Citrus Sinensis ID: 013166


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------45
MNSVFSADDFSDSFLSSPSPPPASFHALPMNRSQSEWELEKFLQEVTVSPRAISSSSASDNSVPAVIGPSVMSKSRAYEIGDDDVVEIKKSHRDQSLDPPVIPSSTAPVDSDEYRAYLKTKLDLACAAVALRTAPVKPEDKSSLIENQTQAAKPSELGSQAMATVNVSTAHDALGTHPKADFRPLGSADLPAVQARPAAQVRQSTSGSSREDSDDDELEGDTETIEGLDSVDDKRARRMLSNRESARRSRRRKQAHLNELETQAGQLRAEHSSLLKGLTDVNQKYDESAVNNRILKADIETLRAKVKMAEETVKRVTGLNPLLLARSDVPGVGMPLVNVPLDASRNATHPMQPNPNQFFHQAIPSISTPTPNHQSLDSSFPSNIQLPTVGNPQSDRGGKNMTETSPLQHAVGLEHVPQGVGHRVSPPGAVPGWDTGLPHAGSKNNKQR
cccccccccccccccccccccccccccccccccccHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHcccccHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
ccEEEEHccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHcccccEEEEEccccccccccccccccccccccccccHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHcccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccccccccccccccccccccccc
mnsvfsaddfsdsflsspspppasfhalpmnrsqSEWELEKFLQEvtvspraissssasdnsvpavigpsvmsksrayeigddDVVEIKkshrdqsldppvipsstapvdsdEYRAYLKTKLDLACAAVAlrtapvkpedksslienqtqaakpselgsqAMATVNVSTahdalgthpkadfrplgsadlpavqarpaaqvrqstsgssredsdddelegdtetiegldsVDDKRARRMLSNRESARRSRRRKQAHLNELETQAGQLRAEHSSLLKGLTDVNQKYDESAVNNRILKADIETLRAKVKMAEETVKRVTglnplllarsdvpgvgmplvnvpldasrnathpmqpnpnqffhqaipsistptpnhqsldssfpsniqlptvgnpqsdrggknmtetsplqhavglehvpqgvghrvsppgavpgwdtglphagsknnkqr
mnsvfsaddfsdsflsSPSPPPASFHALPMNRSQSEWELEKFLQEVTVSPraissssasdnsvpavigpsvmsksrAYEIGDDDVVEIKKshrdqsldppvipsstapvdsDEYRAYLKTKLDLACAAVALRtapvkpedksslIENQTQAAKPSELGSQAMATVNVSTAHDALGTHPKADFRPLGSADLPAVqarpaaqvrqstsgssredsdddelegdtetiegldsvddkrarrmlsnresarrsrrrkqAHLNEletqagqlraEHSSLLKGLTDvnqkydesavnnrilkadIETLRAKVKMAEEtvkrvtglnplllarsdvpgvGMPLVNVPLDASRNATHPMQPNPNQFFHQAIPSISTPTPNHQSLDSSFPSNIQLPTVGNPQSDRGGKNMTETSPLQHAVGLEHVPQGVGHRVSPPGAVPgwdtglphagsknnkqr
MNSVfsaddfsdsflsspspppasfhalpMNRSQSEWELEKFLQEVTvspraissssasdnsvpavIGPSVMSKSRAYEIGDDDVVEIKKSHRDQSLDPPVIPSSTAPVDSDEYRAYLKTKLDLACAAVALRTAPVKPEDKSSLIENQTQAAKPSELGSQAMATVNVSTAHDALGTHPKADFRPLGSADLpavqarpaaqvrqstsgssredsdddelegdtetiegLDSVDDKRARRMLsnresarrsrrrKQAHLNELETQAGQLRAEHSSLLKGLTDVNQKYDESAVNNRILKADIETLRAKVKMAEETVKRVTGLNPLLLARSDVPGVGMPLVNVPLDASRNATHPMQPNPNQFFHQAIPSISTPTPNHQSLDSSFPSNIQLPTVGNPQSDRGGKNMTETSPLQHAVGLEHVPQGVGHRVSPPGAVPGWDTGLPHAGSKNNKQR
*****************************************************************************************************************YRAYLKTKLDLACAAVALRT*******************************************************************************************************************************************************YDESAVNNRILKADIETLRAKVKMAEETVKRVTGLNPLLLARSDVPGVGMPLVNV*************************************************************************************************************
**SVFSADDFSDSF*******************************************************************************************************************************************************************************************************************************************RRRKQAHLNELETQAGQLRAEHSSLLKGLTDVNQKYDESAVNNRILKADIETLR*************************************************************************************************************************************************
*******************PPPASFHALPMNRSQSEWELEKFLQEVTV***************PAVIGPSVMSKSRAYEIGDDDVVEIKKSHRDQSLDPPVIPSSTAPVDSDEYRAYLKTKLDLACAAVALRTAPVKPEDKSSLIENQTQAAKPSELGSQAMATVNVSTAHDALGTHPKADFRPLGSADLPA******************************ETIEGLDSVDDKRARRM***************AHLNELETQAGQLRAEHSSLLKGLTDVNQKYDESAVNNRILKADIETLRAKVKMAEETVKRVTGLNPLLLARSDVPGVGMPLVNVPLDASRNATHPMQPNPNQFFHQAIPSIST*********SSFPSNIQLPTVGNPQSDRGGKNMTETSPLQHAVGLEHVPQGVGHRVSPPGAVPGWDTGLPH*********
**SVFSADDFSDSFLS*******************EWELEKFLQEVTV*********************************************************TAPVDSDEYRAYLKTKLDLACAAVALRTAP*****************************************************D*****************************************************************AHLNELETQAGQLRAEHSSLLKGLTDVNQKYDESAVNNRILKADIETLRAKVKMAEETVKRVTGLNPLLLARSDVPGVG**LVNVPLDASRNATHPMQPNPNQFFHQAIPSISTPTPNHQSLDSSFPSNIQLPTVG*****************Q*********QGVGHRVSPPGAVPGWDTGLPH*********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNSVFSADDFSDSFLSSPSPPPASFHALPMNRSQSEWELEKFLQEVTVSPRAISSSSASDNSVPAVIGPSVMSKSRAYEIGDDDVVEIKKSHRDQSLDPPVIPSSTAPVDSDEYRAYLKTKLDLACAAVALRTAPVKPEDKSSLIENQTQAAKPSELGSQAMATVNVSTAHDALGTHPKADFRPLGSADLPAVQARPAAQVRQSTSGSSREDSDDDELEGDTETIEGLDSVDDKRARRMLSNxxxxxxxxxxxxxxxxxxxxxxxxxxxxHSSLLKGLTDVNQKYDESAVNxxxxxxxxxxxxxxxxxxxxxxxxxxxxNPLLLARSDVPGVGMPLVNVPLDASRNATHPMQPNPNQFFHQAIPSISTPTPNHQSLDSSFPSNIQLPTVGNPQSDRGGKNMTETSPLQHAVGLEHVPQGVGHRVSPPGAVPGWDTGLPHAGSKNNKQR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query448 2.2.26 [Sep-21-2011]
Q99090401 Light-inducible protein C N/A no 0.852 0.952 0.444 1e-62
O22763411 Basic leucine zipper 10 O yes no 0.863 0.941 0.411 5e-54
Q9M1G6403 Basic leucine zipper 25 O no no 0.738 0.821 0.444 3e-47
B9DGI8314 Basic leucine zipper 63 O no no 0.486 0.694 0.440 2e-40
Q9FUD3277 Basic leucine zipper 9 OS no no 0.305 0.494 0.482 2e-25
P12959453 Regulatory protein opaque N/A no 0.223 0.220 0.544 7e-24
P23922349 Transcription factor HBP- N/A no 0.165 0.212 0.459 4e-08
Q9SJN0442 Protein ABSCISIC ACID-INS no no 0.167 0.169 0.412 7e-07
P24068151 Ocs element-binding facto N/A no 0.207 0.615 0.339 1e-06
P42777270 G-box-binding factor 4 OS no no 0.125 0.207 0.482 4e-06
>sp|Q99090|CPRF2_PETCR Light-inducible protein CPRF2 OS=Petroselinum crispum GN=CPRF2 PE=2 SV=2 Back     alignment and function desciption
 Score =  241 bits (614), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 193/434 (44%), Positives = 259/434 (59%), Gaps = 52/434 (11%)

Query: 1   MNSVFSADDFSDSFLSSPSPPPASFHALPMNRSQSEWELEKFLQEVTVSPRAISSSSASD 60
           M+ VFS +D SD F S P+   +S   L MNRS SEW  + FLQ+          +SA +
Sbjct: 1   MDRVFSVEDISDQFWSPPAREDSS--KLVMNRSDSEWAFQSFLQQ----------ASALE 48

Query: 61  NSVPAVIGPSVMSKSRAYEIGDDDVVEIKKSHRDQSLDPPVIPSSTAPVDSDEYRAYLKT 120
           +S P    P  ++       GD     +K        +P  IP++  PVDS++Y+AYLK+
Sbjct: 49  SSQPLPSDPVPVA-------GD-----VK--------NPVEIPANV-PVDSEDYQAYLKS 87

Query: 121 KLDLACAAVAL-RTAPVKPEDKSSLIENQTQAAKPSELGSQAMATVNVSTAHDALGTHPK 179
           +LDLACAAVAL R + +KP+D ++L++N +QA+  S+L SQ        + HD      K
Sbjct: 88  RLDLACAAVALTRASSLKPQDSAALLDNGSQASNTSQLVSQVPPK---GSGHDLSKEEDK 144

Query: 180 ADFRPLGSADLPAVQARPAAQVRQSTSGSSREDSDDD-ELEGDTETIEGLDSVDDKRARR 238
                  +  LPA+Q + A QV+ +TSGSSR+ SDDD ELEG+TET    D  D KR RR
Sbjct: 145 EALAATATPLLPALQKKSAIQVKSTTSGSSRDHSDDDDELEGETETTRNGDPSDAKRVRR 204

Query: 239 MLSNRESARRSRRRKQAHLNELETQAGQLRAEHSSLLKGLTDVNQKYDESAVNNRILKAD 298
           MLSNRESARRSRRRKQAH+ ELETQ  QLR E+SSLLK LTD++Q+Y+++AV+NR+LKAD
Sbjct: 205 MLSNRESARRSRRRKQAHMTELETQVSQLRVENSSLLKRLTDISQRYNDAAVDNRVLKAD 264

Query: 299 IETLRAKVKMAEETVKRVTGLNPLLLAR-SDVPGVGM-PLVNVPLDASRNATHPMQPNPN 356
           IET+RAKVKMAEETVKRVTGLNP+  +  S++  +GM      P D S + T   Q    
Sbjct: 265 IETMRAKVKMAEETVKRVTGLNPMFQSMSSEISTIGMQSFSGSPSDTSADTT---QDGSK 321

Query: 357 QFFHQAIPSISTPTPNHQSLDSSFPSNIQLPTVGNPQSDRG-----GKNMTETSPLQHAV 411
           Q F+Q  P+   P  + Q + +     +Q+P V N Q         G  M  TS +Q   
Sbjct: 322 QHFYQPAPTSHMPAQD-QKIQNGL---LQVPPVDNLQQHSASGPVEGNKMERTSSMQRVA 377

Query: 412 GLEHVPQGVGHRVS 425
            LEH+ + +   VS
Sbjct: 378 SLEHLQKRIRGGVS 391




Binds to the G-box-like motif (5'-ACGTGGC-3') of the chalcone synthase (CHS) gene promoter. G-box and G-box-like motifs are defined in promoters of certain plant genes which are regulated by such diverse stimuli as light-induction or hormone control.
Petroselinum crispum (taxid: 4043)
>sp|O22763|BZP10_ARATH Basic leucine zipper 10 OS=Arabidopsis thaliana GN=BZIP10 PE=1 SV=2 Back     alignment and function description
>sp|Q9M1G6|BZP25_ARATH Basic leucine zipper 25 OS=Arabidopsis thaliana GN=BZIP25 PE=1 SV=1 Back     alignment and function description
>sp|B9DGI8|BZP63_ARATH Basic leucine zipper 63 OS=Arabidopsis thaliana GN=BZIP63 PE=1 SV=1 Back     alignment and function description
>sp|Q9FUD3|BZIP9_ARATH Basic leucine zipper 9 OS=Arabidopsis thaliana GN=BZIP9 PE=1 SV=1 Back     alignment and function description
>sp|P12959|OP2_MAIZE Regulatory protein opaque-2 OS=Zea mays GN=O2 PE=1 SV=1 Back     alignment and function description
>sp|P23922|HBP1A_WHEAT Transcription factor HBP-1a OS=Triticum aestivum PE=2 SV=1 Back     alignment and function description
>sp|Q9SJN0|ABI5_ARATH Protein ABSCISIC ACID-INSENSITIVE 5 OS=Arabidopsis thaliana GN=ABI5 PE=1 SV=1 Back     alignment and function description
>sp|P24068|OCS1_MAIZE Ocs element-binding factor 1 OS=Zea mays GN=OBF1 PE=2 SV=2 Back     alignment and function description
>sp|P42777|GBF4_ARATH G-box-binding factor 4 OS=Arabidopsis thaliana GN=GBF4 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query448
255559911441 DNA binding protein, putative [Ricinus c 0.946 0.961 0.475 2e-84
118486477445 unknown [Populus trichocarpa] 0.959 0.966 0.514 2e-83
444300790444 bZIP transcription factor family protein 0.886 0.894 0.438 1e-71
225451342423 PREDICTED: light-inducible protein CPRF2 0.870 0.921 0.459 2e-71
16797791450 bZIP transcription factor [Nicotiana tab 0.899 0.895 0.438 3e-71
147796457446 hypothetical protein VITISV_022136 [Viti 0.899 0.903 0.448 3e-69
351720703417 bZIP protein [Glycine max] gi|183014149| 0.897 0.964 0.435 5e-69
351725229404 bZIP transcription factor bZIP89 [Glycin 0.879 0.975 0.438 1e-68
225437201452 PREDICTED: light-inducible protein CPRF2 0.941 0.933 0.436 2e-68
298204854383 unnamed protein product [Vitis vinifera] 0.683 0.798 0.504 2e-66
>gi|255559911|ref|XP_002520974.1| DNA binding protein, putative [Ricinus communis] gi|223539811|gb|EEF41391.1| DNA binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  319 bits (817), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 221/465 (47%), Positives = 281/465 (60%), Gaps = 41/465 (8%)

Query: 1   MNSVFSADDFSDSFLSSPSPPPASFHALPMNRSQSEWELEKFLQEVTVSPRAISSSSASD 60
           MNS+FS DDFSD    +P           M RS SEWELEKFL+E    P + S    ++
Sbjct: 1   MNSIFSVDDFSDLLWQAP-----------MTRSASEWELEKFLEEF---PASSSICDNNN 46

Query: 61  NSVPAVIGPSVMSKSRAYEIGDDDVVEIKKSH-RDQSLDPPVIPSSTAPVDSDEYRAYLK 119
           N    V  P  ++ S+  EI +D+VVEI+K     Q LD   +P    P D+D Y A+LK
Sbjct: 47  NDTTTVAVPKSLTSSKRREICEDEVVEIEKVEINSQPLDRAPLP---PPEDTDGYHAFLK 103

Query: 120 TKLDLACAAVAL---RTAPVKPED-KSSLIENQTQAAKPSELGSQAMATVNVSTAHDALG 175
           ++LDLACAA A    R + VKPE   SS  E+Q    K  E GS  ++       H    
Sbjct: 104 SQLDLACAAAAAAKSRDSSVKPEGVSSSFAEDQRVINKNCESGSSPVS----GNGHGITK 159

Query: 176 THPKADFRPLGSADLPAVQARPAAQ---VRQSTSGSSREDSDDDELEGDTETIEGLDSVD 232
              +AD    GS  LPA+ + P  Q   VRQ+TSGSSREDSDDDELEGDTET + +D  D
Sbjct: 160 GQNEADG---GSLRLPALPSMPRKQEVPVRQATSGSSREDSDDDELEGDTETNDNMDPAD 216

Query: 233 DKRARRMLSNRESARRSRRRKQAHLNELETQAGQLRAEHSSLLKGLTDVNQKYDESAVNN 292
           +KRARRM SNRESARRSRRRKQA LNELE Q GQLR E +SLL  LTD+N+K DE++V+N
Sbjct: 217 EKRARRMQSNRESARRSRRRKQAQLNELEAQVGQLRDERTSLLTRLTDINKKCDEASVDN 276

Query: 293 RILKADIETLRAKVKMAEETVKRVTGLNPLLLARSDVPGVGMPLVNVPLDASRNATHPMQ 352
           RIL A+IETLR KVKMAE+ VKRVTGLNP++LARS++P +GM  V    D S N   PMQ
Sbjct: 277 RILNANIETLRTKVKMAEDQVKRVTGLNPMVLARSNMPNMGMQFVAGQTDVSANVAVPMQ 336

Query: 353 PNPNQFFHQAIPSISTPTPNHQSLDSSFPSNIQLPTVGNPQSDRGGKNMTETSPLQHAVG 412
           PN N FFH ++P +++  P+ Q L +S P+N   P       + G  N+   +PLQ   G
Sbjct: 337 PNNNHFFHHSVPDLTSGAPHLQRLSNSCPNNSVTPLATPLPVNNGTSNIGGIAPLQQVTG 396

Query: 413 ---------LEHVPQGVGHRVSPPGAVPGWDTGLPHAGSKNNKQR 448
                    L+HV +  G  VSPP +V   + GL    +K+NK++
Sbjct: 397 AQNMTDVPPLQHVQKQTGPTVSPPASVLICNKGLSQPVAKDNKKK 441




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|118486477|gb|ABK95078.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
>gi|444300790|gb|AGD98704.1| bZIP transcription factor family protein 6 [Camellia sinensis] Back     alignment and taxonomy information
>gi|225451342|ref|XP_002279520.1| PREDICTED: light-inducible protein CPRF2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|16797791|gb|AAL27150.1| bZIP transcription factor [Nicotiana tabacum] Back     alignment and taxonomy information
>gi|147796457|emb|CAN74806.1| hypothetical protein VITISV_022136 [Vitis vinifera] Back     alignment and taxonomy information
>gi|351720703|ref|NP_001237953.1| bZIP protein [Glycine max] gi|183014149|dbj|BAG24402.1| bZIP protein [Glycine max] Back     alignment and taxonomy information
>gi|351725229|ref|NP_001237085.1| bZIP transcription factor bZIP89 [Glycine max] gi|113367196|gb|ABI34655.1| bZIP transcription factor bZIP89 [Glycine max] Back     alignment and taxonomy information
>gi|225437201|ref|XP_002281328.1| PREDICTED: light-inducible protein CPRF2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|298204854|emb|CBI34161.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query448
TAIR|locus:505006398403 BZIP25 "basic leucine zipper 2 0.375 0.416 0.445 7.7e-48
TAIR|locus:2184251314 BZO2H3 "AT5G28770" [Arabidopsi 0.243 0.347 0.522 1.4e-41
TAIR|locus:2149403277 BZIP9 "AT5G24800" [Arabidopsis 0.227 0.368 0.409 2e-12
TAIR|locus:2053124171 bZIP2 "AT2G18160" [Arabidopsis 0.283 0.742 0.255 5.9e-05
TAIR|locus:505006398 BZIP25 "basic leucine zipper 25" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 339 (124.4 bits), Expect = 7.7e-48, Sum P(2) = 7.7e-48
 Identities = 81/182 (44%), Positives = 107/182 (58%)

Query:   229 DSVDDKRARRMLXXXXXXXXXXXXKQAHLNELETQAGQLRAEHSSLLKGLTDVNQKYDES 288
             D  D KRARRML            KQ  +NE +TQ GQLRAEHS+L+  L+D+N KYD +
Sbjct:   226 DPTDVKRARRMLSNRESARRSRRRKQEQMNEFDTQVGQLRAEHSTLINRLSDMNHKYDAA 285

Query:   289 AVNNRILKADIETLRAKVKMAEETVKRVTGLNPLLLARSDVPGVGMPLVNVPLDASRNAT 348
             AV+NRIL+ADIETLR KVKMAEETVKRVTG+NPL  +R   P +G+P  N P     +A+
Sbjct:   286 AVDNRILRADIETLRTKVKMAEETVKRVTGVNPLHWSR---PNMGIPFSNTP-----SAS 337

Query:   349 HPMQPNPNQFFHQAIPSISTPT--PNHQSLDSS--FPSNIQLPTVGNPQSDRGGKNMTET 404
               + PN N     A  S +T      +Q ++++   P  +    + NP +     N+ ET
Sbjct:   338 SSIPPNSNHILKPANSSTNTSAGLAQNQRVETANFLPEQVNREGMQNPFAP--DSNLYET 395

Query:   405 SP 406
              P
Sbjct:   396 LP 397


GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=IEA;ISS;IDA
GO:0005634 "nucleus" evidence=ISM
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA
GO:0043565 "sequence-specific DNA binding" evidence=IEA
GO:0046983 "protein dimerization activity" evidence=IEA
GO:0005515 "protein binding" evidence=IPI
GO:0045893 "positive regulation of transcription, DNA-dependent" evidence=IDA
GO:0046982 "protein heterodimerization activity" evidence=IPI
GO:2000693 "positive regulation of seed maturation" evidence=IDA
GO:0007165 "signal transduction" evidence=RCA
GO:0009410 "response to xenobiotic stimulus" evidence=RCA
GO:0009723 "response to ethylene stimulus" evidence=RCA
GO:0009755 "hormone-mediated signaling pathway" evidence=RCA
GO:0030968 "endoplasmic reticulum unfolded protein response" evidence=RCA
TAIR|locus:2184251 BZO2H3 "AT5G28770" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2149403 BZIP9 "AT5G24800" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2053124 bZIP2 "AT2G18160" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O22763BZP10_ARATHNo assigned EC number0.41120.86380.9416yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query448
pfam12498112 pfam12498, bZIP_C, Basic leucine-zipper C terminal 2e-23
smart0033865 smart00338, BRLZ, basic region leucin zipper 7e-16
pfam0017064 pfam00170, bZIP_1, bZIP transcription factor 2e-11
cd1219354 cd12193, B_zip1, basic leucine zipper DNA-binding 2e-06
pfam0771654 pfam07716, bZIP_2, Basic region leucine zipper 2e-06
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 0.002
TIGR04211198 TIGR04211, SH3_and_anchor, SH3 domain protein 0.004
>gnl|CDD|221605 pfam12498, bZIP_C, Basic leucine-zipper C terminal Back     alignment and domain information
 Score = 94.1 bits (234), Expect = 2e-23
 Identities = 49/128 (38%), Positives = 64/128 (50%), Gaps = 16/128 (12%)

Query: 301 TLRAKVKMAEETVKRVTGLNPLLLARSDVPGVGMPLVNVPLDASRNATHPMQPNPNQFFH 360
           TLRAKVKMAE+TVKRVTGLNPLL A S++  +GMP    P DAS +A+ P+Q N + +F 
Sbjct: 1   TLRAKVKMAEDTVKRVTGLNPLLQAISEMSSMGMPFSG-PSDASSDASVPIQDNSSNYFQ 59

Query: 361 QAIPSISTPTPNHQSLDSSFPSNIQLPTVGNPQSDRGGKNMTETSPLQHAVGLEHVPQGV 420
           Q   +      + Q         +   T G          M  T  LQ    LEH+ + +
Sbjct: 60  QPAVNPGITVHDDQPE-------LGGATAGGK--------MGRTPSLQRVASLEHLQKRI 104

Query: 421 GHRVSPPG 428
              VS   
Sbjct: 105 RGGVSSST 112


This family of proteins is found in eukaryotes. Proteins in this family are typically between 174 and 411 amino acids in length. The family is found in association with pfam00170. There is a conserved KVK sequence motif. There is a single completely conserved residue K that may be functionally important. Various bZIP proteins have been found and shown to play a role in seed-specific gene expression. bZIP binds to the alpha-globulin gene promoter, but not to promoters of other major storage genes such as glutelin, prolamin and albumin. Length = 112

>gnl|CDD|197664 smart00338, BRLZ, basic region leucin zipper Back     alignment and domain information
>gnl|CDD|201054 pfam00170, bZIP_1, bZIP transcription factor Back     alignment and domain information
>gnl|CDD|213400 cd12193, B_zip1, basic leucine zipper DNA-binding and multimerization region of GCN4 and related proteins Back     alignment and domain information
>gnl|CDD|203738 pfam07716, bZIP_2, Basic region leucine zipper Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|234501 TIGR04211, SH3_and_anchor, SH3 domain protein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 448
PF12498115 bZIP_C: Basic leucine-zipper C terminal; InterPro: 99.94
smart0033865 BRLZ basic region leucin zipper. 99.32
PF0017064 bZIP_1: bZIP transcription factor cAMP response el 99.27
KOG4005292 consensus Transcription factor XBP-1 [Transcriptio 99.23
KOG4343 655 consensus bZIP transcription factor ATF6 [Transcri 99.19
PF0771654 bZIP_2: Basic region leucine zipper; InterPro: IPR 98.97
KOG0709472 consensus CREB/ATF family transcription factor [Tr 98.95
KOG3584348 consensus cAMP response element binding protein an 98.92
KOG0837279 consensus Transcriptional activator of the JUN fam 98.03
PF0313192 bZIP_Maf: bZIP Maf transcription factor; InterPro: 98.01
KOG4196135 consensus bZIP transcription factor MafK [Transcri 96.97
KOG4571294 consensus Activating transcription factor 4 [Trans 96.84
KOG3119269 consensus Basic region leucine zipper transcriptio 96.69
PF0600572 DUF904: Protein of unknown function (DUF904); Inte 96.43
KOG3863604 consensus bZIP transcription factor NRF1 [Transcri 96.25
TIGR0244965 conserved hypothetical protein TIGR02449. Members 96.25
PRK10884206 SH3 domain-containing protein; Provisional 95.79
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 95.79
PF0798975 Microtub_assoc: Microtubule associated; InterPro: 95.41
PF06156107 DUF972: Protein of unknown function (DUF972); Inte 95.4
PF0218345 HALZ: Homeobox associated leucine zipper; InterPro 95.32
TIGR0244965 conserved hypothetical protein TIGR02449. Members 94.76
PRK13169110 DNA replication intiation control protein YabA; Re 94.7
PF1419769 Cep57_CLD_2: Centrosome localisation domain of PPC 94.6
PF08614194 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR 94.57
PF07888 546 CALCOCO1: Calcium binding and coiled-coil domain ( 94.52
PF06156107 DUF972: Protein of unknown function (DUF972); Inte 94.52
PF0600572 DUF904: Protein of unknown function (DUF904); Inte 94.4
COG307479 Uncharacterized protein conserved in bacteria [Fun 94.37
PRK13729 475 conjugal transfer pilus assembly protein TraB; Pro 94.3
PRK13169110 DNA replication intiation control protein YabA; Re 94.28
COG4467114 Regulator of replication initiation timing [Replic 94.25
PF0489970 MbeD_MobD: MbeD/MobD like ; InterPro: IPR006983 Th 93.59
PRK10884206 SH3 domain-containing protein; Provisional 93.56
PRK11637 428 AmiB activator; Provisional 93.53
PF08614194 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR 93.04
PF11559151 ADIP: Afadin- and alpha -actinin-Binding; InterPro 93.01
PF11559151 ADIP: Afadin- and alpha -actinin-Binding; InterPro 92.98
PRK1542279 septal ring assembly protein ZapB; Provisional 92.6
PRK11637 428 AmiB activator; Provisional 92.31
PF11932251 DUF3450: Protein of unknown function (DUF3450); In 92.17
PRK1542279 septal ring assembly protein ZapB; Provisional 92.0
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [ 91.62
COG2433652 Uncharacterized conserved protein [Function unknow 91.57
PF07106169 TBPIP: Tat binding protein 1(TBP-1)-interacting pr 91.47
PF12718143 Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 91.14
PF13851201 GAS: Growth-arrest specific micro-tubule binding 91.08
TIGR03752 472 conj_TIGR03752 integrating conjugative element pro 90.77
COG4026290 Uncharacterized protein containing TOPRIM domain, 90.7
PF1419769 Cep57_CLD_2: Centrosome localisation domain of PPC 90.56
COG4026290 Uncharacterized protein containing TOPRIM domain, 90.55
PF09304107 Cortex-I_coil: Cortexillin I, coiled coil; InterPr 90.54
PF02403108 Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal dom 90.45
PF11932251 DUF3450: Protein of unknown function (DUF3450); In 90.21
COG3883265 Uncharacterized protein conserved in bacteria [Fun 90.11
PF06785401 UPF0242: Uncharacterised protein family (UPF0242); 90.05
PF04849306 HAP1_N: HAP1 N-terminal conserved region; InterPro 90.04
PF1374789 DUF4164: Domain of unknown function (DUF4164) 89.84
PF12325120 TMF_TATA_bd: TATA element modulatory factor 1 TATA 89.74
PF05266190 DUF724: Protein of unknown function (DUF724); Inte 89.52
TIGR03495135 phage_LysB phage lysis regulatory protein, LysB fa 89.39
PF09726697 Macoilin: Transmembrane protein; InterPro: IPR0191 89.17
KOG4005292 consensus Transcription factor XBP-1 [Transcriptio 88.81
PF10186302 Atg14: UV radiation resistance protein and autopha 88.8
PRK09039343 hypothetical protein; Validated 88.72
PF1280852 Mto2_bdg: Micro-tubular organiser Mto1 C-term Mto2 88.55
PF1022480 DUF2205: Predicted coiled-coil protein (DUF2205); 88.45
PF0218345 HALZ: Homeobox associated leucine zipper; InterPro 88.4
PF07106169 TBPIP: Tat binding protein 1(TBP-1)-interacting pr 88.34
PF14662193 CCDC155: Coiled-coil region of CCDC155 88.22
PF04880166 NUDE_C: NUDE protein, C-terminal conserved region; 88.05
PF10805106 DUF2730: Protein of unknown function (DUF2730); In 87.79
PF04111314 APG6: Autophagy protein Apg6; InterPro: IPR007243 87.78
PF15070 617 GOLGA2L5: Putative golgin subfamily A member 2-lik 87.75
KOG1962216 consensus B-cell receptor-associated protein and r 87.66
PF1232974 TMF_DNA_bd: TATA element modulatory factor 1 DNA b 87.54
PF0864796 BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR01395 87.53
TIGR00219283 mreC rod shape-determining protein MreC. MreC (mur 87.18
PRK0440675 hypothetical protein; Provisional 86.85
COG4467114 Regulator of replication initiation timing [Replic 86.83
PF07888546 CALCOCO1: Calcium binding and coiled-coil domain ( 86.81
PF1232974 TMF_DNA_bd: TATA element modulatory factor 1 DNA b 86.7
PRK0211973 hypothetical protein; Provisional 86.52
PRK00888105 ftsB cell division protein FtsB; Reviewed 86.45
PF10473140 CENP-F_leu_zip: Leucine-rich repeats of kinetochor 86.44
PF0410269 SlyX: SlyX; InterPro: IPR007236 The SlyX protein h 86.28
PRK05431 425 seryl-tRNA synthetase; Provisional 86.28
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 86.26
PHA02562562 46 endonuclease subunit; Provisional 85.35
COG4942 420 Membrane-bound metallopeptidase [Cell division and 85.28
KOG3119269 consensus Basic region leucine zipper transcriptio 85.12
PF09304107 Cortex-I_coil: Cortexillin I, coiled coil; InterPr 85.1
PF11180192 DUF2968: Protein of unknown function (DUF2968); In 84.98
KOG4196135 consensus bZIP transcription factor MafK [Transcri 84.86
PF06785 401 UPF0242: Uncharacterised protein family (UPF0242); 84.84
KOG1414395 consensus Transcriptional activator FOSB/c-Fos and 84.66
PF04156191 IncA: IncA protein; InterPro: IPR007285 Chlamydia 84.64
PF15035182 Rootletin: Ciliary rootlet component, centrosome c 84.62
PF14662193 CCDC155: Coiled-coil region of CCDC155 84.61
COG307479 Uncharacterized protein conserved in bacteria [Fun 84.59
KOG0982502 consensus Centrosomal protein Nuf [Cell cycle cont 84.52
COG4942 420 Membrane-bound metallopeptidase [Cell division and 84.51
PRK0432574 hypothetical protein; Provisional 84.5
PF12325120 TMF_TATA_bd: TATA element modulatory factor 1 TATA 84.03
KOG1853333 consensus LIS1-interacting protein NUDE [Cytoskele 83.93
PF05837106 CENP-H: Centromere protein H (CENP-H); InterPro: I 83.93
PF0017064 bZIP_1: bZIP transcription factor cAMP response el 83.89
PRK0084677 hypothetical protein; Provisional 83.86
PRK09039343 hypothetical protein; Validated 83.71
PF12777344 MT: Microtubule-binding stalk of dynein motor; Int 83.68
PRK0279372 phi X174 lysis protein; Provisional 83.63
KOG4403 575 consensus Cell surface glycoprotein STIM, contains 83.15
PF10805106 DUF2730: Protein of unknown function (DUF2730); In 83.08
PF10226195 DUF2216: Uncharacterized conserved proteins (DUF22 83.01
PF12718143 Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 82.97
PF07407 420 Seadorna_VP6: Seadornavirus VP6 protein; InterPro: 82.9
PF10211189 Ax_dynein_light: Axonemal dynein light chain; Inte 82.77
smart0033865 BRLZ basic region leucin zipper. 82.73
PF05266190 DUF724: Protein of unknown function (DUF724); Inte 82.7
PF1271186 Kinesin-relat_1: Kinesin motor; InterPro: IPR02465 82.63
PF06810155 Phage_GP20: Phage minor structural protein GP20; I 82.53
PF10211189 Ax_dynein_light: Axonemal dynein light chain; Inte 82.53
PF06632342 XRCC4: DNA double-strand break repair and V(D)J re 82.52
TIGR01843423 type_I_hlyD type I secretion membrane fusion prote 82.48
PF10205102 KLRAQ: Predicted coiled-coil domain-containing pro 82.46
PF15294278 Leu_zip: Leucine zipper 82.42
TIGR03752 472 conj_TIGR03752 integrating conjugative element pro 82.36
KOG1414395 consensus Transcriptional activator FOSB/c-Fos and 82.3
PRK05431 425 seryl-tRNA synthetase; Provisional 81.97
PF1157768 NEMO: NF-kappa-B essential modulator NEMO; InterPr 81.94
PF00038312 Filament: Intermediate filament protein; InterPro: 81.92
PRK0029568 hypothetical protein; Provisional 81.83
KOG0288 459 consensus WD40 repeat protein TipD [General functi 81.58
PF0410269 SlyX: SlyX; InterPro: IPR007236 The SlyX protein h 81.57
PHA03162135 hypothetical protein; Provisional 81.55
PF0497780 DivIC: Septum formation initiator; InterPro: IPR00 81.4
smart0034044 HALZ homeobox associated leucin zipper. 81.33
PRK13922276 rod shape-determining protein MreC; Provisional 81.3
PF05667594 DUF812: Protein of unknown function (DUF812); Inte 81.17
PF09728309 Taxilin: Myosin-like coiled-coil protein; InterPro 81.14
PF09726697 Macoilin: Transmembrane protein; InterPro: IPR0191 80.76
PF07058 351 Myosin_HC-like: Myosin II heavy chain-like; InterP 80.74
PRK0211973 hypothetical protein; Provisional 80.67
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 80.65
PRK13922276 rod shape-determining protein MreC; Provisional 80.62
PF10481307 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 80.47
PLN02678 448 seryl-tRNA synthetase 80.44
PF04111314 APG6: Autophagy protein Apg6; InterPro: IPR007243 80.3
KOG0977 546 consensus Nuclear envelope protein lamin, intermed 80.29
PF07412200 Geminin: Geminin; InterPro: IPR022786 This family 80.03
KOG0250 1074 consensus DNA repair protein RAD18 (SMC family pro 80.02
PF03962188 Mnd1: Mnd1 family; InterPro: IPR005647 This family 80.02
>PF12498 bZIP_C: Basic leucine-zipper C terminal; InterPro: IPR020983 Basic leucine-zipper (bZIP) proteins are found in eukaryotes Back     alignment and domain information
Probab=99.94  E-value=6.4e-28  Score=211.01  Aligned_cols=114  Identities=39%  Similarity=0.604  Sum_probs=97.9

Q ss_pred             HHHHHHHHHHHHHHHHhhcchhhhhccCCCCCCCCCCCCCCccCcCCCCCCCCCCCccccccCCCCCCCCCCCCCCCCCC
Q 013166          301 TLRAKVKMAEETVKRVTGLNPLLLARSDVPGVGMPLVNVPLDASRNATHPMQPNPNQFFHQAIPSISTPTPNHQSLDSSF  380 (448)
Q Consensus       301 ~Lr~kLk~aE~~v~Rl~~ln~~l~~~~~~~~~~~p~~~~~~~~s~~~~vp~q~~~~~~~~~~~~~~~~~~~~~~~~~n~~  380 (448)
                      +||+|||||||+|+|++++|++|+++.++++++|||.++++|+.+++++|||+++.|||+++.++.+++..+     |. 
T Consensus         1 TLRAKVKMAEe~VkRvTg~n~~~~~~~~~ss~~~p~~~~~s~~~~~~~~Piq~~~~~~~~~~~~~~~i~~~~-----~~-   74 (115)
T PF12498_consen    1 TLRAKVKMAEETVKRVTGMNPMFQAISQMSSMGMPFSSSPSPADSSAAVPIQDNSNNYFHQPNPNPTISVHG-----NN-   74 (115)
T ss_pred             ChhHHHHHHHHHHHHHhccCccccccccCCCCCCCCCCCcccccccccCCccCCchhhccCCCCCCCcCCCC-----cc-
Confidence            499999999999999999999999999999999999999999888899999999999999988888876322     11 


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCcccccccccccccccCCccCCC
Q 013166          381 PSNIQLPTVGNPQSDRGGKNMTETSPLQHAVGLEHVPQGVGHRVSPP  427 (448)
Q Consensus       381 ~~~~~~p~~~~~q~~~~~~~m~~~~s~q~vaslehlqkr~~~~~~~~  427 (448)
                          +.+.   ++...++.||+|+++|||||||||||||||+|+++|
T Consensus        75 ----~~~~---~~~~~~~~~~~~t~smqrvaslEhlQkri~~g~~~~  114 (115)
T PF12498_consen   75 ----DNPE---PGGAFVGGKMGRTASMQRVASLEHLQKRIRGGPTSS  114 (115)
T ss_pred             ----cccc---cccccccccccCCccCccchhHHHHHHHhcCCCCCC
Confidence                1221   122347889999999999999999999999998765



They are typically between 174 and 411 amino acids in length. Various bZIP proteins have been found and shown to play a role in seed-specific gene expression. bZIP binds to the alpha-globulin gene promoter, but not to promoters of other major storage genes such as glutelin, prolamin and albumin []. This entry represents a C-terminal domain found in bZIP proteins. It is found in association with PF00170 from PFAM. There is a conserved KVK sequence motif and a single completely conserved residue K that may be functionally important.

>smart00338 BRLZ basic region leucin zipper Back     alignment and domain information
>PF00170 bZIP_1: bZIP transcription factor cAMP response element binding (CREB) protein signature fos transforming protein signature jun transcription factor signature; InterPro: IPR011616 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotic are proteins that contain a basic region mediating sequence-specific DNA-binding followed by a leucine zipper region (see IPR002158 from INTERPRO) required for dimerization Back     alignment and domain information
>KOG4005 consensus Transcription factor XBP-1 [Transcription] Back     alignment and domain information
>KOG4343 consensus bZIP transcription factor ATF6 [Transcription] Back     alignment and domain information
>PF07716 bZIP_2: Basic region leucine zipper; InterPro: IPR011700 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotes are proteins that contain a basic region mediating sequence-specific DNA-binding, followed by a leucine zipper region (see IPR002158 from INTERPRO), which is required for dimerization Back     alignment and domain information
>KOG0709 consensus CREB/ATF family transcription factor [Transcription] Back     alignment and domain information
>KOG3584 consensus cAMP response element binding protein and related transcription factors [Transcription] Back     alignment and domain information
>KOG0837 consensus Transcriptional activator of the JUN family [Transcription] Back     alignment and domain information
>PF03131 bZIP_Maf: bZIP Maf transcription factor; InterPro: IPR004826 There are several different types of Maf transcription factors with different roles in the cell Back     alignment and domain information
>KOG4196 consensus bZIP transcription factor MafK [Transcription] Back     alignment and domain information
>KOG4571 consensus Activating transcription factor 4 [Transcription] Back     alignment and domain information
>KOG3119 consensus Basic region leucine zipper transcription factor [Transcription] Back     alignment and domain information
>PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation Back     alignment and domain information
>KOG3863 consensus bZIP transcription factor NRF1 [Transcription] Back     alignment and domain information
>TIGR02449 conserved hypothetical protein TIGR02449 Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>PF07989 Microtub_assoc: Microtubule associated; InterPro: IPR012943 Proteins with this domain associate with the spindle body during cell division [] Back     alignment and domain information
>PF06156 DUF972: Protein of unknown function (DUF972); InterPro: IPR010377 FUNCTION: Involved in initiation control of chromosome replication Back     alignment and domain information
>PF02183 HALZ: Homeobox associated leucine zipper; InterPro: IPR003106 This region is a plant specific leucine zipper that is always found associated with a homeobox [] Back     alignment and domain information
>TIGR02449 conserved hypothetical protein TIGR02449 Back     alignment and domain information
>PRK13169 DNA replication intiation control protein YabA; Reviewed Back     alignment and domain information
>PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 Back     alignment and domain information
>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>PF06156 DUF972: Protein of unknown function (DUF972); InterPro: IPR010377 FUNCTION: Involved in initiation control of chromosome replication Back     alignment and domain information
>PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation Back     alignment and domain information
>COG3074 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK13729 conjugal transfer pilus assembly protein TraB; Provisional Back     alignment and domain information
>PRK13169 DNA replication intiation control protein YabA; Reviewed Back     alignment and domain information
>COG4467 Regulator of replication initiation timing [Replication, recombination, and repair] Back     alignment and domain information
>PF04899 MbeD_MobD: MbeD/MobD like ; InterPro: IPR006983 The MbeD and MobD proteins are plasmid encoded, and are involved in the plasmid mobilisation and transfer in the presence of conjugative plasmids [] Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch Back     alignment and domain information
>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch Back     alignment and domain information
>PRK15422 septal ring assembly protein ZapB; Provisional Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PRK15422 septal ring assembly protein ZapB; Provisional Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>COG2433 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences Back     alignment and domain information
>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>PF13851 GAS: Growth-arrest specific micro-tubule binding Back     alignment and domain information
>TIGR03752 conj_TIGR03752 integrating conjugative element protein, PFL_4705 family Back     alignment and domain information
>COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] Back     alignment and domain information
>PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 Back     alignment and domain information
>COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] Back     alignment and domain information
>PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold) Back     alignment and domain information
>PF02403 Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal domain; InterPro: IPR015866 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>COG3883 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function Back     alignment and domain information
>PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues Back     alignment and domain information
>PF13747 DUF4164: Domain of unknown function (DUF4164) Back     alignment and domain information
>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] Back     alignment and domain information
>PF05266 DUF724: Protein of unknown function (DUF724); InterPro: IPR007930 This family contains several uncharacterised proteins found exclusively in Arabidopsis thaliana Back     alignment and domain information
>TIGR03495 phage_LysB phage lysis regulatory protein, LysB family Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>KOG4005 consensus Transcription factor XBP-1 [Transcription] Back     alignment and domain information
>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>PF12808 Mto2_bdg: Micro-tubular organiser Mto1 C-term Mto2-binding region; InterPro: IPR024545 This domain occurs at the C terminus of microtubule organising proteins in both budding and fission fungi Back     alignment and domain information
>PF10224 DUF2205: Predicted coiled-coil protein (DUF2205); InterPro: IPR019357 This entry represents a highly conserved 100 residue region which is likely to have a coiled-coil structure Back     alignment and domain information
>PF02183 HALZ: Homeobox associated leucine zipper; InterPro: IPR003106 This region is a plant specific leucine zipper that is always found associated with a homeobox [] Back     alignment and domain information
>PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences Back     alignment and domain information
>PF14662 CCDC155: Coiled-coil region of CCDC155 Back     alignment and domain information
>PF04880 NUDE_C: NUDE protein, C-terminal conserved region; InterPro: IPR006964 This domain represents the C-terminal conserved region of NUDE proteins Back     alignment and domain information
>PF10805 DUF2730: Protein of unknown function (DUF2730); InterPro: IPR020269 This entry represents a family of various hypothetical proteins Back     alignment and domain information
>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 Back     alignment and domain information
>KOG1962 consensus B-cell receptor-associated protein and related proteins [Defense mechanisms] Back     alignment and domain information
>PF12329 TMF_DNA_bd: TATA element modulatory factor 1 DNA binding; InterPro: IPR022092 This is the middle region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes that contains at its N-terminal section a number of leucine zippers that could potentially form coiled coil structures Back     alignment and domain information
>PF08647 BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR013956 BRE1 is an E3 ubiquitin ligase that has been shown to act as a transcriptional activator through direct activator interactions [] Back     alignment and domain information
>TIGR00219 mreC rod shape-determining protein MreC Back     alignment and domain information
>PRK04406 hypothetical protein; Provisional Back     alignment and domain information
>COG4467 Regulator of replication initiation timing [Replication, recombination, and repair] Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>PF12329 TMF_DNA_bd: TATA element modulatory factor 1 DNA binding; InterPro: IPR022092 This is the middle region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes that contains at its N-terminal section a number of leucine zippers that could potentially form coiled coil structures Back     alignment and domain information
>PRK02119 hypothetical protein; Provisional Back     alignment and domain information
>PRK00888 ftsB cell division protein FtsB; Reviewed Back     alignment and domain information
>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] Back     alignment and domain information
>PF04102 SlyX: SlyX; InterPro: IPR007236 The SlyX protein has no known function Back     alignment and domain information
>PRK05431 seryl-tRNA synthetase; Provisional Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>KOG3119 consensus Basic region leucine zipper transcription factor [Transcription] Back     alignment and domain information
>PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold) Back     alignment and domain information
>PF11180 DUF2968: Protein of unknown function (DUF2968); InterPro: IPR021350 This family of proteins has no known function Back     alignment and domain information
>KOG4196 consensus bZIP transcription factor MafK [Transcription] Back     alignment and domain information
>PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function Back     alignment and domain information
>KOG1414 consensus Transcriptional activator FOSB/c-Fos and related bZIP transcription factors [Transcription] Back     alignment and domain information
>PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion Back     alignment and domain information
>PF15035 Rootletin: Ciliary rootlet component, centrosome cohesion Back     alignment and domain information
>PF14662 CCDC155: Coiled-coil region of CCDC155 Back     alignment and domain information
>COG3074 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG0982 consensus Centrosomal protein Nuf [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK04325 hypothetical protein; Provisional Back     alignment and domain information
>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] Back     alignment and domain information
>KOG1853 consensus LIS1-interacting protein NUDE [Cytoskeleton] Back     alignment and domain information
>PF05837 CENP-H: Centromere protein H (CENP-H); InterPro: IPR008426 Chromosome segregation in eukaryotes requires the kinetochore, a multi-protein structure that assembles on centromeric DNA, and which acts to link chromosomes to spindle microtubules Back     alignment and domain information
>PF00170 bZIP_1: bZIP transcription factor cAMP response element binding (CREB) protein signature fos transforming protein signature jun transcription factor signature; InterPro: IPR011616 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotic are proteins that contain a basic region mediating sequence-specific DNA-binding followed by a leucine zipper region (see IPR002158 from INTERPRO) required for dimerization Back     alignment and domain information
>PRK00846 hypothetical protein; Provisional Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>PF12777 MT: Microtubule-binding stalk of dynein motor; InterPro: IPR024743 The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases Back     alignment and domain information
>PRK02793 phi X174 lysis protein; Provisional Back     alignment and domain information
>KOG4403 consensus Cell surface glycoprotein STIM, contains SAM domain [General function prediction only] Back     alignment and domain information
>PF10805 DUF2730: Protein of unknown function (DUF2730); InterPro: IPR020269 This entry represents a family of various hypothetical proteins Back     alignment and domain information
>PF10226 DUF2216: Uncharacterized conserved proteins (DUF2216); InterPro: IPR019359 Proteins in this entry are found in Metazoa and contain a coiled-coil domain Back     alignment and domain information
>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>PF07407 Seadorna_VP6: Seadornavirus VP6 protein; InterPro: IPR009982 This family consists of several VP6 proteins from the Banna virus as well as a related protein VP5 from the Kadipiro virus Back     alignment and domain information
>PF10211 Ax_dynein_light: Axonemal dynein light chain; InterPro: IPR019347 Axonemal dynein light chain proteins play a dynamic role in flagellar and cilial motility Back     alignment and domain information
>smart00338 BRLZ basic region leucin zipper Back     alignment and domain information
>PF05266 DUF724: Protein of unknown function (DUF724); InterPro: IPR007930 This family contains several uncharacterised proteins found exclusively in Arabidopsis thaliana Back     alignment and domain information
>PF12711 Kinesin-relat_1: Kinesin motor; InterPro: IPR024658 Kinesin [, , ] is a microtubule-associated force-producing protein that may play a role in organelle transport Back     alignment and domain information
>PF06810 Phage_GP20: Phage minor structural protein GP20; InterPro: IPR009636 This family consists of several phage minor structural protein Gp20 sequences and prophage sequences of around 180 residues in length Back     alignment and domain information
>PF10211 Ax_dynein_light: Axonemal dynein light chain; InterPro: IPR019347 Axonemal dynein light chain proteins play a dynamic role in flagellar and cilial motility Back     alignment and domain information
>PF06632 XRCC4: DNA double-strand break repair and V(D)J recombination protein XRCC4; InterPro: IPR010585 This entry represents the DNA double-strand break repair and V(D)J recombination protein XRCC4, which is found in certain Metazoans, fungi and plants Back     alignment and domain information
>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family Back     alignment and domain information
>PF10205 KLRAQ: Predicted coiled-coil domain-containing protein; InterPro: IPR019343 This entry represents a N-terminal 100 residues long domain, which contains a conserved KLRAQ motif Back     alignment and domain information
>PF15294 Leu_zip: Leucine zipper Back     alignment and domain information
>TIGR03752 conj_TIGR03752 integrating conjugative element protein, PFL_4705 family Back     alignment and domain information
>KOG1414 consensus Transcriptional activator FOSB/c-Fos and related bZIP transcription factors [Transcription] Back     alignment and domain information
>PRK05431 seryl-tRNA synthetase; Provisional Back     alignment and domain information
>PF11577 NEMO: NF-kappa-B essential modulator NEMO; InterPro: IPR021063 This entry represents a conserved domain found at the N-terminal of NF-kappa-B essential modulator (NEMO) and optineurin proteins Back     alignment and domain information
>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope Back     alignment and domain information
>PRK00295 hypothetical protein; Provisional Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>PF04102 SlyX: SlyX; InterPro: IPR007236 The SlyX protein has no known function Back     alignment and domain information
>PHA03162 hypothetical protein; Provisional Back     alignment and domain information
>PF04977 DivIC: Septum formation initiator; InterPro: IPR007060 DivIC, from the spore-forming, Gram-positive bacterium Bacillus subtilis, is necessary for both vegetative and sporulation septum formation [] Back     alignment and domain information
>smart00340 HALZ homeobox associated leucin zipper Back     alignment and domain information
>PRK13922 rod shape-determining protein MreC; Provisional Back     alignment and domain information
>PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>PF09728 Taxilin: Myosin-like coiled-coil protein; InterPro: IPR019132 Taxilin contains an extraordinarily long coiled-coil domain in its C-terminal half and is ubiquitously expressed Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>PF07058 Myosin_HC-like: Myosin II heavy chain-like; InterPro: IPR009768 This family represents a conserved region within a number of myosin II heavy chain-like proteins that seem to be specific to Arabidopsis thaliana Back     alignment and domain information
>PRK02119 hypothetical protein; Provisional Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>PRK13922 rod shape-determining protein MreC; Provisional Back     alignment and domain information
>PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] Back     alignment and domain information
>PLN02678 seryl-tRNA synthetase Back     alignment and domain information
>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] Back     alignment and domain information
>PF07412 Geminin: Geminin; InterPro: IPR022786 This family contains the eukaryotic protein geminin (approximately 200 residues long) Back     alignment and domain information
>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] Back     alignment and domain information
>PF03962 Mnd1: Mnd1 family; InterPro: IPR005647 This family of proteins includes meiotic nuclear division protein 1 (MND1) from Saccharomyces cerevisiae (Baker's yeast) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query448
1dh3_A55 Transcription factor CREB; protein-DNA complex, tr 2e-14
1t2k_D61 Cyclic-AMP-dependent transcription factor ATF-2; p 2e-10
1jnm_A62 Proto-oncogene C-JUN; BZIP, protein-DNA complex, t 5e-09
3a5t_A107 Transcription factor MAFG; protein-DNA complex, BZ 8e-09
1ci6_A63 Transcription factor ATF-4; BZIP; 2.60A {Homo sapi 1e-08
2wt7_A63 Proto-oncogene protein C-FOS; transcription, trans 2e-08
2dgc_A63 Protein (GCN4); basic domain, leucine zipper, DNA 5e-08
2wt7_B90 Transcription factor MAFB; transcription, transcri 8e-08
1gd2_E70 Transcription factor PAP1; basic leucine zipper, p 3e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-05
1hjb_A87 Ccaat/enhancer binding protein beta; transcription 1e-05
1gu4_A78 CAAT/enhancer binding protein beta; transcription/ 4e-04
>1dh3_A Transcription factor CREB; protein-DNA complex, transcription/DNA complex; HET: DNA; 3.00A {Mus musculus} SCOP: h.1.3.1 Length = 55 Back     alignment and structure
 Score = 66.3 bits (162), Expect = 2e-14
 Identities = 18/52 (34%), Positives = 32/52 (61%)

Query: 234 KRARRMLSNRESARRSRRRKQAHLNELETQAGQLRAEHSSLLKGLTDVNQKY 285
           KR  R++ NRE+AR SRR+K+ ++  LE +   L  ++ +L++ L  +   Y
Sbjct: 1   KREVRLMKNREAARESRRKKKEYVKSLENRVAVLENQNKTLIEELKALKDLY 52


>1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 Length = 61 Back     alignment and structure
>1jnm_A Proto-oncogene C-JUN; BZIP, protein-DNA complex, transcription/DNA complex; 2.20A {Homo sapiens} SCOP: h.1.3.1 PDB: 1fos_F 2h7h_A 1t2k_C 1a02_J* 1s9k_E 1jun_A Length = 62 Back     alignment and structure
>3a5t_A Transcription factor MAFG; protein-DNA complex, BZIP factor, acetylation, DNA-binding, isopeptide bond, nucleus; 2.80A {Mus musculus} Length = 107 Back     alignment and structure
>1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 Length = 63 Back     alignment and structure
>2wt7_A Proto-oncogene protein C-FOS; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 1fos_E* 1a02_F* 1s9k_D Length = 63 Back     alignment and structure
>2dgc_A Protein (GCN4); basic domain, leucine zipper, DNA binding, eukaryotic regulatory protein, transcription/DNA complex; HET: DNA; 2.20A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1dgc_A* 1ld4_E 1ysa_C* 3p8m_D Length = 63 Back     alignment and structure
>2wt7_B Transcription factor MAFB; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 2wty_A* 1k1v_A Length = 90 Back     alignment and structure
>1gd2_E Transcription factor PAP1; basic leucine zipper, protein-DNA complex, transcription/DNA complex; HET: DNA; 2.00A {Schizosaccharomyces pombe} SCOP: h.1.3.1 Length = 70 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1 Length = 87 Back     alignment and structure
>1gu4_A CAAT/enhancer binding protein beta; transcription/DNA, protein-DNA complex, transcription factor, BZIP, C/EBP; 1.80A {Homo sapiens} SCOP: h.1.3.1 PDB: 1gtw_A 1gu5_A 1h88_A 1h8a_A 1io4_A 2e43_A* 2e42_A* 1h89_A 1ci6_B 1nwq_A Length = 78 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query448
1dh3_A55 Transcription factor CREB; protein-DNA complex, tr 99.51
2wt7_A63 Proto-oncogene protein C-FOS; transcription, trans 99.26
1t2k_D61 Cyclic-AMP-dependent transcription factor ATF-2; p 99.17
2dgc_A63 Protein (GCN4); basic domain, leucine zipper, DNA 99.16
1jnm_A62 Proto-oncogene C-JUN; BZIP, protein-DNA complex, t 99.06
1gd2_E70 Transcription factor PAP1; basic leucine zipper, p 98.88
1ci6_A63 Transcription factor ATF-4; BZIP; 2.60A {Homo sapi 98.83
1gu4_A78 CAAT/enhancer binding protein beta; transcription/ 98.45
1hjb_A87 Ccaat/enhancer binding protein beta; transcription 98.43
3a5t_A107 Transcription factor MAFG; protein-DNA complex, BZ 98.35
2wt7_B90 Transcription factor MAFB; transcription, transcri 98.06
2oqq_A42 Transcription factor HY5; homodimer leucine zipper 96.95
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 95.7
1skn_P92 DNA-binding domain of SKN-1; complex (transcriptio 95.28
2jee_A81 YIIU; FTSZ, septum, coiled-coil, cell division, ce 95.03
2jee_A81 YIIU; FTSZ, septum, coiled-coil, cell division, ce 94.61
1deb_A54 APC protein, adenomatous polyposis coli protein; c 94.57
3a7p_A152 Autophagy protein 16; coiled-coil, coiled coil, cy 94.06
2w6a_A63 ARF GTPase-activating protein GIT1; PIX, zinc, sig 93.75
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 93.45
1wlq_A83 Geminin; coiled-coil; 2.80A {Mus musculus} PDB: 2z 92.9
1go4_E100 MAD1 (mitotic arrest deficient)-like 1; mitotic sp 92.49
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 92.29
3u1c_A101 Tropomyosin alpha-1 chain; anti-parallel coiled co 91.43
2w83_C77 C-JUN-amino-terminal kinase-interacting protein 4; 91.27
3s9g_A104 Protein hexim1; cyclin T-binding domain (TBD), cyc 90.91
1ic2_A81 Tropomyosin alpha chain, skeletal muscle; alpha-he 90.64
3u59_A101 Tropomyosin beta chain; muscle contraction, actin, 90.44
3u1c_A101 Tropomyosin alpha-1 chain; anti-parallel coiled co 90.31
3a7p_A152 Autophagy protein 16; coiled-coil, coiled coil, cy 90.25
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 90.16
3m9b_A251 Proteasome-associated ATPase; coil COIL with 5 bet 90.03
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 89.96
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 89.46
2wt7_A63 Proto-oncogene protein C-FOS; transcription, trans 89.46
1hjb_A87 Ccaat/enhancer binding protein beta; transcription 89.35
3u59_A101 Tropomyosin beta chain; muscle contraction, actin, 89.3
1ci6_A63 Transcription factor ATF-4; BZIP; 2.60A {Homo sapi 89.26
2v66_B111 Nuclear distribution protein NUDE-like 1; structur 88.94
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 88.91
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 88.82
1t2k_D61 Cyclic-AMP-dependent transcription factor ATF-2; p 88.69
2eqb_B97 RAB guanine nucleotide exchange factor SEC2; coile 88.66
2v4h_A110 NF-kappa-B essential modulator; transcription, met 88.64
1wle_A 501 Seryl-tRNA synthetase; ligase; HET: SRP; 1.65A {Bo 88.1
3o0z_A168 RHO-associated protein kinase 1; coiled-coil, tran 87.86
3o0z_A168 RHO-associated protein kinase 1; coiled-coil, tran 87.46
3cve_A72 Homer protein homolog 1; coiled coil, alternative 87.1
1gd2_E70 Transcription factor PAP1; basic leucine zipper, p 86.98
2wvr_A209 Geminin; DNA replication license, DNA replication 86.95
3m48_A33 General control protein GCN4; leucine zipper, synt 86.94
3he5_A49 Synzip1; heterodimeric coiled-coil, de novo protei 86.91
3jsv_C94 NF-kappa-B essential modulator; ubiquitin, coiled- 86.79
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 86.53
1p9i_A31 Cortexillin I/GCN4 hybrid peptide; coiled-coil, un 86.52
2c9l_Y63 EB1, zebra, BZLF1 trans-activator protein; viral p 86.46
1kd8_B36 GABH BLL, GCN4 acid base heterodimer base-D12LA16L 86.21
1gu4_A78 CAAT/enhancer binding protein beta; transcription/ 85.89
1ses_A 421 Seryl-tRNA synthetase; ligase; HET: AHX AMP; 2.50A 85.82
3s9g_A104 Protein hexim1; cyclin T-binding domain (TBD), cyc 85.82
3cvf_A79 Homer-3, homer protein homolog 3; coiled coil, alt 85.75
2oxj_A34 Hybrid alpha/beta peptide based on the GCN4-P1 Se 85.41
2dq0_A 455 Seryl-tRNA synthetase; coiled-coil, homodimer, str 85.09
3s4r_A93 Vimentin; alpha-helix, cytoskeleton, intermediate 85.06
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 84.43
3vmx_A48 Voltage-gated hydrogen channel 1; coiled-coil, ION 84.23
3qne_A 485 Seryl-tRNA synthetase, cytoplasmic; amino acid bio 83.82
2zxx_A79 Geminin; coiled-coil, cell cycle, coiled coil, DNA 83.8
3bas_A89 Myosin heavy chain, striated muscle/general contro 83.76
2v66_B111 Nuclear distribution protein NUDE-like 1; structur 83.22
1jnm_A62 Proto-oncogene C-JUN; BZIP, protein-DNA complex, t 83.06
3mq7_A121 Bone marrow stromal antigen 2; HIV, antiviral prot 82.8
1kd8_A36 GABH AIV, GCN4 acid base heterodimer acid-D12IA16V 82.64
3a2a_A58 Voltage-gated hydrogen channel 1; voltage-gated pr 82.28
2xdj_A83 Uncharacterized protein YBGF; unknown function; 1. 82.25
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 81.82
2oa5_A110 Hypothetical protein BQLF2; MHR28B, NESG, structur 81.78
2oqq_A42 Transcription factor HY5; homodimer leucine zipper 81.68
4h22_A103 Leucine-rich repeat flightless-interacting protei; 81.66
3he5_B52 Synzip2; heterodimeric coiled-coil, de novo protei 81.65
3c3f_A34 Alpha/beta peptide with the GCN4-PLI SIDE chain S 81.53
3na7_A256 HP0958; flagellar biogenesis, flagellum export, C4 81.43
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 81.13
4etp_A 403 Kinesin-like protein KAR3; kinesin motor protein, 81.05
3a7o_A75 Autophagy protein 16; coiled-coil, coiled coil, cy 81.04
3iv1_A78 Tumor susceptibility gene 101 protein; coiled_COIL 80.95
3bas_A89 Myosin heavy chain, striated muscle/general contro 80.89
2kz5_A91 Transcription factor NF-E2 45 kDa subunit; structu 80.85
3efg_A78 Protein SLYX homolog; xanthomonas campestris PV. c 80.76
3swf_A74 CGMP-gated cation channel alpha-1; coiled-coil, as 80.36
2dgc_A63 Protein (GCN4); basic domain, leucine zipper, DNA 80.29
1x8y_A86 Lamin A/C; structural protein, intermediate filame 80.19
3m91_A51 Proteasome-associated ATPase; coil COIL alpha heli 80.14
>1dh3_A Transcription factor CREB; protein-DNA complex, transcription/DNA complex; HET: DNA; 3.00A {Mus musculus} SCOP: h.1.3.1 Back     alignment and structure
Probab=99.51  E-value=2.1e-14  Score=110.17  Aligned_cols=53  Identities=34%  Similarity=0.596  Sum_probs=49.6

Q ss_pred             HHHHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 013166          234 KRARRMLSNRESARRSRRRKQAHLNELETQAGQLRAEHSSLLKGLTDVNQKYD  286 (448)
Q Consensus       234 KR~RRmlsNRESARRSR~RKq~~LeeLE~qV~~Le~ENs~L~~ql~~l~q~~~  286 (448)
                      ||.+||++||+||++||+||++|+++||.+|..|+.||..|..++..|++.|.
T Consensus         1 kr~rR~~~NResA~rSR~RKk~~~~~LE~~v~~L~~eN~~L~~~~~~L~~~~~   53 (55)
T 1dh3_A            1 KREVRLMKNREAARESRRKKKEYVKSLENRVAVLENQNKTLIEELKALKDLYS   53 (55)
T ss_dssp             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTST
T ss_pred             ChHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhc
Confidence            68999999999999999999999999999999999999999999998887653



>2wt7_A Proto-oncogene protein C-FOS; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 1fos_E* 1a02_F* 1s9k_D Back     alignment and structure
>1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>2dgc_A Protein (GCN4); basic domain, leucine zipper, DNA binding, eukaryotic regulatory protein, transcription/DNA complex; HET: DNA; 2.20A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1dgc_A* 1ld4_E 1ysa_C* 3p8m_D Back     alignment and structure
>1jnm_A Proto-oncogene C-JUN; BZIP, protein-DNA complex, transcription/DNA complex; 2.20A {Homo sapiens} SCOP: h.1.3.1 PDB: 1fos_F 2h7h_A 1t2k_C 1a02_J* 1s9k_E 1jun_A Back     alignment and structure
>1gd2_E Transcription factor PAP1; basic leucine zipper, protein-DNA complex, transcription/DNA complex; HET: DNA; 2.00A {Schizosaccharomyces pombe} SCOP: h.1.3.1 Back     alignment and structure
>1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>1gu4_A CAAT/enhancer binding protein beta; transcription/DNA, protein-DNA complex, transcription factor, BZIP, C/EBP; 1.80A {Homo sapiens} SCOP: h.1.3.1 PDB: 1gtw_A 1gu5_A 1h88_A 1h8a_A 1io4_A 2e43_A* 2e42_A* 1h89_A 1ci6_B 1nwq_A Back     alignment and structure
>1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>3a5t_A Transcription factor MAFG; protein-DNA complex, BZIP factor, acetylation, DNA-binding, isopeptide bond, nucleus; 2.80A {Mus musculus} Back     alignment and structure
>2wt7_B Transcription factor MAFB; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 2wty_A* 1k1v_A Back     alignment and structure
>2oqq_A Transcription factor HY5; homodimer leucine zipper; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
>1skn_P DNA-binding domain of SKN-1; complex (transcription factor/DNA), transcription/DNA complex; HET: DNA LDA; 2.50A {Caenorhabditis elegans} SCOP: a.37.1.1 Back     alignment and structure
>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} Back     alignment and structure
>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} Back     alignment and structure
>1deb_A APC protein, adenomatous polyposis coli protein; coiled coil, tumor suppressor, structural protein; 2.40A {Homo sapiens} SCOP: h.1.18.1 Back     alignment and structure
>3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2w6a_A ARF GTPase-activating protein GIT1; PIX, zinc, signaling protein, CAT-1, cytoplasm, ANK repeat, coiled-coil, zinc-finger, metal-binding; 1.40A {Rattus norvegicus} Back     alignment and structure
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
>1wlq_A Geminin; coiled-coil; 2.80A {Mus musculus} PDB: 2zxx_A* Back     alignment and structure
>1go4_E MAD1 (mitotic arrest deficient)-like 1; mitotic spindle checkpoint, cell cycle, mitosis, nuclear Pro; 2.05A {Homo sapiens} SCOP: h.1.22.1 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A Back     alignment and structure
>2w83_C C-JUN-amino-terminal kinase-interacting protein 4; golgi apparatus, protein transport, ER-golgi transport, ARF, GTPase, effector, myristate; HET: GTP; 1.93A {Homo sapiens} Back     alignment and structure
>3s9g_A Protein hexim1; cyclin T-binding domain (TBD), cyclin T1/P-TEFB/7SK snRNA, N transcription; 2.10A {Homo sapiens} PDB: 2gd7_A Back     alignment and structure
>1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1 Back     alignment and structure
>3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} Back     alignment and structure
>3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A Back     alignment and structure
>3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3m9b_A Proteasome-associated ATPase; coil COIL with 5 beta-strand barrel inter domain, chaperone; 3.94A {Mycobacterium tuberculosis} PDB: 3m9d_A Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Back     alignment and structure
>2wt7_A Proto-oncogene protein C-FOS; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 1fos_E* 1a02_F* 1s9k_D Back     alignment and structure
>1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} Back     alignment and structure
>1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Back     alignment and structure
>1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>2eqb_B RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 2.70A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure
>2v4h_A NF-kappa-B essential modulator; transcription, metal-binding, NEMO - IKK gamma - NFKB pathwa darpin, transcription regulation; 2.9A {Mus musculus} Back     alignment and structure
>1wle_A Seryl-tRNA synthetase; ligase; HET: SRP; 1.65A {Bos taurus} Back     alignment and structure
>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Back     alignment and structure
>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Back     alignment and structure
>3cve_A Homer protein homolog 1; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, postsynaptic cell membrane, synapse; 1.75A {Rattus norvegicus} Back     alignment and structure
>1gd2_E Transcription factor PAP1; basic leucine zipper, protein-DNA complex, transcription/DNA complex; HET: DNA; 2.00A {Schizosaccharomyces pombe} SCOP: h.1.3.1 Back     alignment and structure
>2wvr_A Geminin; DNA replication license, DNA replication inhibitor, phosphoprotein, UBL conjugation, DNA-binding, polymorphism; HET: DNA; 3.30A {Homo sapiens} Back     alignment and structure
>3m48_A General control protein GCN4; leucine zipper, synthetic peptide, alpha helix, activa amino-acid biosynthesis, DNA-binding, nucleus; 1.45A {Synthetic} PDB: 3i1g_A 2ahp_A* 2o7h_A Back     alignment and structure
>3he5_A Synzip1; heterodimeric coiled-coil, de novo protein; 1.75A {Artificial gene} Back     alignment and structure
>3jsv_C NF-kappa-B essential modulator; ubiquitin, coiled-coil, cellular signaling, cytoplasm, isopeptide bond, nucleus, phosphoprotein, UBL conjugation; 2.70A {Mus musculus} PDB: 3f89_A 2zvo_B 2zvn_B Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>1p9i_A Cortexillin I/GCN4 hybrid peptide; coiled-coil, unknown function; 1.17A {Synthetic} SCOP: h.1.10.1 Back     alignment and structure
>2c9l_Y EB1, zebra, BZLF1 trans-activator protein; viral protein, epstein-BARR virus, EBV; 2.25A {Human herpesvirus 4} SCOP: h.1.3.1 PDB: 2c9n_Y Back     alignment and structure
>1kd8_B GABH BLL, GCN4 acid base heterodimer base-D12LA16L; coiled coil heterodimer, de novo protein; 1.90A {Synthetic} SCOP: h.1.3.1 PDB: 1kd9_B 1kdd_B Back     alignment and structure
>1gu4_A CAAT/enhancer binding protein beta; transcription/DNA, protein-DNA complex, transcription factor, BZIP, C/EBP; 1.80A {Homo sapiens} SCOP: h.1.3.1 PDB: 1gtw_A 1gu5_A 1h88_A 1h8a_A 1io4_A 2e43_A* 2e42_A* 1h89_A 1ci6_B 1nwq_A Back     alignment and structure
>1ses_A Seryl-tRNA synthetase; ligase; HET: AHX AMP; 2.50A {Thermus thermophilus} SCOP: a.2.7.1 d.104.1.1 PDB: 1ser_A* 1set_A* 1sry_A Back     alignment and structure
>3s9g_A Protein hexim1; cyclin T-binding domain (TBD), cyclin T1/P-TEFB/7SK snRNA, N transcription; 2.10A {Homo sapiens} PDB: 2gd7_A Back     alignment and structure
>3cvf_A Homer-3, homer protein homolog 3; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, phosphoprotein, polymorphism; 2.90A {Homo sapiens} Back     alignment and structure
>2oxj_A Hybrid alpha/beta peptide based on the GCN4-P1 Se heptad positions B and F substituted...; helix bundle, foldamer, unknown function; HET: B3K B3D B3E B3S B3Y B3X B3A BAL; 2.00A {Synthetic} PDB: 2oxk_A* Back     alignment and structure
>2dq0_A Seryl-tRNA synthetase; coiled-coil, homodimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: SSA; 2.60A {Pyrococcus horikoshii} PDB: 2dq1_A* 2dq2_A 2zr2_A* 2zr3_A Back     alignment and structure
>3s4r_A Vimentin; alpha-helix, cytoskeleton, intermediate filament, structural; 2.45A {Homo sapiens} PDB: 3ssu_A Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Back     alignment and structure
>3vmx_A Voltage-gated hydrogen channel 1; coiled-coil, ION channel, ION transport, membrane protein; 1.45A {Mus musculus} Back     alignment and structure
>3qne_A Seryl-tRNA synthetase, cytoplasmic; amino acid biosynthesis, CTG-clade, codon ambiguity, pathoge II aminoacyl-tRNA synthetase family; 2.00A {Candida albicans} PDB: 3qo7_A* 3qo8_A* 3qo5_A Back     alignment and structure
>2zxx_A Geminin; coiled-coil, cell cycle, coiled coil, DNA replication inhibitor, phosphoprotein, DNA-binding, nucleus, proto-oncogene; HET: DNA; 2.80A {Mus musculus} Back     alignment and structure
>3bas_A Myosin heavy chain, striated muscle/general control protein GCN4 chimera; alpha-helical coiled coil, disorder, salt links; 2.30A {Argopecten irradians} SCOP: h.1.26.1 PDB: 1nkn_A 3bat_A Back     alignment and structure
>2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens} Back     alignment and structure
>1jnm_A Proto-oncogene C-JUN; BZIP, protein-DNA complex, transcription/DNA complex; 2.20A {Homo sapiens} SCOP: h.1.3.1 PDB: 1fos_F 2h7h_A 1t2k_C 1a02_J* 1s9k_E 1jun_A Back     alignment and structure
>3mq7_A Bone marrow stromal antigen 2; HIV, antiviral protein; 2.28A {Homo sapiens} PDB: 3mqc_A 3mqb_A 3mkx_A 3nwh_A 2xg7_A* 2x7a_A Back     alignment and structure
>1kd8_A GABH AIV, GCN4 acid base heterodimer acid-D12IA16V; coiled coil heterodimer, de novo protein; 1.90A {Synthetic} SCOP: h.1.3.1 PDB: 1kdd_A 1kd9_A Back     alignment and structure
>3a2a_A Voltage-gated hydrogen channel 1; voltage-gated proton channel, alternative splicing, coiled C transport, ionic channel, membrane, transmembrane; 2.00A {Homo sapiens} Back     alignment and structure
>2xdj_A Uncharacterized protein YBGF; unknown function; 1.82A {Escherichia coli} PDB: 2wz7_A Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>2oa5_A Hypothetical protein BQLF2; MHR28B, NESG, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; HET: PE5; 2.10A {Murid herpesvirus 4} SCOP: d.362.1.1 PDB: 2h3r_A* Back     alignment and structure
>2oqq_A Transcription factor HY5; homodimer leucine zipper; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>4h22_A Leucine-rich repeat flightless-interacting protei; nucleic acid sensor, transcription; 2.89A {Homo sapiens} Back     alignment and structure
>3he5_B Synzip2; heterodimeric coiled-coil, de novo protein; 1.75A {Artificial gene} Back     alignment and structure
>3c3f_A Alpha/beta peptide with the GCN4-PLI SIDE chain S AN (alpha-alpha-alpha-beta) backbone...; helix bundle, foldamer, unknown function, de novo protein; HET: B3K B3D B3E BIL B3L BAL; 2.00A {Synthetic} SCOP: h.1.3.1 Back     alignment and structure
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Back     alignment and structure
>4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3a7o_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3iv1_A Tumor susceptibility gene 101 protein; coiled_COIL, tumorigenesis, CELL_cycle regulation, alternative splicing, cell cycle, cell division; HET: MSE; 2.50A {Homo sapiens} Back     alignment and structure
>3bas_A Myosin heavy chain, striated muscle/general control protein GCN4 chimera; alpha-helical coiled coil, disorder, salt links; 2.30A {Argopecten irradians} SCOP: h.1.26.1 PDB: 1nkn_A 3bat_A Back     alignment and structure
>2kz5_A Transcription factor NF-E2 45 kDa subunit; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3efg_A Protein SLYX homolog; xanthomonas campestris PV. campestris, coiled-coil, structur genomics, PSI-2, protein structure initiative; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3swf_A CGMP-gated cation channel alpha-1; coiled-coil, assembly domain, transport protein; 2.14A {Bos taurus} Back     alignment and structure
>2dgc_A Protein (GCN4); basic domain, leucine zipper, DNA binding, eukaryotic regulatory protein, transcription/DNA complex; HET: DNA; 2.20A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1dgc_A* 1ld4_E 1ysa_C* 3p8m_D Back     alignment and structure
>1x8y_A Lamin A/C; structural protein, intermediate filament protein; 2.20A {Homo sapiens} SCOP: h.1.20.1 PDB: 3v5b_A 3v4w_A 3v4q_A Back     alignment and structure
>3m91_A Proteasome-associated ATPase; coil COIL alpha helix, ATP-binding, chaperone, nucleotide-BI proteasome, S-nitrosylation; 1.80A {Mycobacterium tuberculosis} PDB: 3m9h_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query448
d1sknp_74 Skn-1 {Caenorhabditis elegans [TaxId: 6239]} 89.0
d1seta1110 Seryl-tRNA synthetase (SerRS) {Thermus thermophilu 86.94
>d1sknp_ a.37.1.1 (P:) Skn-1 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
class: All alpha proteins
fold: A DNA-binding domain in eukaryotic transcription factors
superfamily: A DNA-binding domain in eukaryotic transcription factors
family: A DNA-binding domain in eukaryotic transcription factors
domain: Skn-1
species: Caenorhabditis elegans [TaxId: 6239]
Probab=89.00  E-value=0.092  Score=40.64  Aligned_cols=28  Identities=25%  Similarity=0.338  Sum_probs=24.1

Q ss_pred             HHHHHHHHHHhhHHHHHHHHHHHHHHHH
Q 013166          232 DDKRARRMLSNRESARRSRRRKQAHLNE  259 (448)
Q Consensus       232 d~KR~RRmlsNRESARRSR~RKq~~Lee  259 (448)
                      -.+-+||.=+|+.+|+++|+||....++
T Consensus        46 lirDIRRRGKNKvAAqnCRKRKld~~d~   73 (74)
T d1sknp_          46 LIRKIRRRGKNKVAARTCRQRRTDRHDK   73 (74)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHTTT
T ss_pred             HHHHHHHhcccHHHHHHHHHhhhhhhcc
Confidence            3677899999999999999999877654



>d1seta1 a.2.7.1 (A:1-110) Seryl-tRNA synthetase (SerRS) {Thermus thermophilus, strain hb27 [TaxId: 274]} Back     information, alignment and structure