putative 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (THP succinyltransferase), C-terminal left-handed parallel alpha-helix (LbH) domain: This group is composed of mostly uncharacterized proteins containing an N-terminal domain of unknown function and a C-terminal LbH domain with similarity to THP succinyltransferase LbH | Back alignment and domain information |
|---|
| >PRK14354 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG0746 MobA Molybdopterin-guanine dinucleotide biosynthesis protein A [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK14489 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobA/MobB; Provisional | Back alignment and domain information |
|---|
| >TIGR03308 phn_thr-fam phosphonate metabolim protein, transferase hexapeptide repeat family | Back alignment and domain information |
|---|
| >cd03358 LbH_WxcM_N_like WcxM-like, Left-handed parallel beta-Helix (LbH) N-terminal domain: This group is composed of Xanthomonas campestris WcxM and proteins with similarity to the WcxM N-terminal domain | Back alignment and domain information |
|---|
| >PRK10092 maltose O-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR03536 DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase | Back alignment and domain information |
|---|
| >TIGR03536 DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase | Back alignment and domain information |
|---|
| >COG1208 GCD1 Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis, outer membrane / Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK05293 glgC glucose-1-phosphate adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK10191 putative acyl transferase; Provisional | Back alignment and domain information |
|---|
| >TIGR02092 glgD glucose-1-phosphate adenylyltransferase, GlgD subunit | Back alignment and domain information |
|---|
| >COG0448 GlgC ADP-glucose pyrophosphorylase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK00560 molybdopterin-guanine dinucleotide biosynthesis protein A; Provisional | Back alignment and domain information |
|---|
| >PRK09527 lacA galactoside O-acetyltransferase; Reviewed | Back alignment and domain information |
|---|
| >cd02518 GT2_SpsF SpsF is a glycosyltrnasferase implicated in the synthesis of the spore coat | Back alignment and domain information |
|---|
| >TIGR02091 glgC glucose-1-phosphate adenylyltransferase | Back alignment and domain information |
|---|
| >COG2171 DapD Tetrahydrodipicolinate N-succinyltransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14490 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MobA; Provisional | Back alignment and domain information |
|---|
| >TIGR03535 DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase | Back alignment and domain information |
|---|
| >COG1043 LpxA Acyl-[acyl carrier protein] | Back alignment and domain information |
|---|
| >cd03357 LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates | Back alignment and domain information |
|---|
| >PLN02694 serine O-acetyltransferase | Back alignment and domain information |
|---|
| >PRK10502 putative acyl transferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01172 cysE serine O-acetyltransferase | Back alignment and domain information |
|---|
| >PRK14500 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MoaC/MobA; Provisional | Back alignment and domain information |
|---|
| >PRK11132 cysE serine acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG1460 consensus GDP-mannose pyrophosphorylase [Carbohydrate transport and metabolism; Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR03535 DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase | Back alignment and domain information |
|---|
| >PRK10502 putative acyl transferase; Provisional | Back alignment and domain information |
|---|
| >PLN02357 serine acetyltransferase | Back alignment and domain information |
|---|
| >PRK11132 cysE serine acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK00725 glgC glucose-1-phosphate adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK09677 putative lipopolysaccharide biosynthesis O-acetyl transferase WbbJ; Provisional | Back alignment and domain information |
|---|
| >PRK00844 glgC glucose-1-phosphate adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd03354 LbH_SAT Serine acetyltransferase (SAT): SAT catalyzes the CoA-dependent acetylation of the side chain hydroxyl group of L-serine to form O-acetylserine, as the first step of a two-step biosynthetic pathway in bacteria and plants leading to the formation of L-cysteine | Back alignment and domain information |
|---|
| >TIGR01208 rmlA_long glucose-1-phosphate thymidylylransferase, long form | Back alignment and domain information |
|---|
| >PLN02241 glucose-1-phosphate adenylyltransferase | Back alignment and domain information |
|---|
| >PLN02694 serine O-acetyltransferase | Back alignment and domain information |
|---|
| >PRK02862 glgC glucose-1-phosphate adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG1083 NeuA CMP-N-acetylneuraminic acid synthetase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >cd04647 LbH_MAT_like Maltose O-acyltransferase (MAT)-like: This family is composed of maltose O-acetyltransferase, galactoside O-acetyltransferase (GAT), xenobiotic acyltransferase (XAT) and similar proteins | Back alignment and domain information |
|---|
| >cd05825 LbH_wcaF_like wcaF-like: This group is composed of the protein product of the E | Back alignment and domain information |
|---|
| >cd00208 LbetaH Left-handed parallel beta-Helix (LbetaH or LbH) domain: The alignment contains 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) | Back alignment and domain information |
|---|
| >KOG1322 consensus GDP-mannose pyrophosphorylase/mannose-1-phosphate guanylyltransferase [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >PRK10191 putative acyl transferase; Provisional | Back alignment and domain information |
|---|
| >cd03354 LbH_SAT Serine acetyltransferase (SAT): SAT catalyzes the CoA-dependent acetylation of the side chain hydroxyl group of L-serine to form O-acetylserine, as the first step of a two-step biosynthetic pathway in bacteria and plants leading to the formation of L-cysteine | Back alignment and domain information |
|---|
| >PRK09677 putative lipopolysaccharide biosynthesis O-acetyl transferase WbbJ; Provisional | Back alignment and domain information |
|---|
| >TIGR01172 cysE serine O-acetyltransferase | Back alignment and domain information |
|---|
| >PLN02739 serine acetyltransferase | Back alignment and domain information |
|---|
| >cd04647 LbH_MAT_like Maltose O-acyltransferase (MAT)-like: This family is composed of maltose O-acetyltransferase, galactoside O-acetyltransferase (GAT), xenobiotic acyltransferase (XAT) and similar proteins | Back alignment and domain information |
|---|
| >PRK09527 lacA galactoside O-acetyltransferase; Reviewed | Back alignment and domain information |
|---|
| >cd00208 LbetaH Left-handed parallel beta-Helix (LbetaH or LbH) domain: The alignment contains 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) | Back alignment and domain information |
|---|
| >cd04180 UGPase_euk_like Eukaryotic UGPase-like includes UDPase and UDPGlcNAc pyrophosphorylase enzymes | Back alignment and domain information |
|---|
| >PLN02739 serine acetyltransferase | Back alignment and domain information |
|---|
| >PF02348 CTP_transf_3: Cytidylyltransferase; InterPro: IPR003329 Synonym(s): CMP-N-acetylneuraminic acid synthetase Acylneuraminate cytidylyltransferase (2 | Back alignment and domain information |
|---|
| >COG1045 CysE Serine acetyltransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG2171 DapD Tetrahydrodipicolinate N-succinyltransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02357 serine acetyltransferase | Back alignment and domain information |
|---|
| >KOG3121 consensus Dynactin, subunit p25 [Cytoskeleton] | Back alignment and domain information |
|---|
| >cd05825 LbH_wcaF_like wcaF-like: This group is composed of the protein product of the E | Back alignment and domain information |
|---|
| >PRK10092 maltose O-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd03357 LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates | Back alignment and domain information |
|---|
| >COG1045 CysE Serine acetyltransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG3121 consensus Dynactin, subunit p25 [Cytoskeleton] | Back alignment and domain information |
|---|
| >cd04193 UDPGlcNAc_PPase UDPGlcNAc pyrophosphorylase catalayzes the synthesis of UDPGlcNAc | Back alignment and domain information |
|---|
| >KOG4042 consensus Dynactin subunit p27/WS-3, involved in transport of organelles along microtubules [Intracellular trafficking, secretion, and vesicular transport; Cytoskeleton] | Back alignment and domain information |
|---|
| >cd03349 LbH_XAT Xenobiotic acyltransferase (XAT): The XAT class of hexapeptide acyltransferases is composed of a large number of microbial enzymes that catalyze the CoA-dependent acetylation of a variety of hydroxyl-bearing acceptors such as chloramphenicol and streptogramin, among others | Back alignment and domain information |
|---|
| >COG1861 SpsF Spore coat polysaccharide biosynthesis protein F, CMP-KDO synthetase homolog [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >cd03349 LbH_XAT Xenobiotic acyltransferase (XAT): The XAT class of hexapeptide acyltransferases is composed of a large number of microbial enzymes that catalyze the CoA-dependent acetylation of a variety of hydroxyl-bearing acceptors such as chloramphenicol and streptogramin, among others | Back alignment and domain information |
|---|
| >PTZ00339 UDP-N-acetylglucosamine pyrophosphorylase; Provisional | Back alignment and domain information |
|---|
| >KOG4750 consensus Serine O-acetyltransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02353 NRPS_term_dom non-ribosomal peptide synthetase terminal domain of unknown function | Back alignment and domain information |
|---|
| >KOG4042 consensus Dynactin subunit p27/WS-3, involved in transport of organelles along microtubules [Intracellular trafficking, secretion, and vesicular transport; Cytoskeleton] | Back alignment and domain information |
|---|
| >TIGR02353 NRPS_term_dom non-ribosomal peptide synthetase terminal domain of unknown function | Back alignment and domain information |
|---|
| >COG0110 WbbJ Acetyltransferase (isoleucine patch superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02474 UTP--glucose-1-phosphate uridylyltransferase | Back alignment and domain information |
|---|
| >KOG4750 consensus Serine O-acetyltransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG0110 WbbJ Acetyltransferase (isoleucine patch superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK00576 molybdopterin-guanine dinucleotide biosynthesis protein A; Provisional | Back alignment and domain information |
|---|
| >COG4801 Predicted acyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >cd00897 UGPase_euk Eukaryotic UGPase catalyses the synthesis of UDP-Glucose | Back alignment and domain information |
|---|
| >COG4801 Predicted acyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PF14602 Hexapep_2: Hexapeptide repeat of succinyl-transferase; PDB: 2P2O_B 2IC7_B 2RIJ_A 3FSY_B 3FSX_D 3CJ8_A 1QRE_A 1QRG_A 1THJ_B 1QRM_A | Back alignment and domain information |
|---|
| >PLN02435 probable UDP-N-acetylglucosamine pyrophosphorylase | Back alignment and domain information |
|---|
| >PRK13412 fkp bifunctional fucokinase/L-fucose-1-P-guanylyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF01704 UDPGP: UTP--glucose-1-phosphate uridylyltransferase; InterPro: IPR002618 This family consists of UTP--glucose-1-phosphate uridylyltransferases (2 | Back alignment and domain information |
|---|
| >TIGR03552 F420_cofC 2-phospho-L-lactate guanylyltransferase CofC | Back alignment and domain information |
|---|
| >cd06424 UGGPase UGGPase catalyzes the synthesis of UDP-Glucose/UDP-Galactose | Back alignment and domain information |
|---|
| >COG4284 UDP-glucose pyrophosphorylase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF07959 Fucokinase: L-fucokinase; InterPro: IPR012887 In the salvage pathway of GDP-L-fucose, free cytosolic fucose is phosphorylated by L-fucokinase to form L-fucose-L-phosphate, which is then further converted to GDP-L-fucose in the reaction catalysed by GDP-L-fucose pyrophosphorylase [] | Back alignment and domain information |
|---|
| >PLN02830 UDP-sugar pyrophosphorylase | Back alignment and domain information |
|---|
| >cd00761 Glyco_tranf_GTA_type Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold | Back alignment and domain information |
|---|
| >PF07959 Fucokinase: L-fucokinase; InterPro: IPR012887 In the salvage pathway of GDP-L-fucose, free cytosolic fucose is phosphorylated by L-fucokinase to form L-fucose-L-phosphate, which is then further converted to GDP-L-fucose in the reaction catalysed by GDP-L-fucose pyrophosphorylase [] | Back alignment and domain information |
|---|
| >PF00535 Glycos_transf_2: Glycosyl transferase family 2; InterPro: IPR001173 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases | Back alignment and domain information |
|---|
| >cd04195 GT2_AmsE_like GT2_AmsE_like is involved in exopolysaccharide amylovora biosynthesis | Back alignment and domain information |
|---|
| >cd04186 GT_2_like_c Subfamily of Glycosyltransferase Family GT2 of unknown function | Back alignment and domain information |
|---|
| >PF01983 CofC: Guanylyl transferase CofC like; InterPro: IPR002835 Coenzyme F 420 is a hydride carrier cofactor functioning in methanogenesis | Back alignment and domain information |
|---|
| >cd04179 DPM_DPG-synthase_like DPM_DPG-synthase_like is a member of the Glycosyltransferase 2 superfamily | Back alignment and domain information |
|---|
| >PRK13412 fkp bifunctional fucokinase/L-fucose-1-P-guanylyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd06423 CESA_like CESA_like is the cellulose synthase superfamily | Back alignment and domain information |
|---|
| >cd04188 DPG_synthase DPG_synthase is involved in protein N-linked glycosylation | Back alignment and domain information |
|---|
| >cd06439 CESA_like_1 CESA_like_1 is a member of the cellulose synthase (CESA) superfamily | Back alignment and domain information |
|---|
| >cd06442 DPM1_like DPM1_like represents putative enzymes similar to eukaryotic DPM1 | Back alignment and domain information |
|---|
| >PF04519 Bactofilin: Polymer-forming cytoskeletal; InterPro: IPR007607 This family contains several uncharacterised hypothetical proteins | Back alignment and domain information |
|---|
| >PRK10073 putative glycosyl transferase; Provisional | Back alignment and domain information |
|---|
| >cd06427 CESA_like_2 CESA_like_2 is a member of the cellulose synthase superfamily | Back alignment and domain information |
|---|
| >cd04184 GT2_RfbC_Mx_like Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 456 | ||||
| 1lvw_A | 295 | Crystal Structure Of Glucose-1-phosphate Thymidylyl | 4e-05 | ||
| 1h5t_A | 293 | Thymidylyltransferase Complexed With Thymidylyldiph | 1e-04 | ||
| 1h5s_D | 293 | Thymidylyltransferase Complexed With Tmp Length = 2 | 1e-04 | ||
| 3pkp_A | 292 | Q83s Variant Of S. Enterica Rmla With Datp Length = | 1e-04 | ||
| 3pkq_A | 292 | Q83d Variant Of S. Enterica Rmla With Dgtp Length = | 1e-04 | ||
| 1h5s_A | 293 | Thymidylyltransferase Complexed With Tmp Length = 2 | 1e-04 | ||
| 1h5r_B | 293 | Thymidylyltransferase Complexed With Thimidine And | 1e-04 | ||
| 1mp3_A | 292 | L89t Variant Of S. Enterica Rmla Length = 292 | 3e-04 | ||
| 1mp5_A | 292 | Y177f Variant Of S. Enterica Rmla Length = 292 | 3e-04 | ||
| 1mp4_A | 292 | W224h Variant Of S. Enterica Rmla Length = 292 | 3e-04 | ||
| 1iim_A | 292 | Thymidylyltransferase Complexed With Ttp Length = 2 | 3e-04 |
| >pdb|1LVW|A Chain A, Crystal Structure Of Glucose-1-phosphate Thymidylyltransferase, Rmla, Complex With Dtdp Length = 295 | Back alignment and structure |
|
| >pdb|1H5T|A Chain A, Thymidylyltransferase Complexed With Thymidylyldiphosphate- Glucose Length = 293 | Back alignment and structure |
| >pdb|1H5S|D Chain D, Thymidylyltransferase Complexed With Tmp Length = 293 | Back alignment and structure |
| >pdb|3PKP|A Chain A, Q83s Variant Of S. Enterica Rmla With Datp Length = 292 | Back alignment and structure |
| >pdb|3PKQ|A Chain A, Q83d Variant Of S. Enterica Rmla With Dgtp Length = 292 | Back alignment and structure |
| >pdb|1H5S|A Chain A, Thymidylyltransferase Complexed With Tmp Length = 293 | Back alignment and structure |
| >pdb|1H5R|B Chain B, Thymidylyltransferase Complexed With Thimidine And Glucose- 1-Phospate Length = 293 | Back alignment and structure |
| >pdb|1MP3|A Chain A, L89t Variant Of S. Enterica Rmla Length = 292 | Back alignment and structure |
| >pdb|1MP5|A Chain A, Y177f Variant Of S. Enterica Rmla Length = 292 | Back alignment and structure |
| >pdb|1MP4|A Chain A, W224h Variant Of S. Enterica Rmla Length = 292 | Back alignment and structure |
| >pdb|1IIM|A Chain A, Thymidylyltransferase Complexed With Ttp Length = 292 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 456 | |||
| 1jyk_A | 254 | LICC protein, CTP:phosphocholine cytidylytransfera | 1e-15 | |
| 3rsb_A | 196 | Adenosylcobinamide-phosphate guanylyltransferase; | 7e-15 | |
| 2xme_A | 232 | CTP-inositol-1-phosphate cytidylyltransferase; CDP | 3e-13 | |
| 2dpw_A | 232 | Hypothetical protein TTHA0179; transferase, struct | 8e-13 | |
| 2ggo_A | 401 | 401AA long hypothetical glucose-1-phosphate thymid | 1e-12 | |
| 2ggo_A | 401 | 401AA long hypothetical glucose-1-phosphate thymid | 1e-09 | |
| 3eh0_A | 341 | UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltr | 1e-11 | |
| 3pmo_A | 372 | UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; | 2e-11 | |
| 2iu8_A | 374 | LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-a | 2e-11 | |
| 3brk_X | 420 | Glucose-1-phosphate adenylyltransferase; ADP-gluco | 1e-10 | |
| 3fs8_A | 273 | QDTC; acetyltransferase, natural product, deoxysug | 2e-10 | |
| 3fs8_A | 273 | QDTC; acetyltransferase, natural product, deoxysug | 1e-08 | |
| 3fs8_A | 273 | QDTC; acetyltransferase, natural product, deoxysug | 2e-05 | |
| 3fs8_A | 273 | QDTC; acetyltransferase, natural product, deoxysug | 8e-04 | |
| 3mqg_A | 192 | Lipopolysaccharides biosynthesis acetyltransferas; | 6e-10 | |
| 3mqg_A | 192 | Lipopolysaccharides biosynthesis acetyltransferas; | 4e-04 | |
| 3bfp_A | 194 | Acetyltransferase; LEFT-handed beta helix, COA bin | 1e-09 | |
| 3bfp_A | 194 | Acetyltransferase; LEFT-handed beta helix, COA bin | 5e-04 | |
| 2wee_A | 197 | MOBA-related protein; unknown function; 1.65A {Myc | 2e-09 | |
| 4ea9_A | 220 | Perosamine N-acetyltransferase; beta helix, acetyl | 1e-08 | |
| 4ea9_A | 220 | Perosamine N-acetyltransferase; beta helix, acetyl | 5e-07 | |
| 3hsq_A | 259 | Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosam | 3e-08 | |
| 1j2z_A | 270 | Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam | 6e-08 | |
| 3r0s_A | 266 | Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam | 7e-08 | |
| 4eqy_A | 283 | Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam | 9e-08 | |
| 2qia_A | 262 | UDP-N-acetylglucosamine acyltransferase; LEFT-hand | 1e-07 | |
| 2waw_A | 199 | MOBA relate protein; unknown function; HET: PGE; 1 | 2e-07 | |
| 3t57_A | 305 | UDP-N-acetylglucosamine O-acyltransferase domain- | 2e-07 | |
| 3r8y_A | 240 | 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- ac | 2e-07 | |
| 1yp2_A | 451 | Glucose-1-phosphate adenylyltransferase small subu | 2e-07 | |
| 3st8_A | 501 | Bifunctional protein GLMU; acetyltransferase, pyro | 3e-07 | |
| 2vsh_A | 236 | TARI, 2-C-methyl-D-erythritol 4-phosphate cytidyly | 6e-07 | |
| 2v0h_A | 456 | Bifunctional protein GLMU; cell WALL, magnesium, c | 6e-07 | |
| 2v0h_A | 456 | Bifunctional protein GLMU; cell WALL, magnesium, c | 5e-05 | |
| 2xwl_A | 223 | 2-C-methyl-D-erythritol 4-phosphate cytidylyltran; | 7e-07 | |
| 1hm9_A | 468 | GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltr | 2e-06 | |
| 1hm9_A | 468 | GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltr | 4e-04 | |
| 1hm9_A | 468 | GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltr | 5e-04 | |
| 4fce_A | 459 | Bifunctional protein GLMU; GLMU. csgid, niaid, str | 2e-06 | |
| 3f1c_A | 246 | Putative 2-C-methyl-D-erythritol 4-phosphate cytid | 3e-06 | |
| 1vgw_A | 231 | 4-diphosphocytidyl-2C-methyl-D-erythritol synthas; | 4e-06 | |
| 4evw_A | 255 | Nucleoside-diphosphate-sugar pyrophosphorylase; st | 6e-06 | |
| 3q80_A | 231 | 2-C-methyl-D-erythritol 4-phosphate cytidyltransf; | 6e-06 | |
| 3c8v_A | 496 | Putative acetyltransferase; YP_390128.1, structura | 1e-05 | |
| 2yc3_A | 228 | 2-C-methyl-D-erythritol 4-phosphate cytidylyltran | 3e-05 | |
| 1i52_A | 236 | 4-diphosphocytidyl-2-C-methylerythritol synthase; | 4e-05 | |
| 3eev_A | 212 | Chloramphenicol acetyltransferase; beta-helix, str | 4e-05 | |
| 2px7_A | 236 | 2-C-methyl-D-erythritol 4-phosphate cytidylyltrans | 5e-05 | |
| 1e5k_A | 201 | Molybdopterin-guanine dinucleotide biosynthesis pr | 6e-05 | |
| 4e8l_A | 219 | Virginiamycin A acetyltransferase; structural geno | 7e-05 | |
| 1vpa_A | 234 | 2-C-methyl-D-erythritol 4-phosphate cytidylyltran; | 7e-05 | |
| 1w55_A | 371 | ISPD/ISPF bifunctional enzyme; biosynthetic pathwa | 9e-05 | |
| 3vbi_A | 205 | ANTD, galactoside O-acetyltransferase; anthrose, a | 1e-04 | |
| 3vbi_A | 205 | ANTD, galactoside O-acetyltransferase; anthrose, a | 1e-04 | |
| 3d5n_A | 197 | Q97W15_sulso; NESG, SSR125, structural genomics, P | 1e-04 | |
| 1xat_A | 212 | Xenobiotic acetyltransferase; chloramphenicol, LEF | 4e-04 | |
| 1tzf_A | 259 | Glucose-1-phosphate cytidylyltransferase; nucleoti | 6e-04 |
| >1jyk_A LICC protein, CTP:phosphocholine cytidylytransferase; 3D structure, CTP:phosphocholine cytidylyltransferase; 1.50A {Streptococcus pneumoniae} SCOP: c.68.1.13 PDB: 1jyl_A* Length = 254 | Back alignment and structure |
|---|
Score = 75.2 bits (185), Expect = 1e-15
Identities = 23/121 (19%), Positives = 52/121 (42%), Gaps = 17/121 (14%)
Query: 1 MDFQVVVLAGGTSKKLVPLVSKEVPKALLPVANRPVLSYVLEQLELSNIKDLIVVVEGAD 60
+ + ++LA G +L PL ++ PKAL+ V +P++ Y +E L+ I D+I++V
Sbjct: 24 IRVKAIILAAGLGTRLRPL-TENTPKALVQVNQKPLIEYQIEFLKEKGINDIIIIV---- 78
Query: 61 AALRVGGWIS---AAYVDRLHVEVATVPEDV--GTAGALRAIAHHLTAKDVLVVSGDLVS 115
G++ ++ V + + +L + L ++ + + +
Sbjct: 79 ------GYLKEQFDYLKEKYGVRLVFNDKYADYNNFYSLYLVKEELA-NSYVIDADNYLF 131
Query: 116 D 116
Sbjct: 132 K 132
|
| >3rsb_A Adenosylcobinamide-phosphate guanylyltransferase; pyrophosphorylase binding motif, pyrophosphorylase; HET: GTP; 2.80A {Methanocaldococcus jannaschii} Length = 196 | Back alignment and structure |
|---|
| >2xme_A CTP-inositol-1-phosphate cytidylyltransferase; CDP-inositol, DI-MYO-inositol phosphate; 1.89A {Archaeoglobus fulgidus} PDB: 2xmh_A* Length = 232 | Back alignment and structure |
|---|
| >2dpw_A Hypothetical protein TTHA0179; transferase, structural genomics, NPPSFA, national project O structural and functional analyses; 2.90A {Thermus thermophilus} SCOP: c.68.1.19 Length = 232 | Back alignment and structure |
|---|
| >2ggo_A 401AA long hypothetical glucose-1-phosphate thymidylyltransferase; beta barrel; 1.80A {Sulfolobus tokodaii} PDB: 2ggq_A* Length = 401 | Back alignment and structure |
|---|
| >2ggo_A 401AA long hypothetical glucose-1-phosphate thymidylyltransferase; beta barrel; 1.80A {Sulfolobus tokodaii} PDB: 2ggq_A* Length = 401 | Back alignment and structure |
|---|
| >3eh0_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltransferase; LPXD, LEFT-handed parallel beta helix, acyl carrier protein, antibiotic resistance; 2.60A {Escherichia coli} Length = 341 | Back alignment and structure |
|---|
| >3pmo_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; lipid A biosynthesis pathway, transferase; 1.30A {Pseudomonas aeruginosa} Length = 372 | Back alignment and structure |
|---|
| >2iu8_A LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; UDP-3- O-acyl-glucosamine N-acyltransferase, lipid A biosynthesis; HET: PLM UD1; 2.2A {Chlamydia trachomatis} PDB: 2iu9_A* 2iua_A* Length = 374 | Back alignment and structure |
|---|
| >3brk_X Glucose-1-phosphate adenylyltransferase; ADP-glucose pyrophosphorylase, allostery, kinetics, structure-function relationships; 2.10A {Agrobacterium tumefaciens} Length = 420 | Back alignment and structure |
|---|
| >3fs8_A QDTC; acetyltransferase, natural product, deoxysugar; HET: ACO; 1.70A {Thermoanaerobacteriumthermosaccharolyticum} PDB: 3fsb_A* 3fsc_A* Length = 273 | Back alignment and structure |
|---|
| >3fs8_A QDTC; acetyltransferase, natural product, deoxysugar; HET: ACO; 1.70A {Thermoanaerobacteriumthermosaccharolyticum} PDB: 3fsb_A* 3fsc_A* Length = 273 | Back alignment and structure |
|---|
| >3fs8_A QDTC; acetyltransferase, natural product, deoxysugar; HET: ACO; 1.70A {Thermoanaerobacteriumthermosaccharolyticum} PDB: 3fsb_A* 3fsc_A* Length = 273 | Back alignment and structure |
|---|
| >3fs8_A QDTC; acetyltransferase, natural product, deoxysugar; HET: ACO; 1.70A {Thermoanaerobacteriumthermosaccharolyticum} PDB: 3fsb_A* 3fsc_A* Length = 273 | Back alignment and structure |
|---|
| >3mqg_A Lipopolysaccharides biosynthesis acetyltransferas; beta helix, acetyl transferase, transferase; HET: ACO U5P UDP PE4; 1.43A {Bordetella petrii} PDB: 3mqh_A* Length = 192 | Back alignment and structure |
|---|
| >3mqg_A Lipopolysaccharides biosynthesis acetyltransferas; beta helix, acetyl transferase, transferase; HET: ACO U5P UDP PE4; 1.43A {Bordetella petrii} PDB: 3mqh_A* Length = 192 | Back alignment and structure |
|---|
| >3bfp_A Acetyltransferase; LEFT-handed beta helix, COA binding protein, N-glycan biosynthesis, bacillosamine, structural genomics, MKBSGI; HET: FLC; 1.75A {Campylobacter jejuni} SCOP: b.81.1.8 PDB: 2vhe_A* 3bsw_A* 3bss_A* 3bsy_A* 2npo_A Length = 194 | Back alignment and structure |
|---|
| >3bfp_A Acetyltransferase; LEFT-handed beta helix, COA binding protein, N-glycan biosynthesis, bacillosamine, structural genomics, MKBSGI; HET: FLC; 1.75A {Campylobacter jejuni} SCOP: b.81.1.8 PDB: 2vhe_A* 3bsw_A* 3bss_A* 3bsy_A* 2npo_A Length = 194 | Back alignment and structure |
|---|
| >2wee_A MOBA-related protein; unknown function; 1.65A {Mycobacterium tuberculosis H37RV} PDB: 2we9_A 2yes_A Length = 197 | Back alignment and structure |
|---|
| >4ea9_A Perosamine N-acetyltransferase; beta helix, acetyl coenzyme A, GDP-perosa transferase; HET: JBT; 0.90A {Caulobacter vibrioides} PDB: 4ea8_A* 4ea7_A* 4eaa_A* 4eab_A* Length = 220 | Back alignment and structure |
|---|
| >4ea9_A Perosamine N-acetyltransferase; beta helix, acetyl coenzyme A, GDP-perosa transferase; HET: JBT; 0.90A {Caulobacter vibrioides} PDB: 4ea8_A* 4ea7_A* 4eaa_A* 4eab_A* Length = 220 | Back alignment and structure |
|---|
| >3hsq_A Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosamine O-acyltransferase; L.interrogans LPXA, LPXA, LPXA acyltransferase; 2.10A {Leptospira interrogans} PDB: 3i3a_A* 3i3x_A* Length = 259 | Back alignment and structure |
|---|
| >1j2z_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; UDP-N-acetylglucosamine acyltransferase, LPXA, LEFT-handed B structure; HET: SOG TLA; 2.10A {Helicobacter pylori} SCOP: b.81.1.1 Length = 270 | Back alignment and structure |
|---|
| >3r0s_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; structural genomics; 2.30A {Campylobacter jejuni subsp} Length = 266 | Back alignment and structure |
|---|
| >4eqy_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; ssgcid, beta helix, structural genomics, seattle structural center for infectious disease, transferase; 1.80A {Burkholderia thailandensis} Length = 283 | Back alignment and structure |
|---|
| >2qia_A UDP-N-acetylglucosamine acyltransferase; LEFT-handed parallel beta helix; HET: U20; 1.74A {Escherichia coli K12} SCOP: b.81.1.1 PDB: 1lxa_A 2jf3_A* 2aq9_A* 2qiv_X* 2jf2_A Length = 262 | Back alignment and structure |
|---|
| >2waw_A MOBA relate protein; unknown function; HET: PGE; 1.60A {Mycobacterium SP} Length = 199 | Back alignment and structure |
|---|
| >3t57_A UDP-N-acetylglucosamine O-acyltransferase domain- protein; LEFT-handed parallel beta helix, lipid A biosynthesis, lipid synthesis; 2.10A {Arabidopsis thaliana} Length = 305 | Back alignment and structure |
|---|
| >3r8y_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- acetyltransferase; structural genomics, csgid; 1.70A {Bacillus anthracis} PDB: 3cj8_A* Length = 240 | Back alignment and structure |
|---|
| >1yp2_A Glucose-1-phosphate adenylyltransferase small subunit; ADP-glucose synthase, ADP-glucose pyrophosphorylase, agpase B; HET: PMB; 2.11A {Solanum tuberosum} SCOP: b.81.1.4 c.68.1.6 PDB: 1yp3_A* 1yp4_A* Length = 451 | Back alignment and structure |
|---|
| >3st8_A Bifunctional protein GLMU; acetyltransferase, pyrophosphorylase, rossmann fold, LEFT-handed-beta-helix, cell shape; HET: COA GP1 UD1; 1.98A {Mycobacterium tuberculosis} PDB: 3spt_A* 3foq_A 3dk5_A 3d8v_A 3d98_A* 3dj4_A 2qkx_A* Length = 501 | Back alignment and structure |
|---|
| >2vsh_A TARI, 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; nucleotidyltransferase; HET: 1PE PG4 P6G; 2.00A {Streptococcus pneumoniae} PDB: 2vsi_A* Length = 236 | Back alignment and structure |
|---|
| >2v0h_A Bifunctional protein GLMU; cell WALL, magnesium, cell shape, transferase, peptidoglycan synthesis, associative mechanism; 1.79A {Haemophilus influenzae} PDB: 2v0i_A* 2v0j_A* 2v0k_A* 2v0l_A* 2vd4_A* 2w0v_A* 2w0w_A* 3twd_A* Length = 456 | Back alignment and structure |
|---|
| >2v0h_A Bifunctional protein GLMU; cell WALL, magnesium, cell shape, transferase, peptidoglycan synthesis, associative mechanism; 1.79A {Haemophilus influenzae} PDB: 2v0i_A* 2v0j_A* 2v0k_A* 2v0l_A* 2vd4_A* 2w0v_A* 2w0w_A* 3twd_A* Length = 456 | Back alignment and structure |
|---|
| >2xwl_A 2-C-methyl-D-erythritol 4-phosphate cytidylyltran; transferase, MEP pathway; HET: CTP; 1.49A {Mycobacterium smegmatis} PDB: 2xwm_A* Length = 223 | Back alignment and structure |
|---|
| >1hm9_A GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltransfe; acetyltransferase, bifunctional, drug design; HET: ACO UD1; 1.75A {Streptococcus pneumoniae} SCOP: b.81.1.4 c.68.1.5 PDB: 1hm8_A* 1hm0_A* 4ac3_A* 4aaw_A* 1g97_A* 1g95_A* Length = 468 | Back alignment and structure |
|---|
| >1hm9_A GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltransfe; acetyltransferase, bifunctional, drug design; HET: ACO UD1; 1.75A {Streptococcus pneumoniae} SCOP: b.81.1.4 c.68.1.5 PDB: 1hm8_A* 1hm0_A* 4ac3_A* 4aaw_A* 1g97_A* 1g95_A* Length = 468 | Back alignment and structure |
|---|
| >1hm9_A GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltransfe; acetyltransferase, bifunctional, drug design; HET: ACO UD1; 1.75A {Streptococcus pneumoniae} SCOP: b.81.1.4 c.68.1.5 PDB: 1hm8_A* 1hm0_A* 4ac3_A* 4aaw_A* 1g97_A* 1g95_A* Length = 468 | Back alignment and structure |
|---|
| >4fce_A Bifunctional protein GLMU; GLMU. csgid, niaid, structural genomics, national institute allergy and infectious diseases; HET: GP1; 1.96A {Yersinia pseudotuberculosis} PDB: 3fww_A 1hv9_A* 2oi5_A* 2oi6_A* 2oi7_A* 1fxj_A* 1fwy_A* Length = 459 | Back alignment and structure |
|---|
| >3f1c_A Putative 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase 2; structural genomics, PSI-2, protein structure initiative; 2.30A {Listeria monocytogenes str} Length = 246 | Back alignment and structure |
|---|
| >1vgw_A 4-diphosphocytidyl-2C-methyl-D-erythritol synthas; structural genomics, transferase; 2.35A {Neisseria gonorrhoeae} SCOP: c.68.1.13 PDB: 1vgz_A Length = 231 | Back alignment and structure |
|---|
| >4evw_A Nucleoside-diphosphate-sugar pyrophosphorylase; structural genomics, PSI-biology; HET: MSE; 1.90A {Vibrio cholerae} Length = 255 | Back alignment and structure |
|---|
| >3q80_A 2-C-methyl-D-erythritol 4-phosphate cytidyltransf; TB structural genomics consortium, TBSGC, rossman fold; HET: CDM; 2.00A {Mycobacterium tuberculosis} PDB: 3q7u_A* 3okr_A 2xwn_A* Length = 231 | Back alignment and structure |
|---|
| >3c8v_A Putative acetyltransferase; YP_390128.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.28A {Desulfovibrio desulfuricans subsp} Length = 496 | Back alignment and structure |
|---|
| >2yc3_A 2-C-methyl-D-erythritol 4-phosphate cytidylyltran chloroplastic; transferase, non-mevalonate-pathway, herbicide, allosteric P; HET: MW5; 1.40A {Arabidopsis thaliana} PDB: 2yc5_A* 1w77_A* 2ycm_A* Length = 228 | Back alignment and structure |
|---|
| >1i52_A 4-diphosphocytidyl-2-C-methylerythritol synthase; cytidylyltransferase, deoxyxylulose-5-phosphate pathway (DXP isoprenoid biosynthesys, MEP; HET: CTP; 1.50A {Escherichia coli} SCOP: c.68.1.13 PDB: 1ini_A* 1inj_A 1vgt_A 1vgu_A 3n9w_A 1h3m_A Length = 236 | Back alignment and structure |
|---|
| >3eev_A Chloramphenicol acetyltransferase; beta-helix, structural genomics, center for STR genomics of infectious diseases, csgid; 2.61A {Vibrio cholerae o1 biovar el tor} Length = 212 | Back alignment and structure |
|---|
| >2px7_A 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; TTHA0171, ISPD_THET8, ISPD, structural genomics PSI; 2.20A {Thermus thermophilus HB8} Length = 236 | Back alignment and structure |
|---|
| >1e5k_A Molybdopterin-guanine dinucleotide biosynthesis protein A; molybdopterin nucleotidyl-transferase,; HET: CIT; 1.35A {Escherichia coli} SCOP: c.68.1.8 PDB: 1h4e_A* 1hjl_A* 1hjj_A* 1h4c_A* 1h4d_A* 1fr9_A 1frw_A* Length = 201 | Back alignment and structure |
|---|
| >4e8l_A Virginiamycin A acetyltransferase; structural genomics, antibiotic resistance, center for struc genomics of infectious diseases (csgid); 2.70A {Staphylococcus aureus} Length = 219 | Back alignment and structure |
|---|
| >1vpa_A 2-C-methyl-D-erythritol 4-phosphate cytidylyltran; TM1393, JCSG, joint center for structural GENO PSI, protein structure initiative; HET: CTP; 2.67A {Thermotoga maritima} SCOP: c.68.1.13 Length = 234 | Back alignment and structure |
|---|
| >1w55_A ISPD/ISPF bifunctional enzyme; biosynthetic pathway, isoprenoids, nonmevalonate, transferase; HET: C GPP; 2.3A {Campylobacter jejuni} SCOP: c.68.1.13 d.79.5.1 PDB: 1w57_A* Length = 371 | Back alignment and structure |
|---|
| >3vbi_A ANTD, galactoside O-acetyltransferase; anthrose, acylated sugar, LEFT-handed beta helix, sugar N-AC transferase; HET: COA 0FX; 1.80A {Bacillus cereus} PDB: 3vbj_A* 3vbm_A* 3vbk_A* 3vbp_A* 3vbl_A* 3vbn_A* Length = 205 | Back alignment and structure |
|---|
| >3vbi_A ANTD, galactoside O-acetyltransferase; anthrose, acylated sugar, LEFT-handed beta helix, sugar N-AC transferase; HET: COA 0FX; 1.80A {Bacillus cereus} PDB: 3vbj_A* 3vbm_A* 3vbk_A* 3vbp_A* 3vbl_A* 3vbn_A* Length = 205 | Back alignment and structure |
|---|
| >3d5n_A Q97W15_sulso; NESG, SSR125, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.80A {Sulfolobus solfataricus} Length = 197 | Back alignment and structure |
|---|
| >1xat_A Xenobiotic acetyltransferase; chloramphenicol, LEFT-handed helix; 3.20A {Pseudomonas aeruginosa} SCOP: b.81.1.3 PDB: 2xat_A* Length = 212 | Back alignment and structure |
|---|
| >1tzf_A Glucose-1-phosphate cytidylyltransferase; nucleotidyltransferase, mixed alpha/beta fold; HET: C5G; 2.10A {Salmonella enterica subsp} SCOP: c.68.1.13 PDB: 1wvc_A* Length = 259 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 456 | |||
| 1yp2_A | 451 | Glucose-1-phosphate adenylyltransferase small subu | 100.0 | |
| 3brk_X | 420 | Glucose-1-phosphate adenylyltransferase; ADP-gluco | 100.0 | |
| 3st8_A | 501 | Bifunctional protein GLMU; acetyltransferase, pyro | 100.0 | |
| 2ggo_A | 401 | 401AA long hypothetical glucose-1-phosphate thymid | 100.0 | |
| 1hm9_A | 468 | GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltr | 100.0 | |
| 4fce_A | 459 | Bifunctional protein GLMU; GLMU. csgid, niaid, str | 100.0 | |
| 2v0h_A | 456 | Bifunctional protein GLMU; cell WALL, magnesium, c | 100.0 | |
| 3juk_A | 281 | UDP-glucose pyrophosphorylase (GALU); transfer; HE | 99.97 | |
| 4ecm_A | 269 | Glucose-1-phosphate thymidylyltransferase; HET: DA | 99.96 | |
| 1tzf_A | 259 | Glucose-1-phosphate cytidylyltransferase; nucleoti | 99.95 | |
| 2ux8_A | 297 | Glucose-1-phosphate uridylyltransferase; UGPG, GAL | 99.95 | |
| 3pnn_A | 303 | Conserved domain protein; structural genomics, PSI | 99.94 | |
| 2e3d_A | 302 | UTP--glucose-1-phosphate uridylyltransferase; UDP- | 99.94 | |
| 2pa4_A | 323 | UTP-glucose-1-phosphate uridylyltransferase; phosp | 99.94 | |
| 1fxo_A | 293 | Glucose-1-phosphate thymidylyltransferase; rhamnos | 99.94 | |
| 4evw_A | 255 | Nucleoside-diphosphate-sugar pyrophosphorylase; st | 99.94 | |
| 1lvw_A | 295 | Glucose-1-phosphate thymidylyltransferase; protein | 99.93 | |
| 1mc3_A | 296 | Glucose-1-phosphate thymidylyltransferase; glucose | 99.93 | |
| 2qh5_A | 308 | PMI, ALGA, mannose-6-phosphate isomerase; structur | 99.93 | |
| 2x65_A | 336 | Mannose-1-phosphate guanylyltransferase; nucleotid | 99.9 | |
| 3oam_A | 252 | 3-deoxy-manno-octulosonate cytidylyltransferase; c | 99.89 | |
| 2cu2_A | 337 | Putative mannose-1-phosphate guanylyl transferase; | 99.88 | |
| 1jyk_A | 254 | LICC protein, CTP:phosphocholine cytidylytransfera | 99.88 | |
| 3k8d_A | 264 | 3-deoxy-manno-octulosonate cytidylyltransferase; K | 99.85 | |
| 3tqd_A | 256 | 3-deoxy-manno-octulosonate cytidylyltransferase; c | 99.84 | |
| 2y6p_A | 234 | 3-deoxy-manno-octulosonate cytidylyltransferase; l | 99.79 | |
| 4fcu_A | 253 | 3-deoxy-manno-octulosonate cytidylyltransferase; s | 99.78 | |
| 1h7e_A | 245 | 3-deoxy-manno-octulosonate cytidylyltransferase; n | 99.77 | |
| 1vic_A | 262 | 3-deoxy-manno-octulosonate cytidylyltransferase; s | 99.76 | |
| 2iu8_A | 374 | LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-a | 99.74 | |
| 3f1c_A | 246 | Putative 2-C-methyl-D-erythritol 4-phosphate cytid | 99.72 | |
| 1ezi_A | 228 | CMP-N-acetylneuraminic acid synthetase; homodimer, | 99.7 | |
| 2icy_A | 469 | Probable UTP-glucose-1-phosphate uridylyltransfera | 99.7 | |
| 2vsh_A | 236 | TARI, 2-C-methyl-D-erythritol 4-phosphate cytidyly | 99.7 | |
| 2xwl_A | 223 | 2-C-methyl-D-erythritol 4-phosphate cytidylyltran; | 99.7 | |
| 2dpw_A | 232 | Hypothetical protein TTHA0179; transferase, struct | 99.69 | |
| 2xme_A | 232 | CTP-inositol-1-phosphate cytidylyltransferase; CDP | 99.69 | |
| 2yc3_A | 228 | 2-C-methyl-D-erythritol 4-phosphate cytidylyltran | 99.67 | |
| 3r8y_A | 240 | 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- ac | 99.64 | |
| 1vgw_A | 231 | 4-diphosphocytidyl-2C-methyl-D-erythritol synthas; | 99.64 | |
| 3ixc_A | 191 | Hexapeptide transferase family protein; niaid, ssg | 99.62 | |
| 1xhd_A | 173 | Putative acetyltransferase/acyltransferase; struct | 99.61 | |
| 3tv0_A | 194 | Dynactin subunit 6; LEFT-handed beta-helix, ARP11, | 99.6 | |
| 1qwj_A | 229 | Cytidine monophospho-N-acetylneuraminic acid synth | 99.6 | |
| 3rsb_A | 196 | Adenosylcobinamide-phosphate guanylyltransferase; | 99.59 | |
| 1i52_A | 236 | 4-diphosphocytidyl-2-C-methylerythritol synthase; | 99.59 | |
| 3mqg_A | 192 | Lipopolysaccharides biosynthesis acetyltransferas; | 99.58 | |
| 3r3r_A | 187 | Ferripyochelin binding protein; structural genomic | 99.58 | |
| 1v3w_A | 173 | Ferripyochelin binding protein; beta-helix, carbon | 99.58 | |
| 2wee_A | 197 | MOBA-related protein; unknown function; 1.65A {Myc | 99.58 | |
| 3kwd_A | 213 | Carbon dioxide concentrating mechanism protein; LE | 99.57 | |
| 2waw_A | 199 | MOBA relate protein; unknown function; HET: PGE; 1 | 99.57 | |
| 1vpa_A | 234 | 2-C-methyl-D-erythritol 4-phosphate cytidylyltran; | 99.56 | |
| 3q80_A | 231 | 2-C-methyl-D-erythritol 4-phosphate cytidyltransf; | 99.56 | |
| 3kwd_A | 213 | Carbon dioxide concentrating mechanism protein; LE | 99.56 | |
| 2i5k_A | 488 | UTP--glucose-1-phosphate uridylyltransferase; LEFT | 99.56 | |
| 3r1w_A | 189 | Carbonic anhydrase; beta-helix, lyase; 1.73A {Unid | 99.55 | |
| 2ggo_A | 401 | 401AA long hypothetical glucose-1-phosphate thymid | 99.55 | |
| 3vbi_A | 205 | ANTD, galactoside O-acetyltransferase; anthrose, a | 99.54 | |
| 1qre_A | 247 | Carbonic anhydrase; beta-helix, lyase; 1.46A {Meth | 99.54 | |
| 2px7_A | 236 | 2-C-methyl-D-erythritol 4-phosphate cytidylyltrans | 99.53 | |
| 3fs8_A | 273 | QDTC; acetyltransferase, natural product, deoxysug | 99.53 | |
| 3pmo_A | 372 | UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; | 99.53 | |
| 2qia_A | 262 | UDP-N-acetylglucosamine acyltransferase; LEFT-hand | 99.53 | |
| 4eqy_A | 283 | Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam | 99.53 | |
| 3r0s_A | 266 | Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam | 99.53 | |
| 3r0s_A | 266 | Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam | 99.53 | |
| 4e79_A | 357 | UDP-3-O-acylglucosamine N-acyltransferase; lipopol | 99.52 | |
| 3bfp_A | 194 | Acetyltransferase; LEFT-handed beta helix, COA bin | 99.52 | |
| 3eh0_A | 341 | UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltr | 99.52 | |
| 1j2z_A | 270 | Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam | 99.52 | |
| 1qre_A | 247 | Carbonic anhydrase; beta-helix, lyase; 1.46A {Meth | 99.52 | |
| 4e6u_A | 265 | Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam | 99.52 | |
| 4eqy_A | 283 | Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam | 99.51 | |
| 3hsq_A | 259 | Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosam | 99.51 | |
| 3c8v_A | 496 | Putative acetyltransferase; YP_390128.1, structura | 99.5 | |
| 4e6u_A | 265 | Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam | 99.5 | |
| 3d5n_A | 197 | Q97W15_sulso; NESG, SSR125, structural genomics, P | 99.5 | |
| 3hsq_A | 259 | Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosam | 99.5 | |
| 2pig_A | 334 | Putative transferase; SCR6, NESG, YDCK, structural | 99.49 | |
| 1jv1_A | 505 | Glcnac1P uridyltransferase isoform 1: AGX1; nucleo | 99.49 | |
| 4ea9_A | 220 | Perosamine N-acetyltransferase; beta helix, acetyl | 99.48 | |
| 3pmo_A | 372 | UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; | 99.47 | |
| 1xhd_A | 173 | Putative acetyltransferase/acyltransferase; struct | 99.47 | |
| 3t57_A | 305 | UDP-N-acetylglucosamine O-acyltransferase domain- | 99.47 | |
| 3eh0_A | 341 | UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltr | 99.47 | |
| 3mqg_A | 192 | Lipopolysaccharides biosynthesis acetyltransferas; | 99.46 | |
| 1j2z_A | 270 | Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam | 99.46 | |
| 1v3w_A | 173 | Ferripyochelin binding protein; beta-helix, carbon | 99.46 | |
| 3bfp_A | 194 | Acetyltransferase; LEFT-handed beta helix, COA bin | 99.46 | |
| 4e79_A | 357 | UDP-3-O-acylglucosamine N-acyltransferase; lipopol | 99.46 | |
| 2qia_A | 262 | UDP-N-acetylglucosamine acyltransferase; LEFT-hand | 99.45 | |
| 1e5k_A | 201 | Molybdopterin-guanine dinucleotide biosynthesis pr | 99.45 | |
| 3tv0_A | 194 | Dynactin subunit 6; LEFT-handed beta-helix, ARP11, | 99.45 | |
| 4ea9_A | 220 | Perosamine N-acetyltransferase; beta helix, acetyl | 99.44 | |
| 3ixc_A | 191 | Hexapeptide transferase family protein; niaid, ssg | 99.44 | |
| 3r3r_A | 187 | Ferripyochelin binding protein; structural genomic | 99.43 | |
| 3eg4_A | 304 | 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su | 99.43 | |
| 3fs8_A | 273 | QDTC; acetyltransferase, natural product, deoxysug | 99.43 | |
| 3r8y_A | 240 | 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- ac | 99.42 | |
| 2pig_A | 334 | Putative transferase; SCR6, NESG, YDCK, structural | 99.41 | |
| 3vbi_A | 205 | ANTD, galactoside O-acetyltransferase; anthrose, a | 99.41 | |
| 2iu8_A | 374 | LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-a | 99.41 | |
| 3tk8_A | 316 | 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su | 99.4 | |
| 3r5d_A | 347 | Tetrahydrodipicolinate N-succinyletransferase; 1.8 | 99.4 | |
| 3t57_A | 305 | UDP-N-acetylglucosamine O-acyltransferase domain- | 99.4 | |
| 3r1w_A | 189 | Carbonic anhydrase; beta-helix, lyase; 1.73A {Unid | 99.4 | |
| 3gos_A | 276 | 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su | 99.39 | |
| 1w55_A | 371 | ISPD/ISPF bifunctional enzyme; biosynthetic pathwa | 99.39 | |
| 3gos_A | 276 | 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su | 99.39 | |
| 3eg4_A | 304 | 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su | 99.38 | |
| 2e8b_A | 201 | Probable molybdopterin-guanine dinucleotide biosy | 99.37 | |
| 3fsy_A | 332 | Tetrahydrodipicolinate N-succinyltransferase; beta | 99.36 | |
| 1hm9_A | 468 | GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltr | 99.36 | |
| 3ngw_A | 208 | Molybdopterin-guanine dinucleotide biosynthesis P | 99.36 | |
| 3c8v_A | 496 | Putative acetyltransferase; YP_390128.1, structura | 99.35 | |
| 3tk8_A | 316 | 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su | 99.35 | |
| 2v0h_A | 456 | Bifunctional protein GLMU; cell WALL, magnesium, c | 99.35 | |
| 3jqy_B | 252 | NEUO, polysialic acid O-acetyltransferase; LEFT-ha | 99.34 | |
| 3fsy_A | 332 | Tetrahydrodipicolinate N-succinyltransferase; beta | 99.31 | |
| 3nz2_A | 195 | Hexapeptide-repeat containing-acetyltransferase; s | 99.29 | |
| 2wlg_A | 215 | Polysialic acid O-acetyltransferase; enzyme, LEFT- | 99.28 | |
| 3r5d_A | 347 | Tetrahydrodipicolinate N-succinyletransferase; 1.8 | 99.28 | |
| 2rij_A | 387 | Putative 2,3,4,5-tetrahydropyridine-2-carboxylate | 99.27 | |
| 3jqy_B | 252 | NEUO, polysialic acid O-acetyltransferase; LEFT-ha | 99.24 | |
| 3ftt_A | 199 | Putative acetyltransferase sacol2570; galactoside | 99.24 | |
| 4fce_A | 459 | Bifunctional protein GLMU; GLMU. csgid, niaid, str | 99.23 | |
| 3brk_X | 420 | Glucose-1-phosphate adenylyltransferase; ADP-gluco | 99.22 | |
| 3srt_A | 188 | Maltose O-acetyltransferase; structural genomics, | 99.21 | |
| 3hjj_A | 190 | Maltose O-acetyltransferase; LEFT-handed beta-heli | 99.21 | |
| 3st8_A | 501 | Bifunctional protein GLMU; acetyltransferase, pyro | 99.21 | |
| 2oeg_A | 505 | UTP-glucose-1-phosphate uridylyltransferase 2, put | 99.2 | |
| 3q1x_A | 313 | Serine acetyltransferase; cysteine biosynthesis, L | 99.2 | |
| 3q1x_A | 313 | Serine acetyltransferase; cysteine biosynthesis, L | 99.18 | |
| 1krr_A | 203 | Galactoside O-acetyltransferase; LEFT-handed paral | 99.16 | |
| 1ocx_A | 182 | Maltose O-acetyltransferase; LEFT-handed parallel | 99.15 | |
| 3mc4_A | 287 | WW/RSP5/WWP domain:bacterial transferase hexapept | 99.14 | |
| 3f1x_A | 310 | Serine acetyltransferase; NESG X-RAY BVR62 A6KZB9 | 99.13 | |
| 2p2o_A | 185 | Maltose transacetylase; GK1921, GKA001001921.1, ge | 99.11 | |
| 2wlg_A | 215 | Polysialic acid O-acetyltransferase; enzyme, LEFT- | 99.1 | |
| 3f1x_A | 310 | Serine acetyltransferase; NESG X-RAY BVR62 A6KZB9 | 99.1 | |
| 2yqc_A | 486 | UDP-N-acetylglucosamine pyrophosphorylase; uridine | 99.08 | |
| 3oc9_A | 405 | UDP-N-acetylglucosamine pyrophosphorylase; structu | 99.08 | |
| 4hur_A | 220 | Virginiamycin A acetyltransferase; structural geno | 99.05 | |
| 2rij_A | 387 | Putative 2,3,4,5-tetrahydropyridine-2-carboxylate | 99.04 | |
| 1ssq_A | 267 | SAT, serine acetyltransferase; LEFT-handed paralle | 99.04 | |
| 4hur_A | 220 | Virginiamycin A acetyltransferase; structural geno | 99.04 | |
| 3nz2_A | 195 | Hexapeptide-repeat containing-acetyltransferase; s | 99.04 | |
| 1yp2_A | 451 | Glucose-1-phosphate adenylyltransferase small subu | 99.04 | |
| 3hjj_A | 190 | Maltose O-acetyltransferase; LEFT-handed beta-heli | 99.03 | |
| 1t3d_A | 289 | SAT, serine acetyltransferase; LEFT-handed-beta-he | 99.01 | |
| 3srt_A | 188 | Maltose O-acetyltransferase; structural genomics, | 99.01 | |
| 3ftt_A | 199 | Putative acetyltransferase sacol2570; galactoside | 99.0 | |
| 1ssq_A | 267 | SAT, serine acetyltransferase; LEFT-handed paralle | 98.95 | |
| 1t3d_A | 289 | SAT, serine acetyltransferase; LEFT-handed-beta-he | 98.92 | |
| 1krr_A | 203 | Galactoside O-acetyltransferase; LEFT-handed paral | 98.9 | |
| 1ocx_A | 182 | Maltose O-acetyltransferase; LEFT-handed parallel | 98.89 | |
| 2p2o_A | 185 | Maltose transacetylase; GK1921, GKA001001921.1, ge | 98.83 | |
| 3eev_A | 212 | Chloramphenicol acetyltransferase; beta-helix, str | 98.76 | |
| 4e8l_A | 219 | Virginiamycin A acetyltransferase; structural geno | 98.72 | |
| 4e8l_A | 219 | Virginiamycin A acetyltransferase; structural geno | 98.71 | |
| 3eev_A | 212 | Chloramphenicol acetyltransferase; beta-helix, str | 98.71 | |
| 1xat_A | 212 | Xenobiotic acetyltransferase; chloramphenicol, LEF | 98.62 | |
| 1mr7_A | 209 | Streptogramin A acetyltransferase; LEFT-handed par | 98.62 | |
| 1mr7_A | 209 | Streptogramin A acetyltransferase; LEFT-handed par | 98.49 | |
| 1xat_A | 212 | Xenobiotic acetyltransferase; chloramphenicol, LEF | 98.36 | |
| 3r3i_A | 528 | UTP--glucose-1-phosphate uridylyltransferase; ross | 97.88 | |
| 2i5e_A | 211 | Hypothetical protein MM_2497; APC86122, methanosar | 97.64 | |
| 3gue_A | 484 | UTP-glucose-1-phosphate uridylyltransferase 2; pho | 96.07 | |
| 3ogz_A | 630 | UDP-sugar pyrophosphorylase; LEFT handed beta heli | 95.69 | |
| 1qg8_A | 255 | Protein (spore coat polysaccharide biosynthesis P | 87.8 | |
| 3bcv_A | 240 | Putative glycosyltransferase protein; protein stru | 85.37 | |
| 3cgx_A | 242 | Putative nucleotide-diphospho-sugar transferase; Y | 83.98 |
| >1yp2_A Glucose-1-phosphate adenylyltransferase small subunit; ADP-glucose synthase, ADP-glucose pyrophosphorylase, agpase B; HET: PMB; 2.11A {Solanum tuberosum} SCOP: b.81.1.4 c.68.1.6 PDB: 1yp3_A* 1yp4_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=2.4e-45 Score=373.73 Aligned_cols=352 Identities=20% Similarity=0.335 Sum_probs=250.0
Q ss_pred CceEEEEecCCCCCCcCCCCCCCcccccccCCc-chHHHHHHHHHHCCCCEEEEEecCchhhHHHHhhhhhhc---cC--
Q 012817 2 DFQVVVLAGGTSKKLVPLVSKEVPKALLPVANR-PVLSYVLEQLELSNIKDLIVVVEGADAALRVGGWISAAY---VD-- 75 (456)
Q Consensus 2 ~~~aiIlagG~g~rl~pl~~~~~pK~llpi~gk-pli~~~l~~l~~~gi~~v~iv~~~~~~~~~i~~~~~~~~---~~-- 75 (456)
+|+|||||||.|+||+|| |...||+|+|++|+ |||+|+|++|.++|+++++|++++.. +.+.+++.+.+ ..
T Consensus 20 ~~~avILAaG~gtRl~pl-T~~~pK~llpi~g~~pli~~~l~~l~~~g~~~i~vv~~~~~--~~i~~~~~~~~~~~~~~~ 96 (451)
T 1yp2_A 20 SVLGIILGGGAGTRLYPL-TKKRAKPAVPLGANYRLIDIPVSNCLNSNISKIYVLTQFNS--ASLNRHLSRAYASNMGGY 96 (451)
T ss_dssp HEEEEEC------CCTTT-TTTSCGGGCEETTTEETTHHHHHHHHHTTCCEEEEEESCCC--HHHHHHHHHHCC------
T ss_pred ceEEEEECCCCCCcccch-hcCCcceeeEECCcceeHHHHHHHHHHCCCCEEEEEeccCH--HHHHHHHhhhhhcccccc
Confidence 489999999999999999 88999999999999 99999999999999999999998653 24544443321 10
Q ss_pred --ccceEEEEc--cC-----CcChHHHHHHHHhcCC---CCcEEEEcCCcccCCChhHHHHHHHhcCceEEEEEeecccC
Q 012817 76 --RLHVEVATV--PE-----DVGTAGALRAIAHHLT---AKDVLVVSGDLVSDVPPGAVTAAHRRHDAVVTAMICSVPVS 143 (456)
Q Consensus 76 --~~~i~~~~~--~~-----~~gt~~al~~~~~~l~---~~~~lv~~~D~i~~~~l~~~l~~~~~~~a~~t~~~~~~~~~ 143 (456)
...+.+... .. ..|++++++.+++.+. +++|++++||++++.++.++++.|++.++++|+++.+.+..
T Consensus 97 ~~~~~v~i~~~~~~~~~~~~~~Gt~~al~~a~~~~~~~~~~~~lv~~~D~~~~~~l~~l~~~~~~~~~~~tl~~~~~~~~ 176 (451)
T 1yp2_A 97 KNEGFVEVLAAQQSPENPDWFQGTADAVRQYLWLFEEHTVLEYLILAGDHLYRMDYEKFIQAHRETDADITVAALPMDEK 176 (451)
T ss_dssp --CCEEEEEESCSSTTSCCCCCSHHHHHHHTHHHHTTSCCSEEEEECSCEECCCCHHHHHHHHHHTTCSEEEEEEEECHH
T ss_pred cccCcEEEecccccccccccccCcHHHHHHHHHHHHhcCCCeEEEecCcEEEcCCHHHHHHHHHHcCCcEEEEEEEcChh
Confidence 001334321 11 3799999999887764 46799999999999999999999999899998887765321
Q ss_pred CCccCCCCCCcccCCCCCcccEEEecCCCcEEEEeecccccc--cccccchHHHhhccee-EEecCCccceEEeechHHH
Q 012817 144 GLSEAGSSGAKDKTKKPGRYNIIGMDPTKQFLLHIATGAELE--KDTRIRKSILRAVGQM-DIRADLMDAHMYAFNRSVL 220 (456)
Q Consensus 144 ~~~~~~~~~~~~~~~~~~~~~iv~~d~~~~~l~~~~~~~~~~--k~~~~~~~~~~~~~~~-~~~~~~~~~giYi~~~~vl 220 (456)
+ +..|+++.+|++++ +..+.++++.+ +...++..++.+++.. ...++++++|+|+|++++|
T Consensus 177 ~---------------~~~~g~v~~d~~~~-v~~~~ekp~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~Giy~~~~~~l 240 (451)
T 1yp2_A 177 R---------------ATAFGLMKIDEEGR-IIEFAEKPQGEQLQAMKVDTTILGLDDKRAKEMPFIASMGIYVISKDVM 240 (451)
T ss_dssp H---------------HTTSEEEEECTTSB-EEEEEESCCHHHHHHTCCCGGGGSCCHHHHHHCCEEEEEEEEEEEHHHH
T ss_pred h---------------cccCCEEEECCCCC-EEEEEECCCchhhccccccccccccccccccCCcceEEeeEEEEcHHHH
Confidence 1 45689999997766 45555433211 0011111222111110 0024678999999999998
Q ss_pred HHHHhcC-ccccccccchhHHHhHhccccccccCCCCCCccccccCCCcchhhhhccCCCCcccccccCCCCCCCCCCcc
Q 012817 221 QEVLDQK-DKFQSLKQDVLPYLVRSQLKSEILINGAPQGQQAKENGNDKVSYRILANASTPSFHELYALGPNGSAPVRRT 299 (456)
Q Consensus 221 ~~~~~~~-~~~~s~~~d~l~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 299 (456)
..++++. ....++.+|+++.+++++
T Consensus 241 ~~~l~~~~~~~~~~~~~~l~~~i~~g------------------------------------------------------ 266 (451)
T 1yp2_A 241 LNLLRDKFPGANDFGSEVIPGATSLG------------------------------------------------------ 266 (451)
T ss_dssp HHHHHTTCTTCCCTTTTHHHHHHHTT------------------------------------------------------
T ss_pred HHHHHhhcccccchHhhHHHHHHhcC------------------------------------------------------
Confidence 7666543 233566678888877542
Q ss_pred eeeEEEEecCcchhhcccCHHHHHHHhHhhhccc-ccc---CCCcccCCCceeCCCCEeCCCcEECCCCEECCCCEECCC
Q 012817 300 HKCCVYIASNSKYCVRLNSIQAFMDINRDVIGEA-NHL---SGYNFSAQNNIIHPSAELGSKTTVGPHCMLGEGSQMGDK 375 (456)
Q Consensus 300 ~~~~~yi~~~~~~~~~i~~~~~y~~~~~~~l~~~-~~~---~~~~~~~~~~~i~~~~~i~~~~~i~~~~~i~~~~~I~~~ 375 (456)
.++.+| ...++|.+++++++|++++++++.+. ... .....++....++|++.| .++.| .++.||++|.|+.
T Consensus 267 ~~v~~~--~~~~~w~digt~~~l~~a~~~l~~~~~~~~~~~~~~~~i~~~~~i~~~~~i-~~~~I-~~~~Ig~~~~I~~- 341 (451)
T 1yp2_A 267 MRVQAY--LYDGYWEDIGTIEAFYNANLGITKKPVPDFSFYDRSAPIYTQPRYLPPSKM-LDADV-TDSVIGEGCVIKN- 341 (451)
T ss_dssp CCEEEE--ECCSCCEECSSHHHHHHHHHGGGCSSSCSSCSCCSSSCCCCCCCCCCCEEE-EEEEE-EEEEECTTCEEEE-
T ss_pred CceEEE--EeCCEEEECCCHHHHHHHHHHHhcccccchhccCCCCeeccCCccCCCeEE-cceEE-eCeEECCCCEEcc-
Confidence 223444 45679999999999999999987653 111 112223344555555555 45666 5688888888886
Q ss_pred CeEeeeEECCCCEECCCcEEeCeEECCC-------------------CEECCCcEEcCeEECCCCEECCCcEecC
Q 012817 376 CSVKRSVIGRHCRIGSNVKVVNSVVMNH-------------------VTIGDGCSIQGSVICSNAQLQERVALKD 431 (456)
Q Consensus 376 ~~i~~s~Ig~~~~ig~~~~i~~s~i~~~-------------------~~ig~~~~i~~~ii~~~~~I~~~~~i~~ 431 (456)
+.|.+++||++|.||++|.|.+++++++ +.||++|+|++++|+++|.||++++|.+
T Consensus 342 ~~i~~~~Ig~~~~Ig~~~~I~~~~~~~~~~~~~~~~~~~~~~~g~~~~~Ig~~~~i~~~~Ig~~~~IG~~~~i~~ 416 (451)
T 1yp2_A 342 CKIHHSVVGLRSCISEGAIIEDSLLMGADYYETDADRKLLAAKGSVPIGIGKNCHIKRAIIDKNARIGDNVKIIN 416 (451)
T ss_dssp EEEESCEECTTCEECTTCEEESCEECCCSSCCCHHHHHHHHTTTCCCSEECTTCEEESEEECTTCEECTTCEECC
T ss_pred eEEeccEECCCCEECCCCEEcCceEECCCCcccccccccccccCceeEEECCCCEEeccEeCCCcEECCCCEEeC
Confidence 7888999999999999999999998888 9999999999999999999999998864
|
| >3brk_X Glucose-1-phosphate adenylyltransferase; ADP-glucose pyrophosphorylase, allostery, kinetics, structure-function relationships; 2.10A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >3st8_A Bifunctional protein GLMU; acetyltransferase, pyrophosphorylase, rossmann fold, LEFT-handed-beta-helix, cell shape; HET: COA GP1 UD1; 1.98A {Mycobacterium tuberculosis} PDB: 3spt_A* 3foq_A 3dk5_A 3d8v_A 3d98_A* 3dj4_A 2qkx_A* | Back alignment and structure |
|---|
| >2ggo_A 401AA long hypothetical glucose-1-phosphate thymidylyltransferase; beta barrel; 1.80A {Sulfolobus tokodaii} PDB: 2ggq_A* | Back alignment and structure |
|---|
| >1hm9_A GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltransfe; acetyltransferase, bifunctional, drug design; HET: ACO UD1; 1.75A {Streptococcus pneumoniae} SCOP: b.81.1.4 c.68.1.5 PDB: 1hm8_A* 1hm0_A* 4ac3_A* 4aaw_A* 1g97_A* 1g95_A* | Back alignment and structure |
|---|
| >4fce_A Bifunctional protein GLMU; GLMU. csgid, niaid, structural genomics, national institute allergy and infectious diseases; HET: GP1; 1.96A {Yersinia pseudotuberculosis} PDB: 3fww_A 1hv9_A* 2oi5_A* 2oi6_A* 2oi7_A* 1fxj_A* 1fwy_A* | Back alignment and structure |
|---|
| >2v0h_A Bifunctional protein GLMU; cell WALL, magnesium, cell shape, transferase, peptidoglycan synthesis, associative mechanism; 1.79A {Haemophilus influenzae} PDB: 2v0i_A* 2v0j_A* 2v0k_A* 2v0l_A* 2vd4_A* 2w0v_A* 2w0w_A* 3twd_A* | Back alignment and structure |
|---|
| >3juk_A UDP-glucose pyrophosphorylase (GALU); transfer; HET: UPG; 2.30A {Helicobacter pylori} PDB: 3juj_A* | Back alignment and structure |
|---|
| >4ecm_A Glucose-1-phosphate thymidylyltransferase; HET: DAU; 2.30A {Bacillus anthracis} PDB: 3hl3_A* | Back alignment and structure |
|---|
| >1tzf_A Glucose-1-phosphate cytidylyltransferase; nucleotidyltransferase, mixed alpha/beta fold; HET: C5G; 2.10A {Salmonella enterica subsp} SCOP: c.68.1.13 PDB: 1wvc_A* | Back alignment and structure |
|---|
| >2ux8_A Glucose-1-phosphate uridylyltransferase; UGPG, GALU pyrophosphorylase, nucleotidyltransferase; HET: G1P; 2.65A {Sphingomonas elodea} | Back alignment and structure |
|---|
| >3pnn_A Conserved domain protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; HET: MSE GOL; 1.90A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >2e3d_A UTP--glucose-1-phosphate uridylyltransferase; UDP-glucose, carbohydrate, pyrophosphorylase; 1.95A {Escherichia coli} | Back alignment and structure |
|---|
| >2pa4_A UTP-glucose-1-phosphate uridylyltransferase; phosphorylase, nucleotidyltransferase, metabolism; HET: GUD; 2.00A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >1fxo_A Glucose-1-phosphate thymidylyltransferase; rhamnose, nucleotidyltransferase, pyrophosphorylase, allostery; HET: TMP; 1.66A {Pseudomonas aeruginosa} SCOP: c.68.1.6 PDB: 1fzw_A 1g0r_A* 1g1l_A* 1g23_A* 1g2v_A* 1g3l_A* 1h5r_A* 1h5s_C* 1h5t_A* 1h5s_D* 1h5s_A* 1h5r_B* 1h5s_B* 1h5t_B* 1iim_A* 1iin_A* 3pkp_A* 3pkq_A* 1mp5_A* 1mp3_A* ... | Back alignment and structure |
|---|
| >4evw_A Nucleoside-diphosphate-sugar pyrophosphorylase; structural genomics, PSI-biology; HET: MSE; 1.90A {Vibrio cholerae} | Back alignment and structure |
|---|
| >1lvw_A Glucose-1-phosphate thymidylyltransferase; protein nucleotide complex, nucleotide binding fold; HET: TYD; 1.70A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.68.1.6 | Back alignment and structure |
|---|
| >1mc3_A Glucose-1-phosphate thymidylyltransferase; glucose-1-phosphate thymidylytransferase, RFFH; HET: TTP; 2.60A {Escherichia coli} SCOP: c.68.1.6 | Back alignment and structure |
|---|
| >2qh5_A PMI, ALGA, mannose-6-phosphate isomerase; structural genomics, PSI, protein structure initi nysgrc; 2.30A {Helicobacter pylori} | Back alignment and structure |
|---|
| >2x65_A Mannose-1-phosphate guanylyltransferase; nucleotidyltransferase; HET: M1P; 2.10A {Thermotoga maritima} PDB: 2x5z_A* 2x60_A* 2x5s_A* | Back alignment and structure |
|---|
| >3oam_A 3-deoxy-manno-octulosonate cytidylyltransferase; center for structural genomics of infectious diseases; 1.75A {Vibrio cholerae o1 biovar el tor} SCOP: c.68.1.13 | Back alignment and structure |
|---|
| >2cu2_A Putative mannose-1-phosphate guanylyl transferase; mannose-1-phosphate geranyltransferase, thermus thermophilus structural genomics; 2.20A {Thermus thermophilus} SCOP: b.81.4.1 c.68.1.20 | Back alignment and structure |
|---|
| >1jyk_A LICC protein, CTP:phosphocholine cytidylytransferase; 3D structure, CTP:phosphocholine cytidylyltransferase; 1.50A {Streptococcus pneumoniae} SCOP: c.68.1.13 PDB: 1jyl_A* | Back alignment and structure |
|---|
| >3k8d_A 3-deoxy-manno-octulosonate cytidylyltransferase; KDSB synthetase KDO complex, lipopolysaccharide biosynthesis magnesium, nucleotidyltransferase; HET: KDO CTP; 1.90A {Escherichia coli} SCOP: c.68.1.13 PDB: 3k8e_C 1vh1_A 3jtj_A* | Back alignment and structure |
|---|
| >3tqd_A 3-deoxy-manno-octulosonate cytidylyltransferase; cell envelope; 1.80A {Coxiella burnetii} SCOP: c.68.1.0 | Back alignment and structure |
|---|
| >2y6p_A 3-deoxy-manno-octulosonate cytidylyltransferase; lipid A; HET: CTP; 2.10A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >4fcu_A 3-deoxy-manno-octulosonate cytidylyltransferase; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.90A {Acinetobacter baumannii} PDB: 3pol_A | Back alignment and structure |
|---|
| >1h7e_A 3-deoxy-manno-octulosonate cytidylyltransferase; nucleotidyltransferase, CMP-KDO synthetase, nucleoside monophosphate glycosides; 1.83A {Escherichia coli} SCOP: c.68.1.13 PDB: 1gqc_A* 1gq9_A 1h6j_A 1h7f_A* 1h7g_A* 1h7h_A* 1h7t_A* | Back alignment and structure |
|---|
| >1vic_A 3-deoxy-manno-octulosonate cytidylyltransferase; structural genomics; 1.80A {Haemophilus influenzae} SCOP: c.68.1.13 PDB: 1vh3_A 3duv_A* | Back alignment and structure |
|---|
| >2iu8_A LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; UDP-3- O-acyl-glucosamine N-acyltransferase, lipid A biosynthesis; HET: PLM UD1; 2.2A {Chlamydia trachomatis} PDB: 2iu9_A* 2iua_A* | Back alignment and structure |
|---|
| >3f1c_A Putative 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase 2; structural genomics, PSI-2, protein structure initiative; 2.30A {Listeria monocytogenes str} SCOP: c.68.1.0 | Back alignment and structure |
|---|
| >1ezi_A CMP-N-acetylneuraminic acid synthetase; homodimer, alpha-beta-alpha, transferase; 2.00A {Neisseria meningitidis} SCOP: c.68.1.13 PDB: 1eyr_A | Back alignment and structure |
|---|
| >2vsh_A TARI, 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; nucleotidyltransferase; HET: 1PE PG4 P6G; 2.00A {Streptococcus pneumoniae} PDB: 2vsi_A* | Back alignment and structure |
|---|
| >2xwl_A 2-C-methyl-D-erythritol 4-phosphate cytidylyltran; transferase, MEP pathway; HET: CTP; 1.49A {Mycobacterium smegmatis} PDB: 2xwm_A* | Back alignment and structure |
|---|
| >2dpw_A Hypothetical protein TTHA0179; transferase, structural genomics, NPPSFA, national project O structural and functional analyses; 2.90A {Thermus thermophilus} SCOP: c.68.1.19 | Back alignment and structure |
|---|
| >2xme_A CTP-inositol-1-phosphate cytidylyltransferase; CDP-inositol, DI-MYO-inositol phosphate; 1.89A {Archaeoglobus fulgidus} PDB: 2xmh_A* | Back alignment and structure |
|---|
| >2yc3_A 2-C-methyl-D-erythritol 4-phosphate cytidylyltran chloroplastic; transferase, non-mevalonate-pathway, herbicide, allosteric P; HET: MW5; 1.40A {Arabidopsis thaliana} PDB: 2yc5_A* 1w77_A* 2ycm_A* | Back alignment and structure |
|---|
| >3r8y_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- acetyltransferase; structural genomics, csgid; 1.70A {Bacillus anthracis} PDB: 3cj8_A* | Back alignment and structure |
|---|
| >1vgw_A 4-diphosphocytidyl-2C-methyl-D-erythritol synthas; structural genomics, transferase; 2.35A {Neisseria gonorrhoeae} SCOP: c.68.1.13 PDB: 1vgz_A | Back alignment and structure |
|---|
| >3ixc_A Hexapeptide transferase family protein; niaid, ssgcid, seattle structural genomics center for infect disease, GRAM-negative bacteria; 1.61A {Anaplasma phagocytophilum} | Back alignment and structure |
|---|
| >1xhd_A Putative acetyltransferase/acyltransferase; structural genomics, protein structure initiative, medwest C structural genomics, MCSG; 1.90A {Bacillus cereus} SCOP: b.81.1.5 PDB: 3vnp_A 2eg0_A | Back alignment and structure |
|---|
| >3tv0_A Dynactin subunit 6; LEFT-handed beta-helix, ARP11, cytosol, structural; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >1qwj_A Cytidine monophospho-N-acetylneuraminic acid synthetase; CMP-5-N-acetylneuraminic acid synthetase, CMP-NEU5AC, sialic acid, glycosylation; HET: NCC; 2.80A {Mus musculus} SCOP: c.68.1.13 | Back alignment and structure |
|---|
| >3rsb_A Adenosylcobinamide-phosphate guanylyltransferase; pyrophosphorylase binding motif, pyrophosphorylase; HET: GTP; 2.80A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1i52_A 4-diphosphocytidyl-2-C-methylerythritol synthase; cytidylyltransferase, deoxyxylulose-5-phosphate pathway (DXP isoprenoid biosynthesys, MEP; HET: CTP; 1.50A {Escherichia coli} SCOP: c.68.1.13 PDB: 1ini_A* 1inj_A 1vgt_A 1vgu_A 3n9w_A 1h3m_A | Back alignment and structure |
|---|
| >3mqg_A Lipopolysaccharides biosynthesis acetyltransferas; beta helix, acetyl transferase, transferase; HET: ACO U5P UDP PE4; 1.43A {Bordetella petrii} PDB: 3mqh_A* | Back alignment and structure |
|---|
| >3r3r_A Ferripyochelin binding protein; structural genomics, csgid, center for structural genomics O infectious diseases, all beta protein; 1.20A {Salmonella enterica subsp} SCOP: b.81.1.0 PDB: 3tio_A 3tis_A | Back alignment and structure |
|---|
| >1v3w_A Ferripyochelin binding protein; beta-helix, carbonic anhydrase, structural genomics, riken S genomics/proteomics initiative, RSGI, lyase; 1.50A {Pyrococcus horikoshii} SCOP: b.81.1.5 PDB: 1v67_A 2fko_A | Back alignment and structure |
|---|
| >2wee_A MOBA-related protein; unknown function; 1.65A {Mycobacterium tuberculosis H37RV} PDB: 2we9_A 2yes_A | Back alignment and structure |
|---|
| >3kwd_A Carbon dioxide concentrating mechanism protein; LEFT-handed beta helix, gamma carbonic anhydrase, disulfide dependent activity; 1.10A {Thermosynechococcus elongatus} PDB: 3kwe_A 3kwc_A | Back alignment and structure |
|---|
| >2waw_A MOBA relate protein; unknown function; HET: PGE; 1.60A {Mycobacterium SP} | Back alignment and structure |
|---|
| >1vpa_A 2-C-methyl-D-erythritol 4-phosphate cytidylyltran; TM1393, JCSG, joint center for structural GENO PSI, protein structure initiative; HET: CTP; 2.67A {Thermotoga maritima} SCOP: c.68.1.13 | Back alignment and structure |
|---|
| >3q80_A 2-C-methyl-D-erythritol 4-phosphate cytidyltransf; TB structural genomics consortium, TBSGC, rossman fold; HET: CDM; 2.00A {Mycobacterium tuberculosis} SCOP: c.68.1.0 PDB: 3q7u_A* 3okr_A 2xwn_A* | Back alignment and structure |
|---|
| >3kwd_A Carbon dioxide concentrating mechanism protein; LEFT-handed beta helix, gamma carbonic anhydrase, disulfide dependent activity; 1.10A {Thermosynechococcus elongatus} PDB: 3kwe_A 3kwc_A | Back alignment and structure |
|---|
| >2i5k_A UTP--glucose-1-phosphate uridylyltransferase; LEFT-handed beta-helix, SGC domain; 3.10A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3r1w_A Carbonic anhydrase; beta-helix, lyase; 1.73A {Unidentified} | Back alignment and structure |
|---|
| >2ggo_A 401AA long hypothetical glucose-1-phosphate thymidylyltransferase; beta barrel; 1.80A {Sulfolobus tokodaii} PDB: 2ggq_A* | Back alignment and structure |
|---|
| >3vbi_A ANTD, galactoside O-acetyltransferase; anthrose, acylated sugar, LEFT-handed beta helix, sugar N-AC transferase; HET: COA 0FX; 1.80A {Bacillus cereus} PDB: 3vbj_A* 3vbm_A* 3vbk_A* 3vbp_A* 3vbl_A* 3vbn_A* | Back alignment and structure |
|---|
| >1qre_A Carbonic anhydrase; beta-helix, lyase; 1.46A {Methanosarcina thermophila} SCOP: b.81.1.5 PDB: 1qq0_A 1qrf_A 1qrg_A 1qrm_A 1qrl_A 1thj_A 3otm_A 3ow5_A 3ou9_A 3otz_A 3oup_A | Back alignment and structure |
|---|
| >2px7_A 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; TTHA0171, ISPD_THET8, ISPD, structural genomics PSI; 2.20A {Thermus thermophilus HB8} | Back alignment and structure |
|---|
| >3fs8_A QDTC; acetyltransferase, natural product, deoxysugar; HET: ACO; 1.70A {Thermoanaerobacteriumthermosaccharolyticum} PDB: 3fsb_A* 3fsc_A* | Back alignment and structure |
|---|
| >3pmo_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; lipid A biosynthesis pathway, transferase; 1.30A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2qia_A UDP-N-acetylglucosamine acyltransferase; LEFT-handed parallel beta helix; HET: U20; 1.74A {Escherichia coli K12} SCOP: b.81.1.1 PDB: 1lxa_A 2jf3_A* 2aq9_A* 2qiv_X* 2jf2_A | Back alignment and structure |
|---|
| >4eqy_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; ssgcid, beta helix, structural genomics, seattle structural center for infectious disease, transferase; 1.80A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >3r0s_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; structural genomics; 2.30A {Campylobacter jejuni subsp} SCOP: b.81.1.0 | Back alignment and structure |
|---|
| >3r0s_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; structural genomics; 2.30A {Campylobacter jejuni subsp} SCOP: b.81.1.0 | Back alignment and structure |
|---|
| >4e79_A UDP-3-O-acylglucosamine N-acyltransferase; lipopolysaccaride synthesis; 2.66A {Acinetobacter baumannii} PDB: 4e75_A | Back alignment and structure |
|---|
| >3bfp_A Acetyltransferase; LEFT-handed beta helix, COA binding protein, N-glycan biosynthesis, bacillosamine, structural genomics, MKBSGI; HET: FLC; 1.75A {Campylobacter jejuni} SCOP: b.81.1.8 PDB: 2vhe_A* 3bsw_A* 3bss_A* 3bsy_A* 2npo_A | Back alignment and structure |
|---|
| >3eh0_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltransferase; LPXD, LEFT-handed parallel beta helix, acyl carrier protein, antibiotic resistance; 2.60A {Escherichia coli} | Back alignment and structure |
|---|
| >1j2z_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; UDP-N-acetylglucosamine acyltransferase, LPXA, LEFT-handed B structure; HET: SOG TLA; 2.10A {Helicobacter pylori} SCOP: b.81.1.1 | Back alignment and structure |
|---|
| >1qre_A Carbonic anhydrase; beta-helix, lyase; 1.46A {Methanosarcina thermophila} SCOP: b.81.1.5 PDB: 1qq0_A 1qrf_A 1qrg_A 1qrm_A 1qrl_A 1thj_A 3otm_A 3ow5_A 3ou9_A 3otz_A 3oup_A | Back alignment and structure |
|---|
| >4e6u_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; lipopolysaccaride synthesis; 1.41A {Acinetobacter baumannii} PDB: 4e6t_A* | Back alignment and structure |
|---|
| >4eqy_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; ssgcid, beta helix, structural genomics, seattle structural center for infectious disease, transferase; 1.80A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >3hsq_A Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosamine O-acyltransferase; L.interrogans LPXA, LPXA, LPXA acyltransferase; 2.10A {Leptospira interrogans} SCOP: b.81.1.0 PDB: 3i3a_A* 3i3x_A* | Back alignment and structure |
|---|
| >3c8v_A Putative acetyltransferase; YP_390128.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.28A {Desulfovibrio desulfuricans subsp} | Back alignment and structure |
|---|
| >4e6u_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; lipopolysaccaride synthesis; 1.41A {Acinetobacter baumannii} PDB: 4e6t_A* | Back alignment and structure |
|---|
| >3d5n_A Q97W15_sulso; NESG, SSR125, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.80A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3hsq_A Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosamine O-acyltransferase; L.interrogans LPXA, LPXA, LPXA acyltransferase; 2.10A {Leptospira interrogans} SCOP: b.81.1.0 PDB: 3i3a_A* 3i3x_A* | Back alignment and structure |
|---|
| >2pig_A Putative transferase; SCR6, NESG, YDCK, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.38A {Salmonella paratyphi} PDB: 2f9c_A | Back alignment and structure |
|---|
| >1jv1_A Glcnac1P uridyltransferase isoform 1: AGX1; nucleotidyltransferase, alternative splicing; HET: UD1; 1.90A {Homo sapiens} SCOP: c.68.1.5 PDB: 1jv3_A* 1jvg_A* 1jvd_A* 1vm8_A* | Back alignment and structure |
|---|
| >4ea9_A Perosamine N-acetyltransferase; beta helix, acetyl coenzyme A, GDP-perosa transferase; HET: JBT; 0.90A {Caulobacter vibrioides} PDB: 4ea8_A* 4ea7_A* 4eaa_A* 4eab_A* | Back alignment and structure |
|---|
| >3pmo_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; lipid A biosynthesis pathway, transferase; 1.30A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1xhd_A Putative acetyltransferase/acyltransferase; structural genomics, protein structure initiative, medwest C structural genomics, MCSG; 1.90A {Bacillus cereus} SCOP: b.81.1.5 PDB: 3vnp_A 2eg0_A | Back alignment and structure |
|---|
| >3t57_A UDP-N-acetylglucosamine O-acyltransferase domain- protein; LEFT-handed parallel beta helix, lipid A biosynthesis, lipid synthesis; 2.10A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3eh0_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltransferase; LPXD, LEFT-handed parallel beta helix, acyl carrier protein, antibiotic resistance; 2.60A {Escherichia coli} | Back alignment and structure |
|---|
| >3mqg_A Lipopolysaccharides biosynthesis acetyltransferas; beta helix, acetyl transferase, transferase; HET: ACO U5P UDP PE4; 1.43A {Bordetella petrii} PDB: 3mqh_A* | Back alignment and structure |
|---|
| >1j2z_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; UDP-N-acetylglucosamine acyltransferase, LPXA, LEFT-handed B structure; HET: SOG TLA; 2.10A {Helicobacter pylori} SCOP: b.81.1.1 | Back alignment and structure |
|---|
| >1v3w_A Ferripyochelin binding protein; beta-helix, carbonic anhydrase, structural genomics, riken S genomics/proteomics initiative, RSGI, lyase; 1.50A {Pyrococcus horikoshii} SCOP: b.81.1.5 PDB: 1v67_A 2fko_A | Back alignment and structure |
|---|
| >3bfp_A Acetyltransferase; LEFT-handed beta helix, COA binding protein, N-glycan biosynthesis, bacillosamine, structural genomics, MKBSGI; HET: FLC; 1.75A {Campylobacter jejuni} SCOP: b.81.1.8 PDB: 2vhe_A* 3bsw_A* 3bss_A* 3bsy_A* 2npo_A | Back alignment and structure |
|---|
| >4e79_A UDP-3-O-acylglucosamine N-acyltransferase; lipopolysaccaride synthesis; 2.66A {Acinetobacter baumannii} PDB: 4e75_A | Back alignment and structure |
|---|
| >2qia_A UDP-N-acetylglucosamine acyltransferase; LEFT-handed parallel beta helix; HET: U20; 1.74A {Escherichia coli K12} SCOP: b.81.1.1 PDB: 1lxa_A 2jf3_A* 2aq9_A* 2qiv_X* 2jf2_A | Back alignment and structure |
|---|
| >1e5k_A Molybdopterin-guanine dinucleotide biosynthesis protein A; molybdopterin nucleotidyl-transferase,; HET: CIT; 1.35A {Escherichia coli} SCOP: c.68.1.8 PDB: 1h4e_A* 1hjl_A* 1hjj_A* 1h4c_A* 1h4d_A* 1fr9_A 1frw_A* | Back alignment and structure |
|---|
| >3tv0_A Dynactin subunit 6; LEFT-handed beta-helix, ARP11, cytosol, structural; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >4ea9_A Perosamine N-acetyltransferase; beta helix, acetyl coenzyme A, GDP-perosa transferase; HET: JBT; 0.90A {Caulobacter vibrioides} PDB: 4ea8_A* 4ea7_A* 4eaa_A* 4eab_A* | Back alignment and structure |
|---|
| >3ixc_A Hexapeptide transferase family protein; niaid, ssgcid, seattle structural genomics center for infect disease, GRAM-negative bacteria; 1.61A {Anaplasma phagocytophilum} | Back alignment and structure |
|---|
| >3r3r_A Ferripyochelin binding protein; structural genomics, csgid, center for structural genomics O infectious diseases, all beta protein; 1.20A {Salmonella enterica subsp} SCOP: b.81.1.0 PDB: 3tio_A 3tis_A | Back alignment and structure |
|---|
| >3eg4_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; ssgcid, beta helix, acyltransferase, amino-acid biosynthesis, cytoplasm; 1.87A {Brucella suis} | Back alignment and structure |
|---|
| >3fs8_A QDTC; acetyltransferase, natural product, deoxysugar; HET: ACO; 1.70A {Thermoanaerobacteriumthermosaccharolyticum} PDB: 3fsb_A* 3fsc_A* | Back alignment and structure |
|---|
| >3r8y_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- acetyltransferase; structural genomics, csgid; 1.70A {Bacillus anthracis} PDB: 3cj8_A* | Back alignment and structure |
|---|
| >2pig_A Putative transferase; SCR6, NESG, YDCK, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.38A {Salmonella paratyphi} PDB: 2f9c_A | Back alignment and structure |
|---|
| >3vbi_A ANTD, galactoside O-acetyltransferase; anthrose, acylated sugar, LEFT-handed beta helix, sugar N-AC transferase; HET: COA 0FX; 1.80A {Bacillus cereus} PDB: 3vbj_A* 3vbm_A* 3vbk_A* 3vbp_A* 3vbl_A* 3vbn_A* | Back alignment and structure |
|---|
| >2iu8_A LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; UDP-3- O-acyl-glucosamine N-acyltransferase, lipid A biosynthesis; HET: PLM UD1; 2.2A {Chlamydia trachomatis} PDB: 2iu9_A* 2iua_A* | Back alignment and structure |
|---|
| >3tk8_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; ssgcid; 1.80A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >3r5d_A Tetrahydrodipicolinate N-succinyletransferase; 1.80A {Pseudomonas aeruginosa} PDB: 3r5b_A* 3r5c_A* 3r5a_A | Back alignment and structure |
|---|
| >3t57_A UDP-N-acetylglucosamine O-acyltransferase domain- protein; LEFT-handed parallel beta helix, lipid A biosynthesis, lipid synthesis; 2.10A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3r1w_A Carbonic anhydrase; beta-helix, lyase; 1.73A {Unidentified} | Back alignment and structure |
|---|
| >3gos_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransfera acyltransferase; 1.80A {Yersinia pestis} SCOP: b.81.1.2 PDB: 1kgq_A* 1kgt_A* 2tdt_A* 3tdt_A* 3bxy_A 1tdt_A | Back alignment and structure |
|---|
| >1w55_A ISPD/ISPF bifunctional enzyme; biosynthetic pathway, isoprenoids, nonmevalonate, transferase; HET: C GPP; 2.3A {Campylobacter jejuni} SCOP: c.68.1.13 d.79.5.1 PDB: 1w57_A* | Back alignment and structure |
|---|
| >3gos_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransfera acyltransferase; 1.80A {Yersinia pestis} SCOP: b.81.1.2 PDB: 1kgq_A* 1kgt_A* 2tdt_A* 3tdt_A* 3bxy_A 1tdt_A | Back alignment and structure |
|---|
| >3eg4_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; ssgcid, beta helix, acyltransferase, amino-acid biosynthesis, cytoplasm; 1.87A {Brucella suis} | Back alignment and structure |
|---|
| >2e8b_A Probable molybdopterin-guanine dinucleotide biosy protein A; putative protein, molybdenum cofactor, structural G NPPSFA; 1.61A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3fsy_A Tetrahydrodipicolinate N-succinyltransferase; beta helix, L beta H domain, acyltransferase; HET: SCA; 1.97A {Mycobacterium tuberculosis} PDB: 3fsx_A* | Back alignment and structure |
|---|
| >1hm9_A GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltransfe; acetyltransferase, bifunctional, drug design; HET: ACO UD1; 1.75A {Streptococcus pneumoniae} SCOP: b.81.1.4 c.68.1.5 PDB: 1hm8_A* 1hm0_A* 4ac3_A* 4aaw_A* 1g97_A* 1g95_A* | Back alignment and structure |
|---|
| >3ngw_A Molybdopterin-guanine dinucleotide biosynthesis P (MOBA); alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.31A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3c8v_A Putative acetyltransferase; YP_390128.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.28A {Desulfovibrio desulfuricans subsp} | Back alignment and structure |
|---|
| >3tk8_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; ssgcid; 1.80A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >2v0h_A Bifunctional protein GLMU; cell WALL, magnesium, cell shape, transferase, peptidoglycan synthesis, associative mechanism; 1.79A {Haemophilus influenzae} PDB: 2v0i_A* 2v0j_A* 2v0k_A* 2v0l_A* 2vd4_A* 2w0v_A* 2w0w_A* 3twd_A* | Back alignment and structure |
|---|
| >3jqy_B NEUO, polysialic acid O-acetyltransferase; LEFT-handed beta-helix polysia; HET: PEG; 1.70A {Escherichia coli} | Back alignment and structure |
|---|
| >3fsy_A Tetrahydrodipicolinate N-succinyltransferase; beta helix, L beta H domain, acyltransferase; HET: SCA; 1.97A {Mycobacterium tuberculosis} PDB: 3fsx_A* | Back alignment and structure |
|---|
| >3nz2_A Hexapeptide-repeat containing-acetyltransferase; structural genomics, center for structural genomics of infec diseases, csgid; HET: ACO; 2.35A {Vibrio cholerae o1 biovar eltor} SCOP: b.81.1.0 PDB: 3ect_A* | Back alignment and structure |
|---|
| >2wlg_A Polysialic acid O-acetyltransferase; enzyme, LEFT-handed beta HEL; HET: SOP; 1.90A {Neisseria meningitidis serogroup Y} PDB: 2wld_A 2wle_A* 2wlf_A* 2wlc_A* | Back alignment and structure |
|---|
| >3r5d_A Tetrahydrodipicolinate N-succinyletransferase; 1.80A {Pseudomonas aeruginosa} PDB: 3r5b_A* 3r5c_A* 3r5a_A | Back alignment and structure |
|---|
| >2rij_A Putative 2,3,4,5-tetrahydropyridine-2-carboxylate succinyltransferase; structural genomics, joint center for structural genomics; HET: MSE CIT; 1.90A {Campylobacter jejuni} | Back alignment and structure |
|---|
| >3jqy_B NEUO, polysialic acid O-acetyltransferase; LEFT-handed beta-helix polysia; HET: PEG; 1.70A {Escherichia coli} | Back alignment and structure |
|---|
| >3ftt_A Putative acetyltransferase sacol2570; galactoside O-acetyltransferase, enzyme, structural genomics, acyltransferase; 1.60A {Staphylococcus aureus subsp} PDB: 3v4e_A* 4dcl_A 4egg_A | Back alignment and structure |
|---|
| >4fce_A Bifunctional protein GLMU; GLMU. csgid, niaid, structural genomics, national institute allergy and infectious diseases; HET: GP1; 1.96A {Yersinia pseudotuberculosis} PDB: 3fww_A 1hv9_A* 2oi5_A* 2oi6_A* 2oi7_A* 1fxj_A* 1fwy_A* | Back alignment and structure |
|---|
| >3brk_X Glucose-1-phosphate adenylyltransferase; ADP-glucose pyrophosphorylase, allostery, kinetics, structure-function relationships; 2.10A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >3srt_A Maltose O-acetyltransferase; structural genomics, the center structural genomics of infectious diseases, csgid; 2.50A {Clostridium difficile} PDB: 4ebh_A* | Back alignment and structure |
|---|
| >3hjj_A Maltose O-acetyltransferase; LEFT-handed beta-helix, acyltransferase, struct genomics; 2.15A {Bacillus anthracis} SCOP: b.81.1.0 PDB: 3igj_A* | Back alignment and structure |
|---|
| >3st8_A Bifunctional protein GLMU; acetyltransferase, pyrophosphorylase, rossmann fold, LEFT-handed-beta-helix, cell shape; HET: COA GP1 UD1; 1.98A {Mycobacterium tuberculosis} PDB: 3spt_A* 3foq_A 3dk5_A 3d8v_A 3d98_A* 3dj4_A 2qkx_A* | Back alignment and structure |
|---|
| >2oeg_A UTP-glucose-1-phosphate uridylyltransferase 2, putative; rossmann-fold, beta-helix, pyrophosphorylase; HET: UPG; 2.30A {Leishmania major} PDB: 2oef_A* | Back alignment and structure |
|---|
| >3q1x_A Serine acetyltransferase; cysteine biosynthesis, LEFT handed helix, OASS; 1.59A {Entamoeba histolytica} PDB: 3p47_A 3p1b_A | Back alignment and structure |
|---|
| >3q1x_A Serine acetyltransferase; cysteine biosynthesis, LEFT handed helix, OASS; 1.59A {Entamoeba histolytica} PDB: 3p47_A 3p1b_A | Back alignment and structure |
|---|
| >1krr_A Galactoside O-acetyltransferase; LEFT-handed parallel beta helix; HET: ACO; 2.50A {Escherichia coli} SCOP: b.81.1.3 PDB: 1kqa_A* 1kru_A* 1krv_A* | Back alignment and structure |
|---|
| >1ocx_A Maltose O-acetyltransferase; LEFT-handed parallel beta-helix; 2.15A {Escherichia coli} SCOP: b.81.1.3 | Back alignment and structure |
|---|
| >3mc4_A WW/RSP5/WWP domain:bacterial transferase hexapept repeat:serine O-acetyltransferase...; ssgcid, structural genomics; 1.95A {Brucella melitensis biovar abortus} | Back alignment and structure |
|---|
| >3f1x_A Serine acetyltransferase; NESG X-RAY BVR62 A6KZB9 A6KZB9_BACV8, structural genomics, P protein structure initiative; 2.00A {Bacteroides vulgatus atcc 8482} | Back alignment and structure |
|---|
| >2p2o_A Maltose transacetylase; GK1921, GKA001001921.1, geobacillus kaustophilus structural genomics, PSI; 1.74A {Geobacillus kaustophilus} PDB: 2ic7_A | Back alignment and structure |
|---|
| >2wlg_A Polysialic acid O-acetyltransferase; enzyme, LEFT-handed beta HEL; HET: SOP; 1.90A {Neisseria meningitidis serogroup Y} PDB: 2wld_A 2wle_A* 2wlf_A* 2wlc_A* | Back alignment and structure |
|---|
| >3f1x_A Serine acetyltransferase; NESG X-RAY BVR62 A6KZB9 A6KZB9_BACV8, structural genomics, P protein structure initiative; 2.00A {Bacteroides vulgatus atcc 8482} | Back alignment and structure |
|---|
| >2yqc_A UDP-N-acetylglucosamine pyrophosphorylase; uridine-diphospho-N- acetylglucosamine, N-acetylglucosamine-1-phosphate, transferase; 1.90A {Candida albicans} PDB: 2yqh_A* 2yqj_A* 2yqs_A* | Back alignment and structure |
|---|
| >3oc9_A UDP-N-acetylglucosamine pyrophosphorylase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.80A {Entamoeba histolytica} | Back alignment and structure |
|---|
| >4hur_A Virginiamycin A acetyltransferase; structural genomics, antibiotic resistance, center for struc genomics of infectious diseases (csgid); HET: ACO; 2.15A {Staphylococcus aureus} PDB: 4hus_A* 4e8l_A | Back alignment and structure |
|---|
| >2rij_A Putative 2,3,4,5-tetrahydropyridine-2-carboxylate succinyltransferase; structural genomics, joint center for structural genomics; HET: MSE CIT; 1.90A {Campylobacter jejuni} | Back alignment and structure |
|---|
| >1ssq_A SAT, serine acetyltransferase; LEFT-handed parallel beta helix; 1.85A {Haemophilus influenzae} SCOP: b.81.1.6 PDB: 1sst_A* 1s80_A 1ssm_A 3gvd_A* | Back alignment and structure |
|---|
| >4hur_A Virginiamycin A acetyltransferase; structural genomics, antibiotic resistance, center for struc genomics of infectious diseases (csgid); HET: ACO; 2.15A {Staphylococcus aureus} PDB: 4hus_A* 4e8l_A | Back alignment and structure |
|---|
| >3nz2_A Hexapeptide-repeat containing-acetyltransferase; structural genomics, center for structural genomics of infec diseases, csgid; HET: ACO; 2.35A {Vibrio cholerae o1 biovar eltor} SCOP: b.81.1.0 PDB: 3ect_A* | Back alignment and structure |
|---|
| >1yp2_A Glucose-1-phosphate adenylyltransferase small subunit; ADP-glucose synthase, ADP-glucose pyrophosphorylase, agpase B; HET: PMB; 2.11A {Solanum tuberosum} SCOP: b.81.1.4 c.68.1.6 PDB: 1yp3_A* 1yp4_A* | Back alignment and structure |
|---|
| >3hjj_A Maltose O-acetyltransferase; LEFT-handed beta-helix, acyltransferase, struct genomics; 2.15A {Bacillus anthracis} SCOP: b.81.1.0 PDB: 3igj_A* | Back alignment and structure |
|---|
| >1t3d_A SAT, serine acetyltransferase; LEFT-handed-beta-helix, dimer of trimers; 2.20A {Escherichia coli} SCOP: b.81.1.6 | Back alignment and structure |
|---|
| >3srt_A Maltose O-acetyltransferase; structural genomics, the center structural genomics of infectious diseases, csgid; 2.50A {Clostridium difficile} PDB: 4ebh_A* | Back alignment and structure |
|---|
| >3ftt_A Putative acetyltransferase sacol2570; galactoside O-acetyltransferase, enzyme, structural genomics, acyltransferase; 1.60A {Staphylococcus aureus subsp} PDB: 3v4e_A* 4dcl_A 4egg_A | Back alignment and structure |
|---|
| >1ssq_A SAT, serine acetyltransferase; LEFT-handed parallel beta helix; 1.85A {Haemophilus influenzae} SCOP: b.81.1.6 PDB: 1sst_A* 1s80_A 1ssm_A 3gvd_A* | Back alignment and structure |
|---|
| >1t3d_A SAT, serine acetyltransferase; LEFT-handed-beta-helix, dimer of trimers; 2.20A {Escherichia coli} SCOP: b.81.1.6 | Back alignment and structure |
|---|
| >1krr_A Galactoside O-acetyltransferase; LEFT-handed parallel beta helix; HET: ACO; 2.50A {Escherichia coli} SCOP: b.81.1.3 PDB: 1kqa_A* 1kru_A* 1krv_A* | Back alignment and structure |
|---|
| >1ocx_A Maltose O-acetyltransferase; LEFT-handed parallel beta-helix; 2.15A {Escherichia coli} SCOP: b.81.1.3 | Back alignment and structure |
|---|
| >2p2o_A Maltose transacetylase; GK1921, GKA001001921.1, geobacillus kaustophilus structural genomics, PSI; 1.74A {Geobacillus kaustophilus} PDB: 2ic7_A | Back alignment and structure |
|---|
| >3eev_A Chloramphenicol acetyltransferase; beta-helix, structural genomics, center for STR genomics of infectious diseases, csgid; 2.61A {Vibrio cholerae o1 biovar el tor} SCOP: b.81.1.3 | Back alignment and structure |
|---|
| >4e8l_A Virginiamycin A acetyltransferase; structural genomics, antibiotic resistance, center for struc genomics of infectious diseases (csgid); 2.70A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >4e8l_A Virginiamycin A acetyltransferase; structural genomics, antibiotic resistance, center for struc genomics of infectious diseases (csgid); 2.70A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3eev_A Chloramphenicol acetyltransferase; beta-helix, structural genomics, center for STR genomics of infectious diseases, csgid; 2.61A {Vibrio cholerae o1 biovar el tor} SCOP: b.81.1.3 | Back alignment and structure |
|---|
| >1xat_A Xenobiotic acetyltransferase; chloramphenicol, LEFT-handed helix; 3.20A {Pseudomonas aeruginosa} SCOP: b.81.1.3 PDB: 2xat_A* | Back alignment and structure |
|---|
| >1mr7_A Streptogramin A acetyltransferase; LEFT-handed parallel beta-helix domain; 1.80A {Enterococcus faecium} SCOP: b.81.1.3 PDB: 1khr_A* 1kk5_A 1kk4_A 1kk6_A 1mr9_A* 1mrl_A* 3dho_A* | Back alignment and structure |
|---|
| >1mr7_A Streptogramin A acetyltransferase; LEFT-handed parallel beta-helix domain; 1.80A {Enterococcus faecium} SCOP: b.81.1.3 PDB: 1khr_A* 1kk5_A 1kk4_A 1kk6_A 1mr9_A* 1mrl_A* 3dho_A* | Back alignment and structure |
|---|
| >1xat_A Xenobiotic acetyltransferase; chloramphenicol, LEFT-handed helix; 3.20A {Pseudomonas aeruginosa} SCOP: b.81.1.3 PDB: 2xat_A* | Back alignment and structure |
|---|
| >3r3i_A UTP--glucose-1-phosphate uridylyltransferase; rossmann fold, beta barrel, nucleotidyltransferase; 3.57A {Homo sapiens} PDB: 3r2w_A | Back alignment and structure |
|---|
| >2i5e_A Hypothetical protein MM_2497; APC86122, methanosarcina mazei GO1, hypothetic protein, STRU genomics, PSI-2, protein structure initiative; 2.10A {Methanosarcina mazei} SCOP: c.68.1.21 | Back alignment and structure |
|---|
| >3gue_A UTP-glucose-1-phosphate uridylyltransferase 2; phosphatase, UDP, structural GE structural genomics consortium, SGC; HET: UPG PG4; 1.92A {Trypanosoma brucei} | Back alignment and structure |
|---|
| >3ogz_A UDP-sugar pyrophosphorylase; LEFT handed beta helix, rossmann fold, UDP sugar pyrophospho transferase; 2.03A {Leishmania major} PDB: 3oh3_A* 3oh1_A* 3oh0_A* 3oh2_A* 3oh4_A* | Back alignment and structure |
|---|
| >1qg8_A Protein (spore coat polysaccharide biosynthesis P SPSA); glycosyltransferase, transferase; 1.50A {Bacillus subtilis} SCOP: c.68.1.1 PDB: 1h7q_A* 1h7l_A 1qgq_A* 1qgs_A* | Back alignment and structure |
|---|
| >3bcv_A Putative glycosyltransferase protein; protein structure initiative II, PSI-II NYSGXRC, structural genomics; 2.35A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3cgx_A Putative nucleotide-diphospho-sugar transferase; YP_389115.1, joint center for structural genomics; 1.90A {Desulfovibrio desulfuricans subsp} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 456 | ||||
| d1mc3a_ | 291 | c.68.1.6 (A:) RffH {Escherichia coli [TaxId: 562]} | 3e-15 | |
| d1lvwa_ | 295 | c.68.1.6 (A:) RmlA (RfbA) {Archaeon Methanobacteri | 3e-14 | |
| d1yp2a2 | 307 | c.68.1.6 (A:10-316) Glucose-1-phosphate adenylyltr | 4e-13 | |
| d1fxoa_ | 292 | c.68.1.6 (A:) RmlA (RfbA) {Pseudomonas aeruginosa | 5e-13 | |
| d1tzfa_ | 259 | c.68.1.13 (A:) Glucose-1-phosphate cytidylyltransf | 1e-11 | |
| d1jyka_ | 229 | c.68.1.13 (A:) CTP:phosphocholine cytidylytransfer | 2e-09 | |
| d2f9ca1 | 320 | b.81.1.7 (A:3-322) Hypothetical protein YdcK {Salm | 5e-09 | |
| d2f9ca1 | 320 | b.81.1.7 (A:3-322) Hypothetical protein YdcK {Salm | 3e-04 | |
| d2dpwa1 | 231 | c.68.1.19 (A:1-231) Uncharacterized protein TTHA01 | 2e-08 | |
| d1fxja1 | 78 | b.81.1.4 (A:252-329) N-acetylglucosamine 1-phospha | 3e-08 | |
| d1fxja1 | 78 | b.81.1.4 (A:252-329) N-acetylglucosamine 1-phospha | 5e-07 | |
| d1fxja1 | 78 | b.81.1.4 (A:252-329) N-acetylglucosamine 1-phospha | 5e-05 | |
| d2oi6a2 | 248 | c.68.1.5 (A:4-251) N-acetylglucosamine 1-phosphate | 1e-07 | |
| d1g97a2 | 250 | c.68.1.5 (A:2-251) N-acetylglucosamine 1-phosphate | 2e-07 | |
| d1j2za_ | 259 | b.81.1.1 (A:) UDP N-acetylglucosamine acyltransfer | 5e-07 | |
| d1j2za_ | 259 | b.81.1.1 (A:) UDP N-acetylglucosamine acyltransfer | 1e-05 | |
| d1i52a_ | 225 | c.68.1.13 (A:) 4-diphosphocytidyl-2C-methyl-D-eryt | 2e-06 | |
| d2jf2a1 | 262 | b.81.1.1 (A:1-262) UDP N-acetylglucosamine acyltra | 8e-06 | |
| d2jf2a1 | 262 | b.81.1.1 (A:1-262) UDP N-acetylglucosamine acyltra | 2e-05 | |
| d1vpaa_ | 221 | c.68.1.13 (A:) 4-diphosphocytidyl-2C-methyl-D-eryt | 9e-06 | |
| d1w55a1 | 205 | c.68.1.13 (A:3-207) IspD/IspF bifunctional enzyme, | 3e-05 | |
| d1vgwa_ | 226 | c.68.1.13 (A:) 4-diphosphocytidyl-2C-methyl-D-eryt | 3e-05 | |
| d1mr7a_ | 203 | b.81.1.3 (A:) Xenobiotic acetyltransferase {Entero | 5e-05 | |
| d1w77a1 | 226 | c.68.1.13 (A:75-300) 4-diphosphocytidyl-2C-methyl- | 7e-05 | |
| d2cu2a2 | 268 | c.68.1.20 (A:1-268) Putative mannose-1-phosphate g | 2e-04 | |
| d1yp2a1 | 135 | b.81.1.4 (A:317-451) Glucose-1-phosphate adenylylt | 5e-04 | |
| d1xata_ | 208 | b.81.1.3 (A:) Xenobiotic acetyltransferase {Pseudo | 0.003 | |
| d1g97a1 | 196 | b.81.1.4 (A:252-447) N-acetylglucosamine 1-phospha | 0.003 | |
| d1e5ka_ | 188 | c.68.1.8 (A:) Molybdenum cofactor biosynthesis pro | 0.004 |
| >d1mc3a_ c.68.1.6 (A:) RffH {Escherichia coli [TaxId: 562]} Length = 291 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Nucleotide-diphospho-sugar transferases superfamily: Nucleotide-diphospho-sugar transferases family: glucose-1-phosphate thymidylyltransferase domain: RffH species: Escherichia coli [TaxId: 562]
Score = 74.0 bits (182), Expect = 3e-15
Identities = 31/143 (21%), Positives = 59/143 (41%), Gaps = 9/143 (6%)
Query: 4 QVVVLAGGTSKKLVPLVSKEVPKALLPVANRPVLSYVLEQLELSNIKDLIVVVEGADAAL 63
+ ++LAGG+ +L P+ ++ V K LLP+ ++P++ Y L L L+ I++++++ D
Sbjct: 3 KGIILAGGSGTRLHPI-TRGVSKQLLPIYDKPMIYYPLSVLMLAGIREILIITTPEDKGY 61
Query: 64 --RVGGWISAAYVDRLHVEVATVPEDVGTAGALRAIAHHLTAKDVLVV-SGDLVSDVPPG 120
R+ G S + +E A P G A A L + +V ++
Sbjct: 62 FQRLLGDGSE---FGIQLEYAEQPSPDGLAQAFIIGETFLNGEPSCLVLGDNIFFGQGFS 118
Query: 121 AVTAAHRRHDAVVTAMICSVPVS 143
A + V
Sbjct: 119 PKLRHVAARTE--GATVFGYQVM 139
|
| >d1lvwa_ c.68.1.6 (A:) RmlA (RfbA) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 295 | Back information, alignment and structure |
|---|
| >d1yp2a2 c.68.1.6 (A:10-316) Glucose-1-phosphate adenylyltransferase small subunit, catalytic domain {Potato (Solanum tuberosum) [TaxId: 4113]} Length = 307 | Back information, alignment and structure |
|---|
| >d1fxoa_ c.68.1.6 (A:) RmlA (RfbA) {Pseudomonas aeruginosa [TaxId: 287]} Length = 292 | Back information, alignment and structure |
|---|
| >d1tzfa_ c.68.1.13 (A:) Glucose-1-phosphate cytidylyltransferase RfbF {Salmonella typhimurium [TaxId: 90371]} Length = 259 | Back information, alignment and structure |
|---|
| >d1jyka_ c.68.1.13 (A:) CTP:phosphocholine cytidylytransferase LicC {Streptococcus pneumoniae [TaxId: 1313]} Length = 229 | Back information, alignment and structure |
|---|
| >d2f9ca1 b.81.1.7 (A:3-322) Hypothetical protein YdcK {Salmonella enterica [TaxId: 28901]} Length = 320 | Back information, alignment and structure |
|---|
| >d2f9ca1 b.81.1.7 (A:3-322) Hypothetical protein YdcK {Salmonella enterica [TaxId: 28901]} Length = 320 | Back information, alignment and structure |
|---|
| >d2dpwa1 c.68.1.19 (A:1-231) Uncharacterized protein TTHA0179 {Thermus thermophilus [TaxId: 274]} Length = 231 | Back information, alignment and structure |
|---|
| >d1fxja1 b.81.1.4 (A:252-329) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 78 | Back information, alignment and structure |
|---|
| >d1fxja1 b.81.1.4 (A:252-329) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 78 | Back information, alignment and structure |
|---|
| >d1fxja1 b.81.1.4 (A:252-329) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 78 | Back information, alignment and structure |
|---|
| >d2oi6a2 c.68.1.5 (A:4-251) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 248 | Back information, alignment and structure |
|---|
| >d1g97a2 c.68.1.5 (A:2-251) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Length = 250 | Back information, alignment and structure |
|---|
| >d1j2za_ b.81.1.1 (A:) UDP N-acetylglucosamine acyltransferase {Helicobacter pylori [TaxId: 210]} Length = 259 | Back information, alignment and structure |
|---|
| >d1j2za_ b.81.1.1 (A:) UDP N-acetylglucosamine acyltransferase {Helicobacter pylori [TaxId: 210]} Length = 259 | Back information, alignment and structure |
|---|
| >d1i52a_ c.68.1.13 (A:) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Escherichia coli [TaxId: 562]} Length = 225 | Back information, alignment and structure |
|---|
| >d2jf2a1 b.81.1.1 (A:1-262) UDP N-acetylglucosamine acyltransferase {Escherichia coli, gene lpxA [TaxId: 562]} Length = 262 | Back information, alignment and structure |
|---|
| >d2jf2a1 b.81.1.1 (A:1-262) UDP N-acetylglucosamine acyltransferase {Escherichia coli, gene lpxA [TaxId: 562]} Length = 262 | Back information, alignment and structure |
|---|
| >d1vpaa_ c.68.1.13 (A:) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Thermotoga maritima [TaxId: 2336]} Length = 221 | Back information, alignment and structure |
|---|
| >d1w55a1 c.68.1.13 (A:3-207) IspD/IspF bifunctional enzyme, CDP-me synthase domain {Campylobacter jejuni [TaxId: 197]} Length = 205 | Back information, alignment and structure |
|---|
| >d1vgwa_ c.68.1.13 (A:) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Neisseria gonorrhoeae [TaxId: 485]} Length = 226 | Back information, alignment and structure |
|---|
| >d1mr7a_ b.81.1.3 (A:) Xenobiotic acetyltransferase {Enterococcus faecium, VAT(D) [TaxId: 1352]} Length = 203 | Back information, alignment and structure |
|---|
| >d1w77a1 c.68.1.13 (A:75-300) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]} Length = 226 | Back information, alignment and structure |
|---|
| >d2cu2a2 c.68.1.20 (A:1-268) Putative mannose-1-phosphate guanylyl transferase (GDP)/mannose-6-phosphate isomerase TTHA1750 {Thermus thermophilus [TaxId: 274]} Length = 268 | Back information, alignment and structure |
|---|
| >d1yp2a1 b.81.1.4 (A:317-451) Glucose-1-phosphate adenylyltransferase small subunit, C-terminal domain {Potato (Solanum tuberosum) [TaxId: 4113]} Length = 135 | Back information, alignment and structure |
|---|
| >d1xata_ b.81.1.3 (A:) Xenobiotic acetyltransferase {Pseudomonas aeruginosa [TaxId: 287]} Length = 208 | Back information, alignment and structure |
|---|
| >d1g97a1 b.81.1.4 (A:252-447) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Length = 196 | Back information, alignment and structure |
|---|
| >d1e5ka_ c.68.1.8 (A:) Molybdenum cofactor biosynthesis protein MobA {Escherichia coli [TaxId: 562]} Length = 188 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 456 | |||
| d1fxoa_ | 292 | RmlA (RfbA) {Pseudomonas aeruginosa [TaxId: 287]} | 100.0 | |
| d1mc3a_ | 291 | RffH {Escherichia coli [TaxId: 562]} | 100.0 | |
| d1yp2a2 | 307 | Glucose-1-phosphate adenylyltransferase small subu | 99.97 | |
| d1lvwa_ | 295 | RmlA (RfbA) {Archaeon Methanobacterium thermoautot | 99.96 | |
| d2cu2a2 | 268 | Putative mannose-1-phosphate guanylyl transferase | 99.93 | |
| d1tzfa_ | 259 | Glucose-1-phosphate cytidylyltransferase RfbF {Sal | 99.93 | |
| d1jyka_ | 229 | CTP:phosphocholine cytidylytransferase LicC {Strep | 99.89 | |
| d1g97a2 | 250 | N-acetylglucosamine 1-phosphate uridyltransferase | 99.85 | |
| d2oi6a2 | 248 | N-acetylglucosamine 1-phosphate uridyltransferase | 99.8 | |
| d1qrea_ | 210 | gamma-carbonic anhydrase {Archaeon Methanosarcina | 99.57 | |
| d1qrea_ | 210 | gamma-carbonic anhydrase {Archaeon Methanosarcina | 99.55 | |
| d2dpwa1 | 231 | Uncharacterized protein TTHA0179 {Thermus thermoph | 99.51 | |
| d3bswa1 | 193 | Acetyltransferase PglD {Campylobacter jejuni [TaxI | 99.51 | |
| d1i52a_ | 225 | 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) | 99.49 | |
| d2jf2a1 | 262 | UDP N-acetylglucosamine acyltransferase {Escherich | 99.47 | |
| d1w77a1 | 226 | 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) | 99.45 | |
| d1xhda_ | 172 | Putative acetyltransferase/acyltransferase BC4754 | 99.45 | |
| d2jf2a1 | 262 | UDP N-acetylglucosamine acyltransferase {Escherich | 99.43 | |
| d1vpaa_ | 221 | 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) | 99.43 | |
| d1yp2a1 | 135 | Glucose-1-phosphate adenylyltransferase small subu | 99.43 | |
| d3bswa1 | 193 | Acetyltransferase PglD {Campylobacter jejuni [TaxI | 99.42 | |
| d1fxja1 | 78 | N-acetylglucosamine 1-phosphate uridyltransferase | 99.41 | |
| d1j2za_ | 259 | UDP N-acetylglucosamine acyltransferase {Helicobac | 99.39 | |
| d1w55a1 | 205 | IspD/IspF bifunctional enzyme, CDP-me synthase dom | 99.37 | |
| d1fxja1 | 78 | N-acetylglucosamine 1-phosphate uridyltransferase | 99.36 | |
| d1j2za_ | 259 | UDP N-acetylglucosamine acyltransferase {Helicobac | 99.36 | |
| d1g97a1 | 196 | N-acetylglucosamine 1-phosphate uridyltransferase | 99.36 | |
| d1v3wa_ | 173 | Ferripyochelin binding protein {Archaeon Pyrococcu | 99.3 | |
| d1vgwa_ | 226 | 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) | 99.3 | |
| d1krra_ | 200 | Galactoside acetyltransferase {Escherichia coli [T | 99.28 | |
| d1e5ka_ | 188 | Molybdenum cofactor biosynthesis protein MobA {Esc | 99.27 | |
| d1vh1a_ | 246 | CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)syn | 99.25 | |
| d1h7ea_ | 245 | CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)syn | 99.25 | |
| d1xhda_ | 172 | Putative acetyltransferase/acyltransferase BC4754 | 99.2 | |
| d1ocxa_ | 182 | Maltose O-acetyltransferase {Escherichia coli [Tax | 99.17 | |
| d1vica_ | 255 | CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)syn | 99.16 | |
| d1v3wa_ | 173 | Ferripyochelin binding protein {Archaeon Pyrococcu | 99.14 | |
| d1g97a1 | 196 | N-acetylglucosamine 1-phosphate uridyltransferase | 99.12 | |
| d3tdta_ | 274 | Tetrahydrodipicolinate-N-succinlytransferase, THDP | 99.12 | |
| d1yp2a1 | 135 | Glucose-1-phosphate adenylyltransferase small subu | 99.12 | |
| d3tdta_ | 274 | Tetrahydrodipicolinate-N-succinlytransferase, THDP | 99.06 | |
| d2oi6a1 | 201 | N-acetylglucosamine 1-phosphate uridyltransferase | 99.05 | |
| d1eyra_ | 225 | CMP acylneuraminate synthetase {Neisseria meningit | 99.02 | |
| d1qwja_ | 228 | CMP acylneuraminate synthetase {Mouse (Mus musculu | 98.95 | |
| d1mr7a_ | 203 | Xenobiotic acetyltransferase {Enterococcus faecium | 98.93 | |
| d1ocxa_ | 182 | Maltose O-acetyltransferase {Escherichia coli [Tax | 98.89 | |
| d2oi6a1 | 201 | N-acetylglucosamine 1-phosphate uridyltransferase | 98.88 | |
| d1krra_ | 200 | Galactoside acetyltransferase {Escherichia coli [T | 98.88 | |
| d1mr7a_ | 203 | Xenobiotic acetyltransferase {Enterococcus faecium | 98.82 | |
| d1ssqa_ | 241 | Serine acetyltransferase {Haemophilus influenzae [ | 98.67 | |
| d1ssqa_ | 241 | Serine acetyltransferase {Haemophilus influenzae [ | 98.66 | |
| d1xata_ | 208 | Xenobiotic acetyltransferase {Pseudomonas aerugino | 98.59 | |
| d2f9ca1 | 320 | Hypothetical protein YdcK {Salmonella enterica [Ta | 98.57 | |
| d1xata_ | 208 | Xenobiotic acetyltransferase {Pseudomonas aerugino | 98.51 | |
| d2icya2 | 378 | UDP-glucose pyrophosphorylase 2 (UDPGP 2) {Thale c | 98.37 | |
| d2f9ca1 | 320 | Hypothetical protein YdcK {Salmonella enterica [Ta | 98.35 | |
| d1jv1a_ | 501 | UDP-N-acetylglucosamine pyrophosphorylase {Human ( | 97.16 | |
| d2i5ea1 | 208 | Hypothetical protein MM2497 {Methanosarcina mazei | 88.92 | |
| d1xhba2 | 328 | Polypeptide N-acetylgalactosaminyltransferase 1, N | 81.49 | |
| d1omza_ | 265 | Alpha-1,4-N-acetylhexosaminyltransferase (Alpha-Ga | 80.25 |
| >d1fxoa_ c.68.1.6 (A:) RmlA (RfbA) {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Nucleotide-diphospho-sugar transferases superfamily: Nucleotide-diphospho-sugar transferases family: glucose-1-phosphate thymidylyltransferase domain: RmlA (RfbA) species: Pseudomonas aeruginosa [TaxId: 287]
Probab=100.00 E-value=3.7e-34 Score=268.84 Aligned_cols=206 Identities=20% Similarity=0.307 Sum_probs=165.1
Q ss_pred CceEEEEecCCCCCCcCCCCCCCcccccccCCcchHHHHHHHHHHCCCCEEEEEecCchhhHHHHhhhhhhccCccceEE
Q 012817 2 DFQVVVLAGGTSKKLVPLVSKEVPKALLPVANRPVLSYVLEQLELSNIKDLIVVVEGADAALRVGGWISAAYVDRLHVEV 81 (456)
Q Consensus 2 ~~~aiIlagG~g~rl~pl~~~~~pK~llpi~gkpli~~~l~~l~~~gi~~v~iv~~~~~~~~~i~~~~~~~~~~~~~i~~ 81 (456)
+++|||||||.|+||+|+ |...||||+||+|||||+|+|++|..+|+++++|++.+.. .+.+++++.+.......+.+
T Consensus 1 k~KavILAgG~GtRl~pl-T~~~pKpllpi~gkPiI~~~l~~l~~~Gi~ei~ii~~~~~-~~~i~~~~~~~~~~g~~I~y 78 (292)
T d1fxoa_ 1 KRKGIILAGGSGTRLHPA-TLAISKQLLPVYDKPMIYYPLSTLMLAGIREILIISTPQD-TPRFQQLLGDGSNWGLDLQY 78 (292)
T ss_dssp CEEEEEECCCCCTTTTTH-HHHSCGGGSEETTEETTHHHHHHHHHTTCCEEEEEECTTT-HHHHHHHHTTSGGGTCEEEE
T ss_pred CcEEEEECCCCCCcCChh-hcCCCcccCEECCEehHHHHHHHHHHCCCCEEEEEeCcCC-HHHHHHHhccccccCeEEEE
Confidence 579999999999999999 9999999999999999999999999999999998887443 34677766654333456777
Q ss_pred EEccCCcChHHHHHHHHhcCCCCc-EEEEcCCcccCCChhHHHHHHHhcCceEEEEEeecccCCCccCCCCCCcccCCCC
Q 012817 82 ATVPEDVGTAGALRAIAHHLTAKD-VLVVSGDLVSDVPPGAVTAAHRRHDAVVTAMICSVPVSGLSEAGSSGAKDKTKKP 160 (456)
Q Consensus 82 ~~~~~~~gt~~al~~~~~~l~~~~-~lv~~~D~i~~~~l~~~l~~~~~~~a~~t~~~~~~~~~~~~~~~~~~~~~~~~~~ 160 (456)
+.++.+.||++|+..|.+.+.+++ ++++++|++++.++.+++++|.++++.+++++.+++ +|
T Consensus 79 ~~q~~~~Gta~ai~~a~~~i~~~~~~lil~dD~~~~~dl~~ll~~h~~~~~~~~i~~~~V~-----------------~p 141 (292)
T d1fxoa_ 79 AVQPSPDGLAQAFLIGESFIGNDLSALVLGDNLYYGHDFHELLGSASQRQTGASVFAYHVL-----------------DP 141 (292)
T ss_dssp EECSSCCCGGGHHHHTHHHHTTSEEEEEETTEEEECTTHHHHHHHHHTCCSSEEEEEEECS-----------------CG
T ss_pred ccCCCCCcHHHHHHhhhhhcCCCceEEEEccccccCcCHHHHHHHHHhCCCCcEEEEEECC-----------------CH
Confidence 888888999999999999887665 577777899999999999999999999999888764 26
Q ss_pred CcccEEEecCCCcEEEEeecccccccccccchHHHhhcceeEEecCCccceEEeechHHHHHHHhcC--ccccccccchh
Q 012817 161 GRYNIIGMDPTKQFLLHIATGAELEKDTRIRKSILRAVGQMDIRADLMDAHMYAFNRSVLQEVLDQK--DKFQSLKQDVL 238 (456)
Q Consensus 161 ~~~~iv~~d~~~~~l~~~~~~~~~~k~~~~~~~~~~~~~~~~~~~~~~~~giYi~~~~vl~~~~~~~--~~~~s~~~d~l 238 (456)
++||++.+|++++++ .+. ||+. ++.|+++.+|+|+|+++++..+-.-. ...+...+|++
T Consensus 142 ~~yGV~~~d~~~ki~-~~~-----EKP~-------------~p~Snla~~G~Y~f~~~~~~~~~~l~~s~rgE~eitD~~ 202 (292)
T d1fxoa_ 142 ERYGVVEFDQGGKAI-SLE-----EKPL-------------EPKSNYAVTGLYFYDQQVVDIARDLKPSPRGELEITDVN 202 (292)
T ss_dssp GGSEEEEECTTSCEE-EEE-----ESCS-------------SCSSSEEEEEEEEECTTHHHHHHHCCCCTTSSCCHHHHH
T ss_pred HHCeEEEEcCCCCEe-EEE-----ECCC-------------CCCCCcEEEEEEEEChHHHHHHHhCCCCCCCchhhHHHH
Confidence 789999999988754 443 3431 33589999999999999986442211 22344456888
Q ss_pred HHHhHhc
Q 012817 239 PYLVRSQ 245 (456)
Q Consensus 239 ~~l~~~~ 245 (456)
+.+++++
T Consensus 203 ~~~l~~~ 209 (292)
T d1fxoa_ 203 RAYLERG 209 (292)
T ss_dssp HHHHHTT
T ss_pred HHHHHcC
Confidence 8887653
|
| >d1mc3a_ c.68.1.6 (A:) RffH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yp2a2 c.68.1.6 (A:10-316) Glucose-1-phosphate adenylyltransferase small subunit, catalytic domain {Potato (Solanum tuberosum) [TaxId: 4113]} | Back information, alignment and structure |
|---|
| >d1lvwa_ c.68.1.6 (A:) RmlA (RfbA) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d2cu2a2 c.68.1.20 (A:1-268) Putative mannose-1-phosphate guanylyl transferase (GDP)/mannose-6-phosphate isomerase TTHA1750 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1tzfa_ c.68.1.13 (A:) Glucose-1-phosphate cytidylyltransferase RfbF {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1jyka_ c.68.1.13 (A:) CTP:phosphocholine cytidylytransferase LicC {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1g97a2 c.68.1.5 (A:2-251) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2oi6a2 c.68.1.5 (A:4-251) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qrea_ b.81.1.5 (A:) gamma-carbonic anhydrase {Archaeon Methanosarcina thermophila [TaxId: 2210]} | Back information, alignment and structure |
|---|
| >d1qrea_ b.81.1.5 (A:) gamma-carbonic anhydrase {Archaeon Methanosarcina thermophila [TaxId: 2210]} | Back information, alignment and structure |
|---|
| >d2dpwa1 c.68.1.19 (A:1-231) Uncharacterized protein TTHA0179 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d3bswa1 b.81.1.8 (A:3-195) Acetyltransferase PglD {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d1i52a_ c.68.1.13 (A:) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2jf2a1 b.81.1.1 (A:1-262) UDP N-acetylglucosamine acyltransferase {Escherichia coli, gene lpxA [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w77a1 c.68.1.13 (A:75-300) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1xhda_ b.81.1.5 (A:) Putative acetyltransferase/acyltransferase BC4754 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d2jf2a1 b.81.1.1 (A:1-262) UDP N-acetylglucosamine acyltransferase {Escherichia coli, gene lpxA [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vpaa_ c.68.1.13 (A:) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1yp2a1 b.81.1.4 (A:317-451) Glucose-1-phosphate adenylyltransferase small subunit, C-terminal domain {Potato (Solanum tuberosum) [TaxId: 4113]} | Back information, alignment and structure |
|---|
| >d3bswa1 b.81.1.8 (A:3-195) Acetyltransferase PglD {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d1fxja1 b.81.1.4 (A:252-329) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1j2za_ b.81.1.1 (A:) UDP N-acetylglucosamine acyltransferase {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1w55a1 c.68.1.13 (A:3-207) IspD/IspF bifunctional enzyme, CDP-me synthase domain {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d1fxja1 b.81.1.4 (A:252-329) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1j2za_ b.81.1.1 (A:) UDP N-acetylglucosamine acyltransferase {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1g97a1 b.81.1.4 (A:252-447) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1v3wa_ b.81.1.5 (A:) Ferripyochelin binding protein {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1vgwa_ c.68.1.13 (A:) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Neisseria gonorrhoeae [TaxId: 485]} | Back information, alignment and structure |
|---|
| >d1krra_ b.81.1.3 (A:) Galactoside acetyltransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e5ka_ c.68.1.8 (A:) Molybdenum cofactor biosynthesis protein MobA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vh1a_ c.68.1.13 (A:) CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)synthetase {Escherichia coli, KdsB [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1h7ea_ c.68.1.13 (A:) CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)synthetase {Escherichia coli, KpsU [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xhda_ b.81.1.5 (A:) Putative acetyltransferase/acyltransferase BC4754 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1ocxa_ b.81.1.3 (A:) Maltose O-acetyltransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vica_ c.68.1.13 (A:) CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)synthetase {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1v3wa_ b.81.1.5 (A:) Ferripyochelin binding protein {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1g97a1 b.81.1.4 (A:252-447) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d3tdta_ b.81.1.2 (A:) Tetrahydrodipicolinate-N-succinlytransferase, THDP-succinlytransferase, DapD {Mycobacterium bovis [TaxId: 1765]} | Back information, alignment and structure |
|---|
| >d1yp2a1 b.81.1.4 (A:317-451) Glucose-1-phosphate adenylyltransferase small subunit, C-terminal domain {Potato (Solanum tuberosum) [TaxId: 4113]} | Back information, alignment and structure |
|---|
| >d3tdta_ b.81.1.2 (A:) Tetrahydrodipicolinate-N-succinlytransferase, THDP-succinlytransferase, DapD {Mycobacterium bovis [TaxId: 1765]} | Back information, alignment and structure |
|---|
| >d2oi6a1 b.81.1.4 (A:252-452) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1eyra_ c.68.1.13 (A:) CMP acylneuraminate synthetase {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d1qwja_ c.68.1.13 (A:) CMP acylneuraminate synthetase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1mr7a_ b.81.1.3 (A:) Xenobiotic acetyltransferase {Enterococcus faecium, VAT(D) [TaxId: 1352]} | Back information, alignment and structure |
|---|
| >d1ocxa_ b.81.1.3 (A:) Maltose O-acetyltransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2oi6a1 b.81.1.4 (A:252-452) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1krra_ b.81.1.3 (A:) Galactoside acetyltransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mr7a_ b.81.1.3 (A:) Xenobiotic acetyltransferase {Enterococcus faecium, VAT(D) [TaxId: 1352]} | Back information, alignment and structure |
|---|
| >d1ssqa_ b.81.1.6 (A:) Serine acetyltransferase {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1ssqa_ b.81.1.6 (A:) Serine acetyltransferase {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1xata_ b.81.1.3 (A:) Xenobiotic acetyltransferase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2f9ca1 b.81.1.7 (A:3-322) Hypothetical protein YdcK {Salmonella enterica [TaxId: 28901]} | Back information, alignment and structure |
|---|
| >d1xata_ b.81.1.3 (A:) Xenobiotic acetyltransferase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2icya2 c.68.1.5 (A:6-383) UDP-glucose pyrophosphorylase 2 (UDPGP 2) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2f9ca1 b.81.1.7 (A:3-322) Hypothetical protein YdcK {Salmonella enterica [TaxId: 28901]} | Back information, alignment and structure |
|---|
| >d1jv1a_ c.68.1.5 (A:) UDP-N-acetylglucosamine pyrophosphorylase {Human (Homo sapiens), AGX1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2i5ea1 c.68.1.21 (A:1-208) Hypothetical protein MM2497 {Methanosarcina mazei [TaxId: 2209]} | Back information, alignment and structure |
|---|
| >d1xhba2 c.68.1.17 (A:95-422) Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1omza_ c.68.1.15 (A:) Alpha-1,4-N-acetylhexosaminyltransferase (Alpha-GalNAcT EXTL2) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|