Citrus Sinensis ID: 013224

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------
MADTAPSRSRDLDKLLLRAGNLVGPTFEPGTELRDDLQEYARILVVGAGGLGCELLKDLALSGFKNLEVIDMDRIEVSNLNRQFLFRMEDVGKPKAEVAAKRVMERVSGVNIVPHFCRIEDKDISFYNDFNIIVLGLDSIEARSYINAVACSFLEYETDDKPREETIKPMVDGGTEGFKGHARVIIPGVTPCFECTIWLFPPQVKFPLCTLAETPRTAAHCIEYAHLIKWDEVHSGKSFDPDDPEHMQWVYSEAVKRAELFGIPGVTYSLTQGVVKNIIPAIASTNAIISAACALETLKIASGCSKTLSNYLTYNGVAGLHIKVTEFVKDKDCLVCGPGVLIELDTSVTLEKFINLLEEHPKLQLAKASVTYRGKNLYMQAPPVLEEMTRSNLSLPLYDLMDKVAKDILHVTGVTGQSDKKTSCLRKLRVVFRGVDGVTDMDMAGGA
cccccccccHHHHHHHHcccccccccccccHHHHHHHHHcccEEEEcccHHHHHHHHHHHHcccccEEEEEcccccccccccccccccccccccHHHHHHHHHHHHccccEEEEEEcccccccccccccccEEEEccccHHHHHHHHHHHHHHHHccccccccccccccEEEccccccccEEEEEEccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccEEEEEcccccHHHHHHHHHHcccccEEEcEEEEccEEEEEEccccHHHHHHccccccHHHHHcccccEEEEEEcccccccccccEEEEEEEEEEcccccccccccccc
cccccccHHccHHHHHccccccccccccccHHHHHHHHHccEEEEEEccccHHHHHHHHHHHccccEEEEEcccEEEcccccEEEEcHcHccccHHHHHHHHHHHHccccEEEEcccccccccHHHHHHccEEEEccccHHHHHHHHHHHHHHHcccccccccccccEEEEccccccccccEEEEEccccccEEEEcccccccccccEEEEccccccHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEccccEEEEEEEEcccccccccccccEEEEcccccHHHHHHHHHHccccccccccEEccccEEEEcccHHHHHHHcHHccccHHHHHccccEEEEEEEEEEccccccEEEEEEEEEEEEcccccccccccccc
madtapsrsRDLDKLLLRagnlvgptfepgtelrDDLQEYARILVVGAGGLGCELLKDLAlsgfknlevidmdrievSNLNRQFLFRMEDVGKPKAEVAAKRVMERvsgvnivphfcriedkdisfyndfNIIVLGLDSIEARSYINAVACSFleyetddkpreetikpmvdggtegfkgharviipgvtpcfectiwlfppqvkfplctlaetprtaAHCIEYAHLikwdevhsgksfdpddpehMQWVYSEAVKRAelfgipgvtysltQGVVKNIIPAIASTNAIISAACALETLKIASGCSKTLSNYLTYNGVAGLHIKVTefvkdkdclvcgpgvlieldTSVTLEKFINLLEEHPKLQLAKASVTyrgknlymqappvleemtrsnlslplYDLMDKVAKDILHVtgvtgqsdkktscLRKLRVVFRgvdgvtdmdmagga
madtapsrsrdLDKLLLRagnlvgptfepgtelRDDLQEYARILVVGAGGLGCELLKDLALSGFKNLEVIDMDRIEVSNLNRQFLFRMEDVGKPKAEVAAKRVmervsgvnivphfcriedkdisFYNDFNIIVLGLDSIEARSYINAVACSFLeyetddkpreETIKPMVDGGTEGFKGHARVIIPGVTPCFECTIWLFPPQVKFPLCTLAETPRTAAHCIEYAHLIKWDEVHSGKSFDPDDPEHMQWVYSEAVKRAELFGIPGVTYSLTQGVVKNIIPAIASTNAIISAACALETLKIASGCSKTLSNYLTYNGVAGLHIKVTEFVKDKDCLVCGPGVLIELDTSVTLEKFINLleehpklqlaKASVTYRGKNLYMQAPPVLEEMTRSNLSLPLYDLMDKVAKDILHVtgvtgqsdkktsclrklrvvfrgvdgvtdmdmagga
MADTAPsrsrdldklllrAGNLVGPTFEPGTELRDDLQEYARILVVGAGGLGCELLKDLALSGFKNLEVIDMDRIEVSNLNRQFLFRMEDVGKPKAEVAAKRVMERVSGVNIVPHFCRIEDKDISFYNDFNIIVLGLDSIEARSYINAVACSFLEYETDDKPREETIKPMVDGGTEGFKGHARVIIPGVTPCFECTIWLFPPQVKFPLCTLAETPRTAAHCIEYAHLIKWDEVHSGKSFDPDDPEHMQWVYSEAVKRAELFGIPGVTYSLTQGVVKniipaiastnaiisaaCALETLKIASGCSKTLSNYLTYNGVAGLHIKVTEFVKDKDCLVCGPGVLIELDTSVTLEKFINLLEEHPKLQLAKASVTYRGKNLYMQAPPVLEEMTRSNLSLPLYDLMDKVAKDILHVTGVTGQSDKKTSCLRKLRVVFRGVDGVTDMDMAGGA
**************LLLRAGNLVGPTFEPGTELRDDLQEYARILVVGAGGLGCELLKDLALSGFKNLEVIDMDRIEVSNLNRQFLFRMEDVGKPKAEVAAKRVMERVSGVNIVPHFCRIEDKDISFYNDFNIIVLGLDSIEARSYINAVACSFLEYET************VDGGTEGFKGHARVIIPGVTPCFECTIWLFPPQVKFPLCTLAETPRTAAHCIEYAHLIKWDEVHSG*********HMQWVYSEAVKRAELFGIPGVTYSLTQGVVKNIIPAIASTNAIISAACALETLKIASGCSKTLSNYLTYNGVAGLHIKVTEFVKDKDCLVCGPGVLIELDTSVTLEKFINLLEEHPKLQLAKASVTYRGKNLYMQAPPVLEEMTRSNLSLPLYDLMDKVAKDILHVTGVTGQSDKKTSCLRKLRVVFRGVDGV*********
******S*SRDLDKLLLRAGNLVGPTFEPGTELRDDLQEYARILVVGAGGLGCELLKDLALSGFKNLEVIDMDRIEVSNLNRQFLFRMEDVGKPKAEVAAKRVMERVSGVNIVPHFCRIEDKDISFYNDFNIIVLGLDSIEARSYINAVACSFLEYETDDKPREETIKPMVDGGTEGFKGHARVIIPGVTPCFECTIWLFPPQVKFPLCTLAETPRTAAHCIEYAHLIKWDEVHSGKSFDPDDPEHMQWVYSEAVKRAELFGIPGVTYSLTQGVVKNIIPAIASTNAIISAACALETLKIASGCSKTLSNYLTYNGVAGLHIKVTEFVKDKDCLVCGPGVLIELDTSVTLEKFINLLEEHPKLQLAKASVTYRGKNLYMQAPPVLEEMTRSNLSLPLYDLMDKVAKDILHVTGVTGQSDKKTSCLRKLRVVFRGVDGVTDMDMAG**
**********DLDKLLLRAGNLVGPTFEPGTELRDDLQEYARILVVGAGGLGCELLKDLALSGFKNLEVIDMDRIEVSNLNRQFLFRMEDVGKPKAEVAAKRVMERVSGVNIVPHFCRIEDKDISFYNDFNIIVLGLDSIEARSYINAVACSFLEYETDDKPREETIKPMVDGGTEGFKGHARVIIPGVTPCFECTIWLFPPQVKFPLCTLAETPRTAAHCIEYAHLIKWDEVHSGKSFDPDDPEHMQWVYSEAVKRAELFGIPGVTYSLTQGVVKNIIPAIASTNAIISAACALETLKIASGCSKTLSNYLTYNGVAGLHIKVTEFVKDKDCLVCGPGVLIELDTSVTLEKFINLLEEHPKLQLAKASVTYRGKNLYMQAPPVLEEMTRSNLSLPLYDLMDKVAKDILHVTG*********SCLRKLRVVFRGVDGVTDMDMAGGA
******SRSRDLDKLLLRAGNLVGPTFEPGTELRDDLQEYARILVVGAGGLGCELLKDLALSGFKNLEVIDMDRIEVSNLNRQFLFRMEDVGKPKAEVAAKRVMERVSGVNIVPHFCRIEDKDISFYNDFNIIVLGLDSIEARSYINAVACSFLEYETDDKPREETIKPMVDGGTEGFKGHARVIIPGVTPCFECTIWLFPPQVKFPLCTLAETPRTAAHCIEYAHLIKWDEVHSGKSFDPDDPEHMQWVYSEAVKRAELFGIPGVTYSLTQGVVKNIIPAIASTNAIISAACALETLKIASGCSKTLSNYLTYNGVAGLHIKVTEFVKDKDCLVCGPGVLIELDTSVTLEKFINLLEEHPKLQLAKASVTYRGKNLYMQAPPVLEEMTRSNLSLPLYDLMDKVAKDILHVTGVTGQSDKKTSCLRKLRVVFRGVD***********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MADTAPSRSRDLDKLLLRAGNLVGPTFEPGTELRDDLQEYARILVVGAGGLGCELLKDLALSGFKNLEVIDMDRIEVSNLNRQFLFRMEDVGKPKAEVAAKRVMERVSGVNIVPHFCRIEDKDISFYNDFNIIVLGLDSIEARSYINAVACSFLEYETDDKPREETIKPMVDGGTEGFKGHARVIIPGVTPCFECTIWLFPPQVKFPLCTLAETPRTAAHCIEYAHLIKWDEVHSGKSFDPDDPEHMQWVYSEAVKRAELFGIPGVTYSLTQGVVKNIIPAIASTNAIISAACALETLKIASGCSKTLSNYLTYNGVAGLHIKVTEFVKDKDCLVCGPGVLIELDTSVTLEKFINLLEEHPKLQLAKASVTYRGKNLYMQAPPVLEEMTRSNLSLPLYDLMDKVAKDILHVTGVTGQSDKKTSCLRKLRVVFRGVDGVTDMDMAGGA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query447 2.2.26 [Sep-21-2011]
O65041454 NEDD8-activating enzyme E yes no 0.986 0.971 0.782 0.0
Q54QG9442 NEDD8-activating enzyme E yes no 0.879 0.889 0.491 1e-110
Q99MI7462 NEDD8-activating enzyme E yes no 0.876 0.848 0.501 1e-108
Q8C878462 NEDD8-activating enzyme E yes no 0.876 0.848 0.498 1e-107
Q5R4A0463 NEDD8-activating enzyme E yes no 0.876 0.846 0.493 1e-107
Q8TBC4463 NEDD8-activating enzyme E yes no 0.876 0.846 0.496 1e-107
Q7ZVX6462 NEDD8-activating enzyme E yes no 0.876 0.848 0.491 1e-106
Q19360430 NEDD8-activating enzyme E yes no 0.881 0.916 0.502 1e-104
Q9V6U8450 NEDD8-activating enzyme E yes no 0.879 0.873 0.497 1e-103
Q09765444 NEDD8-activating enzyme E yes no 0.780 0.786 0.422 6e-85
>sp|O65041|UBA3_ARATH NEDD8-activating enzyme E1 catalytic subunit OS=Arabidopsis thaliana GN=ECR1 PE=1 SV=2 Back     alignment and function desciption
 Score =  721 bits (1862), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/442 (78%), Positives = 383/442 (86%), Gaps = 1/442 (0%)

Query: 7   SRSRDLDKLLLRAGNLVGPTFEPGTELRDDLQEYARILVVGAGGLGCELLKDLALSGFKN 66
           S++RDLDKLLLR GNLV P F PG  LRDD+++Y RILV+GAGGLGCELLKDLALSGF+N
Sbjct: 13  SKTRDLDKLLLRHGNLVDPGFVPGPGLRDDIRDYVRILVIGAGGLGCELLKDLALSGFRN 72

Query: 67  LEVIDMDRIEVSNLNRQFLFRMEDVGKPKAEVAAKRVMERVSGVNIVPHFCRIEDKDISF 126
           LEVIDMDRIEV+NLNRQFLFR+EDVGKPKAEVAAKRVMERVSGV IVPHF RIEDK+I F
Sbjct: 73  LEVIDMDRIEVTNLNRQFLFRIEDVGKPKAEVAAKRVMERVSGVEIVPHFSRIEDKEIEF 132

Query: 127 YNDFNIIVLGLDSIEARSYINAVACSFLEYETDDKPREETIKPMVDGGTEGFKGHARVII 186
           YNDFNII LGLDSIEAR YIN VAC FLEY  DD P+ ETIKPMVDGGTEGFKGHARVI+
Sbjct: 133 YNDFNIIALGLDSIEARKYINGVACGFLEYNEDDTPKRETIKPMVDGGTEGFKGHARVIL 192

Query: 187 PGVTPCFECTIWLFPPQVKFPLCTLAETPRTAAHCIEYAHLIKWDEVHSGKSFDPDDPEH 246
           PGVTPCFECTI+LFPPQVKFPLCTLAETPR AAHCIEYAHLI+W+ VH GK+FDPD+PEH
Sbjct: 193 PGVTPCFECTIYLFPPQVKFPLCTLAETPRNAAHCIEYAHLIQWETVHRGKTFDPDEPEH 252

Query: 247 MQWVYSEAVKRAELFGIPGVTYSLTQGVVKNIIPAIASTNAIISAACALETLKIASGCSK 306
           M+WVY EA++RAELFGIPGVTYSLTQGVVKNIIPAIASTNAIISAACALETLKI S CSK
Sbjct: 253 MKWVYDEAIRRAELFGIPGVTYSLTQGVVKNIIPAIASTNAIISAACALETLKIVSACSK 312

Query: 307 TLSNYLTYNGVAGLHIKVTEFVKDKDCLVCGPGVLIELDTSVTLEKFINLLEEHPKLQLA 366
           TL NYLTYNG  GL+ +VT+F +D +CLVCGPG+LIELDTSVTL KFI +LE+HPKL L+
Sbjct: 313 TLVNYLTYNGGEGLYTEVTKFERDTECLVCGPGILIELDTSVTLSKFIEMLEDHPKLLLS 372

Query: 367 KASVTYRGKNLYMQAPPVLEEMTRSNLSLPLYDLMDKVAKDILHVTGVTG-QSDKKTSCL 425
           KASV      LYMQAPPVLEE  R  LS PLYDLM +V KD +HV G    ++++K SC 
Sbjct: 373 KASVKQGENTLYMQAPPVLEEFHRPKLSKPLYDLMGRVQKDTIHVFGQRALKNNEKESCT 432

Query: 426 RKLRVVFRGVDGVTDMDMAGGA 447
            K+RVVF+G DGV DMD A GA
Sbjct: 433 TKVRVVFKGADGVADMDTAIGA 454
Catalytic subunit of the dimeric ECR1-AXR1 E1 enzyme. E1 activates NEDD8/RUB1 by first adenylating its C-terminal glycine residue with ATP, thereafter linking this residue to the side chain of the catalytic cysteine, yielding a NEDD8-ECR1 thioester and free AMP. E1 finally transfers NEDD8 to the catalytic cysteine of RCE1.
Arabidopsis thaliana (taxid: 3702)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|Q54QG9|UBA3_DICDI NEDD8-activating enzyme E1 catalytic subunit OS=Dictyostelium discoideum GN=uba3 PE=1 SV=1 Back     alignment and function description
>sp|Q99MI7|UBA3_RAT NEDD8-activating enzyme E1 catalytic subunit OS=Rattus norvegicus GN=Uba3 PE=1 SV=1 Back     alignment and function description
>sp|Q8C878|UBA3_MOUSE NEDD8-activating enzyme E1 catalytic subunit OS=Mus musculus GN=Uba3 PE=1 SV=2 Back     alignment and function description
>sp|Q5R4A0|UBA3_PONAB NEDD8-activating enzyme E1 catalytic subunit OS=Pongo abelii GN=UBA3 PE=2 SV=2 Back     alignment and function description
>sp|Q8TBC4|UBA3_HUMAN NEDD8-activating enzyme E1 catalytic subunit OS=Homo sapiens GN=UBA3 PE=1 SV=2 Back     alignment and function description
>sp|Q7ZVX6|UBA3_DANRE NEDD8-activating enzyme E1 catalytic subunit OS=Danio rerio GN=uba3 PE=2 SV=1 Back     alignment and function description
>sp|Q19360|UBA3_CAEEL NEDD8-activating enzyme E1 catalytic subunit OS=Caenorhabditis elegans GN=uba-3 PE=2 SV=2 Back     alignment and function description
>sp|Q9V6U8|UBA3_DROME NEDD8-activating enzyme E1 catalytic subunit OS=Drosophila melanogaster GN=CG13343 PE=2 SV=1 Back     alignment and function description
>sp|Q09765|UBA3_SCHPO NEDD8-activating enzyme E1 catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=uba3 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query447
255552279449 ubiquitin-activating enzyme E1c, putativ 1.0 0.995 0.881 0.0
225432556449 PREDICTED: NEDD8-activating enzyme E1 ca 1.0 0.995 0.877 0.0
449432724449 PREDICTED: NEDD8-activating enzyme E1 ca 0.986 0.982 0.875 0.0
224100343449 predicted protein [Populus trichocarpa] 0.986 0.982 0.877 0.0
357480207454 NEDD8-activating enzyme E1 catalytic sub 1.0 0.984 0.843 0.0
224110476449 predicted protein [Populus trichocarpa] 1.0 0.995 0.859 0.0
356521961446 PREDICTED: NEDD8-activating enzyme E1 ca 0.997 1.0 0.843 0.0
356563478446 PREDICTED: NEDD8-activating enzyme E1 ca 0.997 1.0 0.832 0.0
148909531448 unknown [Picea sitchensis] 1.0 0.997 0.765 0.0
297807971453 hypothetical protein ARALYDRAFT_909950 [ 0.986 0.973 0.786 0.0
>gi|255552279|ref|XP_002517184.1| ubiquitin-activating enzyme E1c, putative [Ricinus communis] gi|223543819|gb|EEF45347.1| ubiquitin-activating enzyme E1c, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  834 bits (2154), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/449 (88%), Positives = 430/449 (95%), Gaps = 2/449 (0%)

Query: 1   MADTA--PSRSRDLDKLLLRAGNLVGPTFEPGTELRDDLQEYARILVVGAGGLGCELLKD 58
           MAD+   PSRSRDLDKLLLR GNLV PTF+PG +LRDDLQEY RILVVGAGGLGCELLKD
Sbjct: 1   MADSTVQPSRSRDLDKLLLRPGNLVAPTFDPGVQLRDDLQEYVRILVVGAGGLGCELLKD 60

Query: 59  LALSGFKNLEVIDMDRIEVSNLNRQFLFRMEDVGKPKAEVAAKRVMERVSGVNIVPHFCR 118
           LALSGFKNLEVIDMDRIEVSNLNRQFLFR+EDVGKPKAEVAAKRVMERVSGVNIVPHFCR
Sbjct: 61  LALSGFKNLEVIDMDRIEVSNLNRQFLFRLEDVGKPKAEVAAKRVMERVSGVNIVPHFCR 120

Query: 119 IEDKDISFYNDFNIIVLGLDSIEARSYINAVACSFLEYETDDKPREETIKPMVDGGTEGF 178
           IEDK++ FYNDF+IIVLGLDSIEARSYIN VACSFLEY+++D PR++T+KPMVDGGTEGF
Sbjct: 121 IEDKELDFYNDFSIIVLGLDSIEARSYINNVACSFLEYDSEDNPRDDTMKPMVDGGTEGF 180

Query: 179 KGHARVIIPGVTPCFECTIWLFPPQVKFPLCTLAETPRTAAHCIEYAHLIKWDEVHSGKS 238
           KGHARVI+PG+TPCFECTIWLFPPQVKFPLCTLAETPRT AHCIEYAHLIKW+EVHSGK+
Sbjct: 181 KGHARVIMPGITPCFECTIWLFPPQVKFPLCTLAETPRTPAHCIEYAHLIKWNEVHSGKA 240

Query: 239 FDPDDPEHMQWVYSEAVKRAELFGIPGVTYSLTQGVVKNIIPAIASTNAIISAACALETL 298
           FDPDDPEHM+WVY+EAVKRAELFGI GVTYSLTQGVVKNIIPAIASTNAIISAACALETL
Sbjct: 241 FDPDDPEHMKWVYTEAVKRAELFGIQGVTYSLTQGVVKNIIPAIASTNAIISAACALETL 300

Query: 299 KIASGCSKTLSNYLTYNGVAGLHIKVTEFVKDKDCLVCGPGVLIELDTSVTLEKFINLLE 358
           KIASGCSKTLSNYLTYNGV GLHIKVTEFVKDKDCL CGPGVLIELDTSV L+KFI+LLE
Sbjct: 301 KIASGCSKTLSNYLTYNGVEGLHIKVTEFVKDKDCLACGPGVLIELDTSVALQKFIDLLE 360

Query: 359 EHPKLQLAKASVTYRGKNLYMQAPPVLEEMTRSNLSLPLYDLMDKVAKDILHVTGVTGQS 418
           EHPKL L++ASVT+RGKNLYMQAPPVLEEMTRSNLSLPL++LM KV KDI+HVTG+TGQ+
Sbjct: 361 EHPKLFLSRASVTHRGKNLYMQAPPVLEEMTRSNLSLPLFELMGKVPKDIVHVTGMTGQN 420

Query: 419 DKKTSCLRKLRVVFRGVDGVTDMDMAGGA 447
            KKTSC+RKLRVVF+G++G+TDMDMAGGA
Sbjct: 421 GKKTSCVRKLRVVFKGMEGITDMDMAGGA 449

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225432556|ref|XP_002280928.1| PREDICTED: NEDD8-activating enzyme E1 catalytic subunit [Vitis vinifera] gi|297736997|emb|CBI26198.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449432724|ref|XP_004134149.1| PREDICTED: NEDD8-activating enzyme E1 catalytic subunit-like [Cucumis sativus] gi|449515377|ref|XP_004164726.1| PREDICTED: NEDD8-activating enzyme E1 catalytic subunit-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224100343|ref|XP_002311839.1| predicted protein [Populus trichocarpa] gi|222851659|gb|EEE89206.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357480207|ref|XP_003610389.1| NEDD8-activating enzyme E1 catalytic subunit [Medicago truncatula] gi|355511444|gb|AES92586.1| NEDD8-activating enzyme E1 catalytic subunit [Medicago truncatula] Back     alignment and taxonomy information
>gi|224110476|ref|XP_002315531.1| predicted protein [Populus trichocarpa] gi|222864571|gb|EEF01702.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356521961|ref|XP_003529618.1| PREDICTED: NEDD8-activating enzyme E1 catalytic subunit-like [Glycine max] Back     alignment and taxonomy information
>gi|356563478|ref|XP_003549989.1| PREDICTED: NEDD8-activating enzyme E1 catalytic subunit-like [Glycine max] Back     alignment and taxonomy information
>gi|148909531|gb|ABR17860.1| unknown [Picea sitchensis] Back     alignment and taxonomy information
>gi|297807971|ref|XP_002871869.1| hypothetical protein ARALYDRAFT_909950 [Arabidopsis lyrata subsp. lyrata] gi|297317706|gb|EFH48128.1| hypothetical protein ARALYDRAFT_909950 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query447
TAIR|locus:2182172454 ECR1 "E1 C-terminal related 1" 0.955 0.940 0.748 4.7e-174
UNIPROTKB|E1BT61463 UBA3 "Uncharacterized protein" 0.852 0.822 0.484 7e-93
RGD|621084462 Uba3 "ubiquitin-like modifier 0.852 0.824 0.476 1.7e-91
UNIPROTKB|Q99MI7462 Uba3 "NEDD8-activating enzyme 0.852 0.824 0.476 1.7e-91
MGI|MGI:1341217462 Uba3 "ubiquitin-like modifier 0.852 0.824 0.474 2.1e-91
UNIPROTKB|Q0P5I7463 UBA3 "Ubiquitin-like modifier 0.852 0.822 0.471 4.5e-91
UNIPROTKB|Q8TBC4463 UBA3 "NEDD8-activating enzyme 0.852 0.822 0.471 4.5e-91
UNIPROTKB|E2QZL9449 UBA3 "Uncharacterized protein" 0.852 0.848 0.471 7.3e-91
UNIPROTKB|E2R4G8463 UBA3 "Uncharacterized protein" 0.852 0.822 0.471 7.3e-91
UNIPROTKB|F6Y460472 UBA3 "Uncharacterized protein" 0.852 0.807 0.471 7.3e-91
TAIR|locus:2182172 ECR1 "E1 C-terminal related 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1691 (600.3 bits), Expect = 4.7e-174, P = 4.7e-174
 Identities = 322/430 (74%), Positives = 359/430 (83%)

Query:    20 GNLVGPTFEPGTELRDDLQEYARILVVGAGGLGCELLKDLALSGFKNLEVIDMDRIEVSN 79
             GNLV P F PG  LRDD+++Y RILV+GAGGLGCELLKDLALSGF+NLEVIDMDRIEV+N
Sbjct:    26 GNLVDPGFVPGPGLRDDIRDYVRILVIGAGGLGCELLKDLALSGFRNLEVIDMDRIEVTN 85

Query:    80 LNRQFLFRMEDVGKPKAEVAAKRVMERVSGVNIVPHFCRIEDKDISFYNDFNIIVLGLDS 139
             LNRQFLFR+EDVGKPKAEVAAKRVMERVSGV IVPHF RIEDK+I FYNDFNII LGLDS
Sbjct:    86 LNRQFLFRIEDVGKPKAEVAAKRVMERVSGVEIVPHFSRIEDKEIEFYNDFNIIALGLDS 145

Query:   140 IEARSYINAVACSFLEYETDDKPREETIKPMVDGGTEGFKGHARVIIPGVTPCFECTIWL 199
             IEAR YIN VAC FLEY  DD P+ ETIKPMVDGGTEGFKGHARVI+PGVTPCFECTI+L
Sbjct:   146 IEARKYINGVACGFLEYNEDDTPKRETIKPMVDGGTEGFKGHARVILPGVTPCFECTIYL 205

Query:   200 FPPQVKFPLCTLAETPRTAAHCIEYAHLIKWDEVHSGKSFDPDDPEHMQWVYSEAVKRAE 259
             FPPQVKFPLCTLAETPR AAHCIEYAHLI+W+ VH GK+FDPD+PEHM+WVY EA++RAE
Sbjct:   206 FPPQVKFPLCTLAETPRNAAHCIEYAHLIQWETVHRGKTFDPDEPEHMKWVYDEAIRRAE 265

Query:   260 LFGIPGVTYSLTQGVVKXXXXXXXXXXXXXXXXCALETLKIASGCSKTLSNYLTYNGVAG 319
             LFGIPGVTYSLTQGVVK                CALETLKI S CSKTL NYLTYNG  G
Sbjct:   266 LFGIPGVTYSLTQGVVKNIIPAIASTNAIISAACALETLKIVSACSKTLVNYLTYNGGEG 325

Query:   320 LHIKVTEFVKDKDCLVCGPGVLIELDTSVTLEKFINLLEEHPKLQLAKASVTYRGKN-LY 378
             L+ +VT+F +D +CLVCGPG+LIELDTSVTL KFI +LE+HPKL L+KASV  +G+N LY
Sbjct:   326 LYTEVTKFERDTECLVCGPGILIELDTSVTLSKFIEMLEDHPKLLLSKASVK-QGENTLY 384

Query:   379 MQAPPVLEEMTRSNLSLPLYDLMDKVAKDILHVTGVTG-QSDKKTSCLRKLRVVFRGVDG 437
             MQAPPVLEE  R  LS PLYDLM +V KD +HV G    ++++K SC  K+RVVF+G DG
Sbjct:   385 MQAPPVLEEFHRPKLSKPLYDLMGRVQKDTIHVFGQRALKNNEKESCTTKVRVVFKGADG 444

Query:   438 VTDMDMAGGA 447
             V DMD A GA
Sbjct:   445 VADMDTAIGA 454
GO:0000166 "nucleotide binding" evidence=IEA
GO:0003824 "catalytic activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005737 "cytoplasm" evidence=ISM
GO:0006464 "cellular protein modification process" evidence=IEA
GO:0008641 "small protein activating enzyme activity" evidence=IEA;IDA
GO:0016881 "acid-amino acid ligase activity" evidence=IEA
GO:0045116 "protein neddylation" evidence=IEA;TAS
GO:0019781 "NEDD8 activating enzyme activity" evidence=IDA
GO:0046982 "protein heterodimerization activity" evidence=NAS
UNIPROTKB|E1BT61 UBA3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
RGD|621084 Uba3 "ubiquitin-like modifier activating enzyme 3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q99MI7 Uba3 "NEDD8-activating enzyme E1 catalytic subunit" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1341217 Uba3 "ubiquitin-like modifier activating enzyme 3" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q0P5I7 UBA3 "Ubiquitin-like modifier activating enzyme 3" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q8TBC4 UBA3 "NEDD8-activating enzyme E1 catalytic subunit" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2QZL9 UBA3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E2R4G8 UBA3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F6Y460 UBA3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q99MI7UBA3_RAT6, ., 3, ., 2, ., -0.50120.87690.8484yesno
Q5R4A0UBA3_PONAB6, ., 3, ., 2, ., -0.49370.87690.8466yesno
Q19360UBA3_CAEEL6, ., 3, ., 2, ., -0.50240.88140.9162yesno
Q9V6U8UBA3_DROME6, ., 3, ., 2, ., -0.49750.87910.8733yesno
Q8TBC4UBA3_HUMAN6, ., 3, ., 2, ., -0.49620.87690.8466yesno
O65041UBA3_ARATH6, ., 3, ., 2, ., -0.78280.98650.9713yesno
Q7ZVX6UBA3_DANRE6, ., 3, ., 2, ., -0.49120.87690.8484yesno
Q54QG9UBA3_DICDI6, ., 3, ., 2, ., -0.49130.87910.8891yesno
Q8C878UBA3_MOUSE6, ., 3, ., 2, ., -0.49870.87690.8484yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer6.3.20.691

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query447
cd01488291 cd01488, Uba3_RUB, Ubiquitin activating enzyme (E1 0.0
cd01484234 cd01484, E1-2_like, Ubiquitin activating enzyme (E 8e-98
cd01489312 cd01489, Uba2_SUMO, Ubiquitin activating enzyme (E 1e-76
cd01490435 cd01490, Ube1_repeat2, Ubiquitin activating enzyme 6e-51
pfam00899134 pfam00899, ThiF, ThiF family 3e-43
COG0476254 COG0476, ThiF, Dinucleotide-utilizing enzymes invo 4e-41
cd01483143 cd01483, E1_enzyme_family, Superfamily of activati 3e-39
cd00757228 cd00757, ThiF_MoeB_HesA_family, ThiF_MoeB_HesA 1e-38
TIGR01408 1008 TIGR01408, Ube1, ubiquitin-activating enzyme E1 4e-34
pfam0213466 pfam02134, UBACT, Repeat in ubiquitin-activating ( 6e-28
pfam0882585 pfam08825, E2_bind, E2 binding domain 4e-25
TIGR02356202 TIGR02356, adenyl_thiF, thiazole biosynthesis aden 5e-25
PRK08762376 PRK08762, PRK08762, molybdopterin biosynthesis pro 1e-20
PRK05690245 PRK05690, PRK05690, molybdopterin biosynthesis pro 7e-20
PRK08644212 PRK08644, PRK08644, thiamine biosynthesis protein 9e-18
PRK07878392 PRK07878, PRK07878, molybdopterin biosynthesis-lik 3e-17
PRK05600370 PRK05600, PRK05600, thiamine biosynthesis protein 3e-17
PRK08328231 PRK08328, PRK08328, hypothetical protein; Provisio 7e-17
PRK12475338 PRK12475, PRK12475, thiamine/molybdopterin biosynt 2e-16
cd01487174 cd01487, E1_ThiF_like, E1_ThiF_like 2e-16
PRK07688339 PRK07688, PRK07688, thiamine/molybdopterin biosynt 8e-16
TIGR02355240 TIGR02355, moeB, molybdopterin synthase sulfurylas 2e-15
TIGR02354200 TIGR02354, thiF_fam2, thiamine biosynthesis protei 7e-15
cd01492197 cd01492, Aos1_SUMO, Ubiquitin activating enzyme (E 4e-14
COG1179263 COG1179, COG1179, Dinucleotide-utilizing enzymes i 4e-14
cd00755231 cd00755, YgdL_like, Family of activating enzymes ( 3e-13
PRK07411390 PRK07411, PRK07411, hypothetical protein; Validate 1e-12
PRK05597355 PRK05597, PRK05597, molybdopterin biosynthesis pro 2e-12
cd01491286 cd01491, Ube1_repeat1, Ubiquitin activating enzyme 4e-12
cd01493425 cd01493, APPBP1_RUB, Ubiquitin activating enzyme ( 6e-11
pfam1058544 pfam10585, UBA_e1_thiolCys, Ubiquitin-activating e 2e-10
cd01486307 cd01486, Apg7, Apg7 is an E1-like protein, that ac 3e-10
cd01485198 cd01485, E1-1_like, Ubiquitin activating enzyme (E 1e-09
PRK15116268 PRK15116, PRK15116, sulfur acceptor protein CsdL; 1e-08
TIGR01408 1008 TIGR01408, Ube1, ubiquitin-activating enzyme E1 1e-07
TIGR01381664 TIGR01381, E1_like_apg7, E1-like protein-activatin 1e-06
PRK14851 679 PRK14851, PRK14851, hypothetical protein; Provisio 2e-06
PRK08223287 PRK08223, PRK08223, hypothetical protein; Validate 3e-06
TIGR03736244 TIGR03736, PRTRC_ThiF, PRTRC system ThiF family pr 7e-05
PRK14852 989 PRK14852, PRK14852, hypothetical protein; Provisio 1e-04
TIGR014081008 TIGR01408, Ube1, ubiquitin-activating enzyme E1 3e-04
pfam0523777 pfam05237, MoeZ_MoeB, MoeZ/MoeB domain 0.001
PRK04965377 PRK04965, PRK04965, NADH:flavorubredoxin oxidoredu 0.002
PRK07877 722 PRK07877, PRK07877, hypothetical protein; Provisio 0.002
>gnl|CDD|238765 cd01488, Uba3_RUB, Ubiquitin activating enzyme (E1) subunit UBA3 Back     alignment and domain information 
 Score =  550 bits (1419), Expect = 0.0
 Identities = 189/296 (63%), Positives = 227/296 (76%), Gaps = 5/296 (1%)

Query: 42  RILVVGAGGLGCELLKDLALSGFKNLEVIDMDRIEVSNLNRQFLFRMEDVGKPKAEVAAK 101
           +ILV+GAGGLGCELLK+LALSGF+N+ VIDMD I+VSNLNRQFLFR +D+GKPKAEVAAK
Sbjct: 1   KILVIGAGGLGCELLKNLALSGFRNIHVIDMDTIDVSNLNRQFLFREKDIGKPKAEVAAK 60

Query: 102 RVMERVSGVNIVPHFCRIEDKDISFYNDFNIIVLGLDSIEARSYINAVACSFLEYETDDK 161
            V +RV GVN+ PHF +I+DKD  FY  FNII+ GLDSIEAR +IN    S L YE    
Sbjct: 61  FVNDRVPGVNVTPHFGKIQDKDEEFYRQFNIIICGLDSIEARRWINGTLVSLLLYED--- 117

Query: 162 PREETIKPMVDGGTEGFKGHARVIIPGVTPCFECTIWLFPPQVKFPLCTLAETPRTAAHC 221
              E+I P++DGGTEGFKGHARVI+PG+T C EC++ LFPPQV FPLCT+A TPR   HC
Sbjct: 118 --PESIIPLIDGGTEGFKGHARVILPGITACIECSLDLFPPQVTFPLCTIANTPRLPEHC 175

Query: 222 IEYAHLIKWDEVHSGKSFDPDDPEHMQWVYSEAVKRAELFGIPGVTYSLTQGVVKNIIPA 281
           IEYA LI+W +       D DDPEH++W+Y +A++RA  F I GVTYSLTQGVVK IIPA
Sbjct: 176 IEYASLIQWPKEFPFVPLDGDDPEHIEWLYQKALERAAQFNISGVTYSLTQGVVKRIIPA 235

Query: 282 IASTNAIISAACALETLKIASGCSKTLSNYLTYNGVAGLHIKVTEFVKDKDCLVCG 337
           +ASTNAII+AAC LE LKIA+ C + L+NYL YNGV G +    E  + +DC VC 
Sbjct: 236 VASTNAIIAAACCLEALKIATDCYENLNNYLMYNGVDGCYTYTFEHERKEDCPVCS 291

UBA3 is part of the heterodimeric activating enzyme (E1), specific for the Rub family of ubiquitin-like proteins (Ubls). E1 enzymes are part of a conjugation cascade to attach Ub or Ubls, covalently to substrate proteins. consisting of activating (E1), conjugating (E2), and/or ligating (E3) enzymes. E1 activates ubiquitin(-like) by C-terminal adenylation, and subsequently forms a highly reactive thioester bond between its catalytic cysteine and Ubls C-terminus. E1 also associates with E2 and promotes ubiquitin transfer to the E2's catalytic cysteine. Post-translational modification by Rub family of ubiquitin-like proteins (Ublps) activates SCF ubiquitin ligases and is involved in cell cycle control, signaling and embryogenesis. UBA3 contains both the nucleotide-binding motif involved in adenylation and the catalytic cysteine involved in the thioester intermediate and Ublp transfer to E2. Length = 291
>gnl|CDD|238761 cd01484, E1-2_like, Ubiquitin activating enzyme (E1), repeat 2-like Back     alignment and domain information
>gnl|CDD|238766 cd01489, Uba2_SUMO, Ubiquitin activating enzyme (E1) subunit UBA2 Back     alignment and domain information
>gnl|CDD|238767 cd01490, Ube1_repeat2, Ubiquitin activating enzyme (E1), repeat 2 Back     alignment and domain information
>gnl|CDD|216180 pfam00899, ThiF, ThiF family Back     alignment and domain information
>gnl|CDD|223552 COG0476, ThiF, Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 2 [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|238760 cd01483, E1_enzyme_family, Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>gnl|CDD|238386 cd00757, ThiF_MoeB_HesA_family, ThiF_MoeB_HesA Back     alignment and domain information
>gnl|CDD|130475 TIGR01408, Ube1, ubiquitin-activating enzyme E1 Back     alignment and domain information
>gnl|CDD|202124 pfam02134, UBACT, Repeat in ubiquitin-activating (UBA) protein Back     alignment and domain information
>gnl|CDD|192164 pfam08825, E2_bind, E2 binding domain Back     alignment and domain information
>gnl|CDD|162820 TIGR02356, adenyl_thiF, thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>gnl|CDD|236337 PRK08762, PRK08762, molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>gnl|CDD|180204 PRK05690, PRK05690, molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>gnl|CDD|236320 PRK08644, PRK08644, thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>gnl|CDD|181156 PRK07878, PRK07878, molybdopterin biosynthesis-like protein MoeZ; Validated Back     alignment and domain information
>gnl|CDD|235528 PRK05600, PRK05600, thiamine biosynthesis protein ThiF; Validated Back     alignment and domain information
>gnl|CDD|169382 PRK08328, PRK08328, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|183547 PRK12475, PRK12475, thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>gnl|CDD|238764 cd01487, E1_ThiF_like, E1_ThiF_like Back     alignment and domain information
>gnl|CDD|181084 PRK07688, PRK07688, thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>gnl|CDD|131408 TIGR02355, moeB, molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>gnl|CDD|162819 TIGR02354, thiF_fam2, thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>gnl|CDD|238769 cd01492, Aos1_SUMO, Ubiquitin activating enzyme (E1) subunit Aos1 Back     alignment and domain information
>gnl|CDD|224100 COG1179, COG1179, Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 1 [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|238384 cd00755, YgdL_like, Family of activating enzymes (E1) of ubiquitin-like proteins related to the E Back     alignment and domain information
>gnl|CDD|180967 PRK07411, PRK07411, hypothetical protein; Validated Back     alignment and domain information
>gnl|CDD|235526 PRK05597, PRK05597, molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>gnl|CDD|238768 cd01491, Ube1_repeat1, Ubiquitin activating enzyme (E1), repeat 1 Back     alignment and domain information
>gnl|CDD|238770 cd01493, APPBP1_RUB, Ubiquitin activating enzyme (E1) subunit APPBP1 Back     alignment and domain information
>gnl|CDD|192635 pfam10585, UBA_e1_thiolCys, Ubiquitin-activating enzyme active site Back     alignment and domain information
>gnl|CDD|238763 cd01486, Apg7, Apg7 is an E1-like protein, that activates two different ubiquitin-like proteins, Apg12 and Apg8, and assigns them to specific E2 enzymes, Apg10 and Apg3, respectively Back     alignment and domain information
>gnl|CDD|238762 cd01485, E1-1_like, Ubiquitin activating enzyme (E1), repeat 1-like Back     alignment and domain information
>gnl|CDD|185071 PRK15116, PRK15116, sulfur acceptor protein CsdL; Provisional Back     alignment and domain information
>gnl|CDD|130475 TIGR01408, Ube1, ubiquitin-activating enzyme E1 Back     alignment and domain information
>gnl|CDD|233388 TIGR01381, E1_like_apg7, E1-like protein-activating enzyme Gsa7p/Apg7p Back     alignment and domain information
>gnl|CDD|184853 PRK14851, PRK14851, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|181302 PRK08223, PRK08223, hypothetical protein; Validated Back     alignment and domain information
>gnl|CDD|163448 TIGR03736, PRTRC_ThiF, PRTRC system ThiF family protein Back     alignment and domain information
>gnl|CDD|184854 PRK14852, PRK14852, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|130475 TIGR01408, Ube1, ubiquitin-activating enzyme E1 Back     alignment and domain information
>gnl|CDD|113988 pfam05237, MoeZ_MoeB, MoeZ/MoeB domain Back     alignment and domain information
>gnl|CDD|179902 PRK04965, PRK04965, NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|236122 PRK07877, PRK07877, hypothetical protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 447
KOG2015422 consensus NEDD8-activating complex, catalytic comp 100.0
cd01488291 Uba3_RUB Ubiquitin activating enzyme (E1) subunit 100.0
KOG2013603 consensus SMT3/SUMO-activating complex, catalytic 100.0
TIGR014081008 Ube1 ubiquitin-activating enzyme E1. This model re 100.0
cd01490435 Ube1_repeat2 Ubiquitin activating enzyme (E1), rep 100.0
cd01489312 Uba2_SUMO Ubiquitin activating enzyme (E1) subunit 100.0
KOG20121013 consensus Ubiquitin activating enzyme UBA1 [Posttr 100.0
cd01484234 E1-2_like Ubiquitin activating enzyme (E1), repeat 100.0
TIGR02355240 moeB molybdopterin synthase sulfurylase MoeB. This 100.0
PRK07411390 hypothetical protein; Validated 100.0
PRK05690245 molybdopterin biosynthesis protein MoeB; Provision 100.0
PRK05597355 molybdopterin biosynthesis protein MoeB; Validated 100.0
PRK05600370 thiamine biosynthesis protein ThiF; Validated 100.0
PRK12475338 thiamine/molybdopterin biosynthesis MoeB-like prot 100.0
PRK08223287 hypothetical protein; Validated 100.0
PRK07878392 molybdopterin biosynthesis-like protein MoeZ; Vali 100.0
PRK07688339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 100.0
cd00757228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 100.0
PRK08762376 molybdopterin biosynthesis protein MoeB; Validated 100.0
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 100.0
PRK08328231 hypothetical protein; Provisional 100.0
KOG2017427 consensus Molybdopterin synthase sulfurylase [Coen 100.0
cd01491286 Ube1_repeat1 Ubiquitin activating enzyme (E1), rep 100.0
cd01492197 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit 100.0
cd01485198 E1-1_like Ubiquitin activating enzyme (E1), repeat 100.0
COG0476254 ThiF Dinucleotide-utilizing enzymes involved in mo 100.0
KOG2014331 consensus SMT3/SUMO-activating complex, AOS1/RAD31 100.0
TIGR03603318 cyclo_dehy_ocin bacteriocin biosynthesis cyclodehy 100.0
cd01493425 APPBP1_RUB Ubiquitin activating enzyme (E1) subuni 100.0
TIGR01408 1008 Ube1 ubiquitin-activating enzyme E1. This model re 100.0
PRK14852 989 hypothetical protein; Provisional 100.0
PRK08644212 thiamine biosynthesis protein ThiF; Provisional 100.0
PRK14851 679 hypothetical protein; Provisional 100.0
TIGR01381664 E1_like_apg7 E1-like protein-activating enzyme Gsa 100.0
PRK07877 722 hypothetical protein; Provisional 100.0
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily o 100.0
TIGR03736244 PRTRC_ThiF PRTRC system ThiF family protein. A nov 100.0
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 99.98
cd01486307 Apg7 Apg7 is an E1-like protein, that activates tw 99.98
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 99.98
PRK15116268 sulfur acceptor protein CsdL; Provisional 99.97
cd01483143 E1_enzyme_family Superfamily of activating enzymes 99.97
cd00755231 YgdL_like Family of activating enzymes (E1) of ubi 99.97
KOG2336422 consensus Molybdopterin biosynthesis-related prote 99.97
KOG2012 1013 consensus Ubiquitin activating enzyme UBA1 [Posttr 99.96
KOG2016523 consensus NEDD8-activating complex, APP-BP1/UBA5 c 99.96
PTZ00245287 ubiquitin activating enzyme; Provisional 99.96
PRK06153393 hypothetical protein; Provisional 99.95
COG1179263 Dinucleotide-utilizing enzymes involved in molybdo 99.95
KOG2018430 consensus Predicted dinucleotide-utilizing enzyme 99.84
TIGR03693 637 ocin_ThiF_like putative thiazole-containing bacter 99.82
PF0882584 E2_bind: E2 binding domain; InterPro: IPR014929 E1 99.73
KOG2337669 consensus Ubiquitin activating E1 enzyme-like prot 99.71
PF0213467 UBACT: Repeat in ubiquitin-activating (UBA) protei 99.65
PF0523784 MoeZ_MoeB: MoeZ/MoeB domain; InterPro: IPR007901 T 99.2
PF1058545 UBA_e1_thiolCys: Ubiquitin-activating enzyme activ 99.14
PF1473287 UAE_UbL: Ubiquitin/SUMO-activating enzyme ubiquiti 98.93
PF09358125 UBA_e1_C: Ubiquitin-activating enzyme e1 C-termina 98.6
TIGR03882193 cyclo_dehyd_2 bacteriocin biosynthesis cyclodehydr 98.32
COG4015217 Predicted dinucleotide-utilizing enzyme of the Thi 98.28
PRK12549284 shikimate 5-dehydrogenase; Reviewed 97.94
COG1748389 LYS9 Saccharopine dehydrogenase and related protei 97.93
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 97.84
PRK06718202 precorrin-2 dehydrogenase; Reviewed 97.42
PRK12548289 shikimate 5-dehydrogenase; Provisional 97.31
PRK14027283 quinate/shikimate dehydrogenase; Provisional 97.1
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 97.07
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 96.99
TIGR01809282 Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO 96.94
PRK12749288 quinate/shikimate dehydrogenase; Reviewed 96.91
PRK06719157 precorrin-2 dehydrogenase; Validated 96.88
PF03435386 Saccharop_dh: Saccharopine dehydrogenase ; InterPr 96.78
PRK00258278 aroE shikimate 5-dehydrogenase; Reviewed 96.75
COG0373414 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] 96.6
PRK13940414 glutamyl-tRNA reductase; Provisional 96.57
COG0169283 AroE Shikimate 5-dehydrogenase [Amino acid transpo 96.52
PRK04148134 hypothetical protein; Provisional 96.36
PRK05562223 precorrin-2 dehydrogenase; Provisional 96.3
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 96.28
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 96.05
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 96.04
PF01113124 DapB_N: Dihydrodipicolinate reductase, N-terminus; 95.96
PF00056141 Ldh_1_N: lactate/malate dehydrogenase, NAD binding 95.94
cd05291306 HicDH_like L-2-hydroxyisocapronate dehydrogenases 95.93
PRK14106450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.89
PF01118121 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi 95.87
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 95.85
COG1086588 Predicted nucleoside-diphosphate sugar epimerases 95.8
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain 95.73
PRK00066315 ldh L-lactate dehydrogenase; Reviewed 95.65
KOG4169261 consensus 15-hydroxyprostaglandin dehydrogenase an 95.65
COG0569225 TrkA K+ transport systems, NAD-binding component [ 95.59
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 95.58
cd05311226 NAD_bind_2_malic_enz NAD(P) binding domain of mali 95.58
PLN00203519 glutamyl-tRNA reductase 95.45
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 95.43
COG1648210 CysG Siroheme synthase (precorrin-2 oxidase/ferroc 95.43
cd05290307 LDH_3 A subgroup of L-lactate dehydrogenases. L-la 95.38
PRK00045423 hemA glutamyl-tRNA reductase; Reviewed 95.16
PRK07066321 3-hydroxybutyryl-CoA dehydrogenase; Validated 95.13
TIGR00507270 aroE shikimate 5-dehydrogenase. This model finds p 95.09
PRK06197306 short chain dehydrogenase; Provisional 95.03
PTZ00082321 L-lactate dehydrogenase; Provisional 95.03
PRK07819286 3-hydroxybutyryl-CoA dehydrogenase; Validated 94.93
PRK06141314 ornithine cyclodeaminase; Validated 94.92
PRK09599301 6-phosphogluconate dehydrogenase-like protein; Rev 94.65
PF0380796 F420_oxidored: NADP oxidoreductase coenzyme F420-d 94.62
PRK01438480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 94.61
TIGR02992326 ectoine_eutC ectoine utilization protein EutC. Mem 94.53
PRK07340304 ornithine cyclodeaminase; Validated 94.51
PLN02602350 lactate dehydrogenase 94.5
PLN028191042 lysine-ketoglutarate reductase/saccharopine dehydr 94.47
KOG0069336 consensus Glyoxylate/hydroxypyruvate reductase (D- 94.45
cd0519186 NAD_bind_amino_acid_DH NAD(P) binding domain of am 94.4
PF02719293 Polysacc_synt_2: Polysaccharide biosynthesis prote 94.39
PRK06130311 3-hydroxybutyryl-CoA dehydrogenase; Validated 94.36
PRK05854313 short chain dehydrogenase; Provisional 94.34
cd05293312 LDH_1 A subgroup of L-lactate dehydrogenases. L-la 94.27
PRK07062265 short chain dehydrogenase; Provisional 94.27
PRK15469312 ghrA bifunctional glyoxylate/hydroxypyruvate reduc 94.26
PRK05476425 S-adenosyl-L-homocysteine hydrolase; Provisional 94.25
PRK12480330 D-lactate dehydrogenase; Provisional 94.18
PRK09242257 tropinone reductase; Provisional 94.17
PRK07502307 cyclohexadienyl dehydrogenase; Validated 94.11
TIGR00872298 gnd_rel 6-phosphogluconate dehydrogenase (decarbox 94.04
PF02558151 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: 94.01
PRK08618325 ornithine cyclodeaminase; Validated 93.99
cd00300300 LDH_like L-lactate dehydrogenase-like enzymes. Mem 93.98
COG1893307 ApbA Ketopantoate reductase [Coenzyme metabolism] 93.93
PRK14619308 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 93.92
PRK10637457 cysG siroheme synthase; Provisional 93.89
PTZ00142470 6-phosphogluconate dehydrogenase; Provisional 93.85
PRK14192283 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.82
PRK07063260 short chain dehydrogenase; Provisional 93.76
PRK08251248 short chain dehydrogenase; Provisional 93.76
PLN02520529 bifunctional 3-dehydroquinate dehydratase/shikimat 93.62
PLN02350493 phosphogluconate dehydrogenase (decarboxylating) 93.52
TIGR01850346 argC N-acetyl-gamma-glutamyl-phosphate reductase, 93.35
PRK12826251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 93.29
PRK08291330 ectoine utilization protein EutC; Validated 93.19
PRK00094325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr 93.19
PRK07831262 short chain dehydrogenase; Provisional 93.14
PRK13304265 L-aspartate dehydrogenase; Reviewed 93.14
PRK07680273 late competence protein ComER; Validated 93.01
PTZ00117319 malate dehydrogenase; Provisional 93.0
TIGR00873467 gnd 6-phosphogluconate dehydrogenase, decarboxylat 92.93
PRK07231251 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 92.91
PLN03209576 translocon at the inner envelope of chloroplast su 92.87
PRK00048257 dihydrodipicolinate reductase; Provisional 92.87
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 92.79
cd05292308 LDH_2 A subgroup of L-lactate dehydrogenases. L-la 92.79
TIGR01035417 hemA glutamyl-tRNA reductase. This enzyme, togethe 92.59
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 92.57
PLN02780320 ketoreductase/ oxidoreductase 92.57
PRK12550272 shikimate 5-dehydrogenase; Reviewed 92.5
PRK10537393 voltage-gated potassium channel; Provisional 92.5
PF00106167 adh_short: short chain dehydrogenase alcohol dehyd 92.5
PRK07634245 pyrroline-5-carboxylate reductase; Reviewed 92.49
TIGR03589324 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This 92.45
PTZ00325321 malate dehydrogenase; Provisional 92.41
COG1063350 Tdh Threonine dehydrogenase and related Zn-depende 92.27
PRK06567 1028 putative bifunctional glutamate synthase subunit b 92.24
PRK11559296 garR tartronate semialdehyde reductase; Provisiona 92.21
PRK07576264 short chain dehydrogenase; Provisional 92.13
PRK07523255 gluconate 5-dehydrogenase; Provisional 92.13
TIGR01759323 MalateDH-SF1 malate dehydrogenase. This model repr 92.11
PRK12921305 2-dehydropantoate 2-reductase; Provisional 92.04
PRK11199374 tyrA bifunctional chorismate mutase/prephenate deh 92.01
cd01339300 LDH-like_MDH L-lactate dehydrogenase-like malate d 91.96
PRK08217253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 91.9
PRK09186256 flagellin modification protein A; Provisional 91.89
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 91.85
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 91.83
COG1052324 LdhA Lactate dehydrogenase and related dehydrogena 91.78
PRK14982340 acyl-ACP reductase; Provisional 91.73
COG1250307 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabo 91.67
PRK12384259 sorbitol-6-phosphate dehydrogenase; Provisional 91.67
TIGR01296339 asd_B aspartate-semialdehyde dehydrogenase (peptid 91.66
PRK05708305 2-dehydropantoate 2-reductase; Provisional 91.57
PRK07478254 short chain dehydrogenase; Provisional 91.55
PRK08339263 short chain dehydrogenase; Provisional 91.44
PRK09880343 L-idonate 5-dehydrogenase; Provisional 91.41
PRK05875276 short chain dehydrogenase; Provisional 91.41
PRK08374336 homoserine dehydrogenase; Provisional 91.37
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 91.31
PRK07679279 pyrroline-5-carboxylate reductase; Reviewed 91.29
TIGR01915219 npdG NADPH-dependent F420 reductase. This model re 91.23
PRK06181263 short chain dehydrogenase; Provisional 91.21
PRK06928277 pyrroline-5-carboxylate reductase; Reviewed 91.2
PLN02427386 UDP-apiose/xylose synthase 91.16
PF03949255 Malic_M: Malic enzyme, NAD binding domain; InterPr 91.14
PRK05867253 short chain dehydrogenase; Provisional 91.14
COG0300265 DltE Short-chain dehydrogenases of various substra 91.12
PRK11880267 pyrroline-5-carboxylate reductase; Reviewed 91.07
PRK07814263 short chain dehydrogenase; Provisional 90.83
cd05211217 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of 90.8
PRK00811283 spermidine synthase; Provisional 90.8
PRK00676338 hemA glutamyl-tRNA reductase; Validated 90.79
PRK05866293 short chain dehydrogenase; Provisional 90.79
PRK12769654 putative oxidoreductase Fe-S binding subunit; Revi 90.77
PRK06125259 short chain dehydrogenase; Provisional 90.76
PRK06522304 2-dehydropantoate 2-reductase; Reviewed 90.73
PRK06194287 hypothetical protein; Provisional 90.69
PRK05872296 short chain dehydrogenase; Provisional 90.63
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 90.6
TIGR01373407 soxB sarcosine oxidase, beta subunit family, heter 90.59
cd00650263 LDH_MDH_like NAD-dependent, lactate dehydrogenase- 90.57
PRK09496453 trkA potassium transporter peripheral membrane com 90.56
PRK00436343 argC N-acetyl-gamma-glutamyl-phosphate reductase; 90.55
PLN02688266 pyrroline-5-carboxylate reductase 90.54
PRK06476258 pyrroline-5-carboxylate reductase; Reviewed 90.51
cd00762254 NAD_bind_malic_enz NAD(P) binding domain of malic 90.5
TIGR03026411 NDP-sugDHase nucleotide sugar dehydrogenase. All o 90.45
PRK05671336 aspartate-semialdehyde dehydrogenase; Reviewed 90.42
PRK06249313 2-dehydropantoate 2-reductase; Provisional 90.39
PRK06523260 short chain dehydrogenase; Provisional 90.38
PLN02240352 UDP-glucose 4-epimerase 90.34
PRK09496453 trkA potassium transporter peripheral membrane com 90.32
cd08230355 glucose_DH Glucose dehydrogenase. Glucose dehydrog 90.31
PRK15409323 bifunctional glyoxylate/hydroxypyruvate reductase 90.28
PRK02705459 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 90.27
COG0240329 GpsA Glycerol-3-phosphate dehydrogenase [Energy pr 90.25
PRK08655437 prephenate dehydrogenase; Provisional 90.22
PRK08040336 putative semialdehyde dehydrogenase; Provisional 90.21
PRK11908347 NAD-dependent epimerase/dehydratase family protein 90.21
PRK05335436 tRNA (uracil-5-)-methyltransferase Gid; Reviewed 90.2
PRK01710458 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 90.17
PRK12367245 short chain dehydrogenase; Provisional 90.17
PRK08589272 short chain dehydrogenase; Validated 90.15
PF12847112 Methyltransf_18: Methyltransferase domain; PDB: 3G 90.13
cd05312279 NAD_bind_1_malic_enz NAD(P) binding domain of mali 90.13
PRK06138252 short chain dehydrogenase; Provisional 90.12
TIGR01202308 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyl 90.11
TIGR01505291 tartro_sem_red 2-hydroxy-3-oxopropionate reductase 90.06
PRK13403335 ketol-acid reductoisomerase; Provisional 90.03
PRK06035291 3-hydroxyacyl-CoA dehydrogenase; Validated 90.02
PRK05565247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 90.01
PRK14874334 aspartate-semialdehyde dehydrogenase; Provisional 89.99
PRK07530292 3-hydroxybutyryl-CoA dehydrogenase; Validated 89.99
PRK09260288 3-hydroxybutyryl-CoA dehydrogenase; Validated 89.95
PRK06940275 short chain dehydrogenase; Provisional 89.94
PLN02383344 aspartate semialdehyde dehydrogenase 89.92
PRK12439341 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 89.86
PRK11259376 solA N-methyltryptophan oxidase; Provisional 89.74
PLN02253280 xanthoxin dehydrogenase 89.73
PTZ00345365 glycerol-3-phosphate dehydrogenase; Provisional 89.72
PRK03562621 glutathione-regulated potassium-efflux system prot 89.71
PRK07453322 protochlorophyllide oxidoreductase; Validated 89.67
PRK07666239 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 89.58
PRK15461296 NADH-dependent gamma-hydroxybutyrate dehydrogenase 89.58
PRK13302271 putative L-aspartate dehydrogenase; Provisional 89.49
TIGR03466328 HpnA hopanoid-associated sugar epimerase. The sequ 89.47
PRK06057255 short chain dehydrogenase; Provisional 89.44
PRK12409410 D-amino acid dehydrogenase small subunit; Provisio 89.42
PRK06223307 malate dehydrogenase; Reviewed 89.42
PRK06196315 oxidoreductase; Provisional 89.42
PRK07067257 sorbitol dehydrogenase; Provisional 89.41
PRK07326237 short chain dehydrogenase; Provisional 89.39
PF01266358 DAO: FAD dependent oxidoreductase; InterPro: IPR00 89.37
PRK08306296 dipicolinate synthase subunit A; Reviewed 89.32
PRK06172253 short chain dehydrogenase; Provisional 89.28
PF01494356 FAD_binding_3: FAD binding domain; InterPro: IPR00 89.24
PRK08293287 3-hydroxybutyryl-CoA dehydrogenase; Validated 89.22
PRK12771564 putative glutamate synthase (NADPH) small subunit; 89.2
COG0039313 Mdh Malate/lactate dehydrogenases [Energy producti 89.18
TIGR01181317 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase. This 89.17
TIGR01318467 gltD_gamma_fam glutamate synthase small subunit fa 89.13
COG1712255 Predicted dinucleotide-utilizing enzyme [General f 89.12
TIGR01771299 L-LDH-NAD L-lactate dehydrogenase. This model repr 89.11
PRK14175286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 89.08
PRK07024257 short chain dehydrogenase; Provisional 89.08
PRK08594257 enoyl-(acyl carrier protein) reductase; Provisiona 89.08
PRK04207341 glyceraldehyde-3-phosphate dehydrogenase; Provisio 89.02
PLN02206442 UDP-glucuronate decarboxylase 88.99
PRK06949258 short chain dehydrogenase; Provisional 88.94
TIGR00137433 gid_trmFO tRNA:m(5)U-54 methyltransferase. This mo 88.89
PRK06728347 aspartate-semialdehyde dehydrogenase; Provisional 88.88
PLN02545295 3-hydroxybutyryl-CoA dehydrogenase 88.87
PRK06139330 short chain dehydrogenase; Provisional 88.86
PRK13303265 L-aspartate dehydrogenase; Provisional 88.84
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 88.79
PRK03659601 glutathione-regulated potassium-efflux system prot 88.74
PF0262996 CoA_binding: CoA binding domain; InterPro: IPR0037 88.74
PRK07792306 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 88.72
PLN02852491 ferredoxin-NADP+ reductase 88.72
PRK05855582 short chain dehydrogenase; Validated 88.72
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 88.68
COG0665387 DadA Glycine/D-amino acid oxidases (deaminating) [ 88.65
PTZ00431260 pyrroline carboxylate reductase; Provisional 88.64
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 88.63
PRK12939250 short chain dehydrogenase; Provisional 88.63
PRK13243333 glyoxylate reductase; Reviewed 88.57
TIGR03376342 glycerol3P_DH glycerol-3-phosphate dehydrogenase ( 88.51
PRK13394262 3-hydroxybutyrate dehydrogenase; Provisional 88.43
PLN02928347 oxidoreductase family protein 88.41
TIGR01377380 soxA_mon sarcosine oxidase, monomeric form. Sarcos 88.33
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 88.15
PRK12829264 short chain dehydrogenase; Provisional 88.15
PRK07109334 short chain dehydrogenase; Provisional 88.15
PRK06046326 alanine dehydrogenase; Validated 88.15
PRK12809639 putative oxidoreductase Fe-S binding subunit; Revi 88.12
PRK06935258 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 88.1
PRK06124256 gluconate 5-dehydrogenase; Provisional 88.09
PRK13301267 putative L-aspartate dehydrogenase; Provisional 88.09
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 88.03
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 88.03
PLN02657390 3,8-divinyl protochlorophyllide a 8-vinyl reductas 87.97
PF03447117 NAD_binding_3: Homoserine dehydrogenase, NAD bindi 87.93
PRK08303305 short chain dehydrogenase; Provisional 87.92
PRK07984262 enoyl-(acyl carrier protein) reductase; Provisiona 87.91
PRK08229341 2-dehydropantoate 2-reductase; Provisional 87.9
PRK12748256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 87.86
PRK07102243 short chain dehydrogenase; Provisional 87.79
PRK12779 944 putative bifunctional glutamate synthase subunit b 87.79
PRK12490299 6-phosphogluconate dehydrogenase-like protein; Rev 87.73
COG0281432 SfcA Malic enzyme [Energy production and conversio 87.68
TIGR01757387 Malate-DH_plant malate dehydrogenase, NADP-depende 87.65
TIGR01763305 MalateDH_bact malate dehydrogenase, NAD-dependent. 87.5
PRK10669558 putative cation:proton antiport protein; Provision 87.49
PRK12491272 pyrroline-5-carboxylate reductase; Reviewed 87.49
PRK08818370 prephenate dehydrogenase; Provisional 87.47
PRK06720169 hypothetical protein; Provisional 87.45
PLN02256304 arogenate dehydrogenase 87.44
PRK14618328 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 87.44
PLN00106323 malate dehydrogenase 87.38
PLN02989325 cinnamyl-alcohol dehydrogenase family protein 87.27
PRK08264238 short chain dehydrogenase; Validated 87.23
PRK14620326 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 87.22
TIGR03206250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr 87.21
PRK05479330 ketol-acid reductoisomerase; Provisional 87.19
PF10727127 Rossmann-like: Rossmann-like domain; InterPro: IPR 87.16
PRK13018378 cell division protein FtsZ; Provisional 87.14
PRK06198260 short chain dehydrogenase; Provisional 87.13
PRK15438378 erythronate-4-phosphate dehydrogenase PdxB; Provis 87.11
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 87.08
PRK05876275 short chain dehydrogenase; Provisional 87.06
PRK09291257 short chain dehydrogenase; Provisional 86.89
PRK07417279 arogenate dehydrogenase; Reviewed 86.85
PRK09126392 hypothetical protein; Provisional 86.84
PRK08265261 short chain dehydrogenase; Provisional 86.83
PRK06199379 ornithine cyclodeaminase; Validated 86.83
PRK00711416 D-amino acid dehydrogenase small subunit; Validate 86.82
TIGR00036266 dapB dihydrodipicolinate reductase. 86.81
PRK07494388 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 86.79
TIGR03364365 HpnW_proposed FAD dependent oxidoreductase TIGR033 86.74
PRK06436303 glycerate dehydrogenase; Provisional 86.65
TIGR02028398 ChlP geranylgeranyl reductase. This model represen 86.63
PRK08277278 D-mannonate oxidoreductase; Provisional 86.63
PRK05717255 oxidoreductase; Validated 86.63
PRK11730715 fadB multifunctional fatty acid oxidation complex 86.61
PRK12859256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 86.58
PRK08945247 putative oxoacyl-(acyl carrier protein) reductase; 86.55
PF08659181 KR: KR domain; InterPro: IPR013968 This domain is 86.5
TIGR02371325 ala_DH_arch alanine dehydrogenase, Archaeoglobus f 86.48
PRK01747662 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans 86.45
PRK09310477 aroDE bifunctional 3-dehydroquinate dehydratase/sh 86.43
PRK07677252 short chain dehydrogenase; Provisional 86.42
PRK00257381 erythronate-4-phosphate dehydrogenase; Validated 86.39
PRK08664349 aspartate-semialdehyde dehydrogenase; Reviewed 86.36
PRK06398258 aldose dehydrogenase; Validated 86.34
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 86.34
PRK07774250 short chain dehydrogenase; Provisional 86.31
PRK07856252 short chain dehydrogenase; Provisional 86.29
PLN00112444 malate dehydrogenase (NADP); Provisional 86.26
PRK12827249 short chain dehydrogenase; Provisional 86.23
PLN02968381 Probable N-acetyl-gamma-glutamyl-phosphate reducta 86.21
smart00846149 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, 86.17
cd00704323 MDH Malate dehydrogenase. Malate dehydrogenase (MD 86.13
PRK08416260 7-alpha-hydroxysteroid dehydrogenase; Provisional 86.12
PRK08125660 bifunctional UDP-glucuronic acid decarboxylase/UDP 86.11
PRK07825273 short chain dehydrogenase; Provisional 86.04
PRK15181348 Vi polysaccharide biosynthesis protein TviC; Provi 85.97
PRK06185407 hypothetical protein; Provisional 85.97
PRK05714405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 85.87
PRK09987299 dTDP-4-dehydrorhamnose reductase; Provisional 85.87
PRK00141473 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 85.86
PRK05650270 short chain dehydrogenase; Provisional 85.81
PRK07608388 ubiquinone biosynthesis hydroxylase family protein 85.79
PRK06841255 short chain dehydrogenase; Provisional 85.77
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 85.75
TIGR01772312 MDH_euk_gproteo malate dehydrogenase, NAD-dependen 85.7
PRK00517250 prmA ribosomal protein L11 methyltransferase; Revi 85.67
PF00670162 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase 85.65
PRK08340259 glucose-1-dehydrogenase; Provisional 85.61
TIGR01289314 LPOR light-dependent protochlorophyllide reductase 85.49
PRK07236386 hypothetical protein; Provisional 85.45
PRK11101 546 glpA sn-glycerol-3-phosphate dehydrogenase subunit 85.38
PRK12814652 putative NADPH-dependent glutamate synthase small 85.31
PRK12937245 short chain dehydrogenase; Provisional 85.25
TIGR00465314 ilvC ketol-acid reductoisomerase. This is the seco 85.22
TIGR00065349 ftsZ cell division protein FtsZ. This family consi 85.21
KOG1298509 consensus Squalene monooxygenase [Lipid transport 85.18
TIGR03451358 mycoS_dep_FDH mycothiol-dependent formaldehyde deh 85.17
cd05298437 GH4_GlvA_pagL_like Glycoside Hydrolases Family 4; 85.12
PRK07364415 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 85.08
TIGR02279503 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa 85.04
PLN02494477 adenosylhomocysteinase 85.03
PLN02740381 Alcohol dehydrogenase-like 84.98
PF04321286 RmlD_sub_bind: RmlD substrate binding domain; Inte 84.96
PRK08013400 oxidoreductase; Provisional 84.94
PRK08507275 prephenate dehydrogenase; Validated 84.92
PRK07574385 formate dehydrogenase; Provisional 84.9
TIGR02469124 CbiT precorrin-6Y C5,15-methyltransferase (decarbo 84.89
PLN02896353 cinnamyl-alcohol dehydrogenase 84.86
cd05296419 GH4_P_beta_glucosidase Glycoside Hydrolases Family 84.86
PRK13984604 putative oxidoreductase; Provisional 84.85
PRK06114254 short chain dehydrogenase; Provisional 84.81
COG1023300 Gnd Predicted 6-phosphogluconate dehydrogenase [Ca 84.8
PRK07904253 short chain dehydrogenase; Provisional 84.79
PRK06500249 short chain dehydrogenase; Provisional 84.79
PRK11154708 fadJ multifunctional fatty acid oxidation complex 84.76
CHL00194317 ycf39 Ycf39; Provisional 84.73
PRK11728393 hydroxyglutarate oxidase; Provisional 84.73
PRK06270341 homoserine dehydrogenase; Provisional 84.72
KOG1430361 consensus C-3 sterol dehydrogenase/3-beta-hydroxys 84.72
TIGR01832248 kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod 84.68
PRK11749457 dihydropyrimidine dehydrogenase subunit A; Provisi 84.68
PRK08703239 short chain dehydrogenase; Provisional 84.61
PRK12810471 gltD glutamate synthase subunit beta; Reviewed 84.6
PRK06753373 hypothetical protein; Provisional 84.57
cd01337310 MDH_glyoxysomal_mitochondrial Glyoxysomal and mito 84.51
PRK07889256 enoyl-(acyl carrier protein) reductase; Provisiona 84.47
PRK06184502 hypothetical protein; Provisional 84.45
TIGR00936406 ahcY adenosylhomocysteinase. This enzyme hydrolyze 84.43
PTZ00075476 Adenosylhomocysteinase; Provisional 84.41
PRK07035252 short chain dehydrogenase; Provisional 84.36
PRK06487317 glycerate dehydrogenase; Provisional 84.29
PLN02858 1378 fructose-bisphosphate aldolase 84.27
PRK098531019 putative selenate reductase subunit YgfK; Provisio 84.26
PRK08850405 2-octaprenyl-6-methoxyphenol hydroxylase; Validate 84.16
PRK08226263 short chain dehydrogenase; Provisional 84.14
PRK08643256 acetoin reductase; Validated 84.09
TIGR02032295 GG-red-SF geranylgeranyl reductase family. This mo 84.03
cd01338322 MDH_choloroplast_like Chloroplast-like malate dehy 84.0
PRK06847375 hypothetical protein; Provisional 83.96
PLN00016378 RNA-binding protein; Provisional 83.94
PRK07531495 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe 83.9
PRK08268507 3-hydroxy-acyl-CoA dehydrogenase; Validated 83.89
cd08239339 THR_DH_like L-threonine dehydrogenase (TDH)-like. 83.88
PLN02166436 dTDP-glucose 4,6-dehydratase 83.84
PRK06701290 short chain dehydrogenase; Provisional 83.83
PF05834374 Lycopene_cycl: Lycopene cyclase protein; InterPro: 83.83
PLN02650351 dihydroflavonol-4-reductase 83.77
cd01076227 NAD_bind_1_Glu_DH NAD(P) binding domain of glutama 83.75
PRK08862227 short chain dehydrogenase; Provisional 83.74
KOG0409327 consensus Predicted dehydrogenase [General functio 83.69
PRK06200263 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog 83.67
TIGR01500256 sepiapter_red sepiapterin reductase. This model de 83.65
PLN02985514 squalene monooxygenase 83.65
PRK12744257 short chain dehydrogenase; Provisional 83.58
PRK08020391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin 83.58
PRK08163396 salicylate hydroxylase; Provisional 83.57
TIGR033151012 Se_ygfK putative selenate reductase, YgfK subunit. 83.57
PRK08244493 hypothetical protein; Provisional 83.56
PRK05442326 malate dehydrogenase; Provisional 83.54
PRK05732395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 83.53
PLN02366308 spermidine synthase 83.52
PRK12266508 glpD glycerol-3-phosphate dehydrogenase; Reviewed 83.46
TIGR02023388 BchP-ChlP geranylgeranyl reductase. This model rep 83.46
PRK10538248 malonic semialdehyde reductase; Provisional 83.45
PRK08849384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 83.43
COG1062366 AdhC Zn-dependent alcohol dehydrogenases, class II 83.43
PRK07097265 gluconate 5-dehydrogenase; Provisional 83.4
TIGR01758324 MDH_euk_cyt malate dehydrogenase, NAD-dependent. T 83.38
PRK07060245 short chain dehydrogenase; Provisional 83.33
cd02201304 FtsZ_type1 FtsZ is a GTPase that is similar to the 83.27
KOG1205282 consensus Predicted dehydrogenase [Secondary metab 83.24
cd08281371 liver_ADH_like1 Zinc-dependent alcohol dehydrogena 83.22
PRK06914280 short chain dehydrogenase; Provisional 83.22
TIGR02632676 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alc 83.21
PRK01581374 speE spermidine synthase; Validated 83.19
TIGR01984382 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T 83.18
PLN02695370 GDP-D-mannose-3',5'-epimerase 83.13
TIGR03329460 Phn_aa_oxid putative aminophosphonate oxidoreducta 83.08
PRK05868372 hypothetical protein; Validated 83.03
PLN03139386 formate dehydrogenase; Provisional 83.02
PRK14188296 bifunctional 5,10-methylene-tetrahydrofolate dehyd 83.01
PRK08063250 enoyl-(acyl carrier protein) reductase; Provisiona 83.01
TIGR03325262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro 82.97
COG0111324 SerA Phosphoglycerate dehydrogenase and related de 82.96
cd01336325 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosoli 82.94
PRK08324681 short chain dehydrogenase; Validated 82.92
PRK08410311 2-hydroxyacid dehydrogenase; Provisional 82.85
PRK06179270 short chain dehydrogenase; Provisional 82.85
COG0654387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and 82.84
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 82.83
PRK08278273 short chain dehydrogenase; Provisional 82.83
PF1345068 NAD_binding_8: NAD(P)-binding Rossmann-like domain 82.83
TIGR01988385 Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub 82.81
PLN02464 627 glycerol-3-phosphate dehydrogenase 82.71
PRK08220252 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated 82.68
TIGR02415254 23BDH acetoin reductases. One member of this famil 82.59
PRK07045388 putative monooxygenase; Reviewed 82.59
PRK09135249 pteridine reductase; Provisional 82.52
PRK12775 1006 putative trifunctional 2-polyprenylphenol hydroxyl 82.5
PRK08243392 4-hydroxybenzoate 3-monooxygenase; Validated 82.44
PRK12823260 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat 82.37
TIGR01692288 HIBADH 3-hydroxyisobutyrate dehydrogenase. This en 82.36
PF05368233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 82.31
KOG0024354 consensus Sorbitol dehydrogenase [Secondary metabo 82.31
>KOG2015 consensus NEDD8-activating complex, catalytic component UBA3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=4e-98  Score=714.26  Aligned_cols=415  Identities=48%  Similarity=0.783  Sum_probs=398.1

Q ss_pred             CCCCCccchhHHhhccCCCCCCCCccCCHHHHHHHhcCCeEEEEcCchHHHHHHHHHHHhCCCeEEEEeCCccCcccCcc
Q 013224            3 DTAPSRSRDLDKLLLRAGNLVGPTFEPGTELRDDLQEYARILVVGAGGLGCELLKDLALSGFKNLEVIDMDRIEVSNLNR   82 (447)
Q Consensus         3 ~~~~~~~~~~~~~l~~~~~~~r~~~~~G~~~q~~L~~~~~VlvvG~GglG~eiak~La~~Gvg~i~lvD~D~Ve~sNL~R   82 (447)
                      +..++||.++..+|+|.++|.-..|.+++|..+.|. ++||||+|+||||||++|||+++||+.+++||+|+|+++||||
T Consensus         4 ~~~s~r~~~~~~~l~r~gpf~~~~f~~~~e~l~~l~-~~kiLviGAGGLGCElLKnLal~gF~~~~viDmDTId~sNLNR   82 (422)
T KOG2015|consen    4 PKPSKRWNGWRQSLERPGPFNLDAFEPSEENLEFLQ-DCKILVIGAGGLGCELLKNLALSGFRQLHVIDMDTIDLSNLNR   82 (422)
T ss_pred             CchhhhhHHHHHHhcCCCCCCCCCCCCCHHHHHHHh-hCcEEEEccCcccHHHHHhHHhhccceeEEEeecceecccchh
Confidence            345789999999999999999999999999999999 9999999999999999999999999999999999999999999


Q ss_pred             ccCCCCCCCCChHHHHHHHHHHhhCCceEEEEEeccCccchhhccCCceEEEcccCCHHHHHHHHHHHHhhccccCCCcc
Q 013224           83 QFLFRMEDVGKPKAEVAAKRVMERVSGVNIVPHFCRIEDKDISFYNDFNIIVLGLDSIEARSYINAVACSFLEYETDDKP  162 (447)
Q Consensus        83 qfLf~~~diG~~Ka~~a~~~l~~~np~v~i~~~~~~i~~~~~~~~~~~DvVi~~~Dn~~~r~~in~~~~~l~~~~~~~~~  162 (447)
                      ||||+++|||++||++||++++++.|++.|.+|..++++++.+|+++||+||+++|++++|+|||.+.+.+..+   |.+
T Consensus        83 QFLF~~~DiG~pKAqvAA~fvn~Rvp~~~v~~h~~kIqd~~~~FYk~F~~iicGLDsIeaRRwIN~mL~~l~~~---g~~  159 (422)
T KOG2015|consen   83 QFLFRESDIGEPKAQVAAEFVNRRVPGCVVVPHRQKIQDKPISFYKRFDLIICGLDSIEARRWINGMLVRLKLE---GNY  159 (422)
T ss_pred             hhcccccccCchhHHHHHHHHHhhCCCcEEeeeecchhcCCHHHHhhhceEEecccchhHHHHHHHHHHHHHhc---cCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999887644   555


Q ss_pred             cccCCCcEEEeeeccccceEEEEeCCCCCccccccCCCCCCCCCCcccccCCcCChhhHHHHHHhhhhhhccCC-CCCCC
Q 013224          163 REETIKPMVDGGTEGFKGHARVIIPGVTPCFECTIWLFPPQVKFPLCTLAETPRTAAHCIEYAHLIKWDEVHSG-KSFDP  241 (447)
Q Consensus       163 ~~~~~~pli~~g~~g~~G~v~~~~p~~t~c~~C~~~~~p~~~~~p~ct~~~~p~~~~hci~~a~~~~~~~~~~~-~~~d~  241 (447)
                      +...-+|+||||++|++||++++.|+.|+|++|+++.+|++.+||+||++++|+.|||||+|++.++|.+.++. .++++
T Consensus       160 d~~~iiPlIDGGtEG~KG~arvI~Pg~TaCieCtldlyppqvs~P~CTiAntPRlpEHciEyv~liqwpe~~~~g~~~~g  239 (422)
T KOG2015|consen  160 DISSIIPLIDGGTEGFKGHARVIYPGITACIECTLDLYPPQVSYPMCTIANTPRLPEHCIEYVKLIQWPELNPFGVPLDG  239 (422)
T ss_pred             CccceeeeeecCcccccceeEEEecCccHHHHhHHhhcCcccCcccceecCCCCCchHhhhhhhhhcchhhCccCCCCCC
Confidence            66678999999999999999999999999999999999999999999999999999999999999999998885 78999


Q ss_pred             CChhHHHHHHHHHHHHHHHhCCCCCccccccccccccccccccHHHHHHHHHHHHHHHHHhCCCCCCcceEEEEcCCCee
Q 013224          242 DDPEHMQWVYSEAVKRAELFGIPGVTYSLTQGVVKNIIPAIASTNAIISAACALETLKIASGCSKTLSNYLTYNGVAGLH  321 (447)
Q Consensus       242 dd~~~l~~i~~~a~~ra~~~~I~~~~~~~~~gv~~~iiPaia~t~Aivagl~a~EalK~ltg~~~~l~n~~~~~~~~~~~  321 (447)
                      ||++|++||++.+++||.+|+|+++++.++.|+++.||||+|+|||+||+.||.||+|+++....+++||++|++..|.+
T Consensus       240 dd~~hI~wi~er~~eRA~ef~I~gv~~~lvtGvvK~IIPaVasTNA~IAA~Ca~ea~Kl~t~~~~~~~Nym~~n~~eG~y  319 (422)
T KOG2015|consen  240 DDPEHIEWIVERSNERANEFNITGVTRRLVTGVVKRIIPAVASTNAVIAAVCATEALKLLTATDDPLDNYMNYNAEEGIY  319 (422)
T ss_pred             CCHHHHHHHHHHHHHHhhhcccccchHHhhhhhHHhhcchhhhhhHHHHHHHHHHHHHHHHhcchhhhhheeeeccccee
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EeEeeeecCCCCccCCC-ceeEecCCCCCHHHHHHHHhcCCCcceeeceeeec-ccEEEecCCCChhhhhccccCCchHH
Q 013224          322 IKVTEFVKDKDCLVCGP-GVLIELDTSVTLEKFINLLEEHPKLQLAKASVTYR-GKNLYMQAPPVLEEMTRSNLSLPLYD  399 (447)
Q Consensus       322 ~~~~~~~~~p~C~vC~~-~~~~~~~~~~tl~~l~~~l~~~~~~~~~~~~i~~~-~~~ly~~~~~~l~~~~~~~L~k~l~e  399 (447)
                      ++++.++|.++|++|+. ...+.+.+..||++++.+++  +.|++..|.+++. ...||++++|++++++++||.++|.|
T Consensus       320 tytf~~er~~nC~vCS~~~~~~~ispt~tl~~vl~~ls--~~~~lk~p~~tt~~~~~ly~~~~~~~e~~t~~nl~~~l~~  397 (422)
T KOG2015|consen  320 TYTFLLERDKNCPVCSNLVQNYDISPTVTLEDVLNHLS--KSFQLKSPALTTAAGRTLYLSSVPSIEEATRKNLSQSLKE  397 (422)
T ss_pred             EEEeeeccCCCCccccCCCcccccCCcccHHHHHHHhh--hhhccCCchhhhhhcceEeecCCcHHHHHhhhhhhhhHHH
Confidence            99999999999999998 77788888999999999997  5799999999864 47899999999999999999999999


Q ss_pred             hhcccccceeeeccccccccCCcceeEEEEEEE
Q 013224          400 LMDKVAKDILHVTGVTGQSDKKTSCLRKLRVVF  432 (447)
Q Consensus       400 l~~~g~~~~~~~~~~~~v~d~~~~~~~~~~~~~  432 (447)
                      | .+|  ++|      +|||.+++..++|+|++
T Consensus       398 l-~dg--~~l------~vtd~~~~~~l~~~l~~  421 (422)
T KOG2015|consen  398 L-SDG--QEL------VVTDKTLSTALTLQLRE  421 (422)
T ss_pred             h-cCC--ceE------EEecccCCcceeEEEec
Confidence            9 888  899      99999999999999987

>cd01488 Uba3_RUB Ubiquitin activating enzyme (E1) subunit UBA3 Back     alignment and domain information
>KOG2013 consensus SMT3/SUMO-activating complex, catalytic component UBA2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01408 Ube1 ubiquitin-activating enzyme E1 Back     alignment and domain information
>cd01490 Ube1_repeat2 Ubiquitin activating enzyme (E1), repeat 2 Back     alignment and domain information
>cd01489 Uba2_SUMO Ubiquitin activating enzyme (E1) subunit UBA2 Back     alignment and domain information
>KOG2012 consensus Ubiquitin activating enzyme UBA1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01484 E1-2_like Ubiquitin activating enzyme (E1), repeat 2-like Back     alignment and domain information
>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>PRK07411 hypothetical protein; Validated Back     alignment and domain information
>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK05600 thiamine biosynthesis protein ThiF; Validated Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>PRK08223 hypothetical protein; Validated Back     alignment and domain information
>PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA Back     alignment and domain information
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>PRK08328 hypothetical protein; Provisional Back     alignment and domain information
>KOG2017 consensus Molybdopterin synthase sulfurylase [Coenzyme transport and metabolism] Back     alignment and domain information
>cd01491 Ube1_repeat1 Ubiquitin activating enzyme (E1), repeat 1 Back     alignment and domain information
>cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 Back     alignment and domain information
>cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like Back     alignment and domain information
>COG0476 ThiF Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 2 [Coenzyme metabolism] Back     alignment and domain information
>KOG2014 consensus SMT3/SUMO-activating complex, AOS1/RAD31 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03603 cyclo_dehy_ocin bacteriocin biosynthesis cyclodehydratase, SagC family Back     alignment and domain information
>cd01493 APPBP1_RUB Ubiquitin activating enzyme (E1) subunit APPBP1 Back     alignment and domain information
>TIGR01408 Ube1 ubiquitin-activating enzyme E1 Back     alignment and domain information
>PRK14852 hypothetical protein; Provisional Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>PRK14851 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01381 E1_like_apg7 E1-like protein-activating enzyme Gsa7p/Apg7p Back     alignment and domain information
>PRK07877 hypothetical protein; Provisional Back     alignment and domain information
>cd01487 E1_ThiF_like E1_ThiF_like Back     alignment and domain information
>TIGR03736 PRTRC_ThiF PRTRC system ThiF family protein Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>cd01486 Apg7 Apg7 is an E1-like protein, that activates two different ubiquitin-like proteins, Apg12 and Apg8, and assigns them to specific E2 enzymes, Apg10 and Apg3, respectively Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>PRK15116 sulfur acceptor protein CsdL; Provisional Back     alignment and domain information
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>cd00755 YgdL_like Family of activating enzymes (E1) of ubiquitin-like proteins related to the E Back     alignment and domain information
>KOG2336 consensus Molybdopterin biosynthesis-related protein [Coenzyme transport and metabolism] Back     alignment and domain information
>KOG2012 consensus Ubiquitin activating enzyme UBA1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2016 consensus NEDD8-activating complex, APP-BP1/UBA5 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00245 ubiquitin activating enzyme; Provisional Back     alignment and domain information
>PRK06153 hypothetical protein; Provisional Back     alignment and domain information
>COG1179 Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 1 [Coenzyme metabolism] Back     alignment and domain information
>KOG2018 consensus Predicted dinucleotide-utilizing enzyme involved in molybdopterin and thiamine biosynthesis [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03693 ocin_ThiF_like putative thiazole-containing bacteriocin maturation protein Back     alignment and domain information
>PF08825 E2_bind: E2 binding domain; InterPro: IPR014929 E1 and E2 enzymes play a central role in ubiquitin and ubiquitin-like protein transfer cascades Back     alignment and domain information
>KOG2337 consensus Ubiquitin activating E1 enzyme-like protein [Coenzyme transport and metabolism] Back     alignment and domain information
>PF02134 UBACT: Repeat in ubiquitin-activating (UBA) protein; InterPro: IPR000127 The post-translational attachment of ubiquitin (IPR000626 from INTERPRO) to proteins (ubiquitinylation) alters the function, location or trafficking of a protein, or targets it to the 26S proteasome for degradation [, , ] Back     alignment and domain information
>PF05237 MoeZ_MoeB: MoeZ/MoeB domain; InterPro: IPR007901 This putative domain is found in the MoeZ protein and the MoeB protein Back     alignment and domain information
>PF10585 UBA_e1_thiolCys: Ubiquitin-activating enzyme active site ; InterPro: IPR019572 Ubiquitin-activating enzyme (E1 enzyme) activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>PF14732 UAE_UbL: Ubiquitin/SUMO-activating enzyme ubiquitin-like domain; PDB: 1Y8Q_B 1Y8R_E 3KYD_B 3KYC_B Back     alignment and domain information
>PF09358 UBA_e1_C: Ubiquitin-activating enzyme e1 C-terminal domain; InterPro: IPR018965 This presumed domain found at the C terminus of Ubiquitin-activating enzyme e1 proteins is functionally uncharacterised Back     alignment and domain information
>TIGR03882 cyclo_dehyd_2 bacteriocin biosynthesis cyclodehydratase domain Back     alignment and domain information
>COG4015 Predicted dinucleotide-utilizing enzyme of the ThiF/HesA family [General function prediction only] Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK14027 quinate/shikimate dehydrogenase; Provisional Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type Back     alignment and domain information
>PRK12749 quinate/shikimate dehydrogenase; Reviewed Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] Back     alignment and domain information
>PRK13940 glutamyl-tRNA reductase; Provisional Back     alignment and domain information
>COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>PRK05562 precorrin-2 dehydrogenase; Provisional Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] Back     alignment and domain information
>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>PRK00066 ldh L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>KOG4169 consensus 15-hydroxyprostaglandin dehydrogenase and related dehydrogenases [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>PLN00203 glutamyl-tRNA reductase Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>COG1648 CysG Siroheme synthase (precorrin-2 oxidase/ferrochelatase domain) [Coenzyme metabolism] Back     alignment and domain information
>cd05290 LDH_3 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR00507 aroE shikimate 5-dehydrogenase Back     alignment and domain information
>PRK06197 short chain dehydrogenase; Provisional Back     alignment and domain information
>PTZ00082 L-lactate dehydrogenase; Provisional Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK06141 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR02992 ectoine_eutC ectoine utilization protein EutC Back     alignment and domain information
>PRK07340 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PLN02602 lactate dehydrogenase Back     alignment and domain information
>PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase Back     alignment and domain information
>KOG0069 consensus Glyoxylate/hydroxypyruvate reductase (D-isomer-specific 2-hydroxy acid dehydrogenase superfamily) [Energy production and conversion] Back     alignment and domain information
>cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins Back     alignment and domain information
>PF02719 Polysacc_synt_2: Polysaccharide biosynthesis protein; InterPro: IPR003869 This domain is found in diverse bacterial polysaccharide biosynthesis proteins including the CapD protein from Staphylococcus aureus [], the WalL protein, mannosyl-transferase [], and several putative epimerases Back     alignment and domain information
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK05854 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd05293 LDH_1 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PRK07062 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>PRK12480 D-lactate dehydrogenase; Provisional Back     alignment and domain information
>PRK09242 tropinone reductase; Provisional Back     alignment and domain information
>PRK07502 cyclohexadienyl dehydrogenase; Validated Back     alignment and domain information
>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 Back     alignment and domain information
>PRK08618 ornithine cyclodeaminase; Validated Back     alignment and domain information
>cd00300 LDH_like L-lactate dehydrogenase-like enzymes Back     alignment and domain information
>COG1893 ApbA Ketopantoate reductase [Coenzyme metabolism] Back     alignment and domain information
>PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK10637 cysG siroheme synthase; Provisional Back     alignment and domain information
>PTZ00142 6-phosphogluconate dehydrogenase; Provisional Back     alignment and domain information
>PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK07063 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08251 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02520 bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase Back     alignment and domain information
>PLN02350 phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>TIGR01850 argC N-acetyl-gamma-glutamyl-phosphate reductase, common form Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>PRK08291 ectoine utilization protein EutC; Validated Back     alignment and domain information
>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK07831 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK13304 L-aspartate dehydrogenase; Reviewed Back     alignment and domain information
>PRK07680 late competence protein ComER; Validated Back     alignment and domain information
>PTZ00117 malate dehydrogenase; Provisional Back     alignment and domain information
>TIGR00873 gnd 6-phosphogluconate dehydrogenase, decarboxylating Back     alignment and domain information
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>PRK00048 dihydrodipicolinate reductase; Provisional Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>TIGR01035 hemA glutamyl-tRNA reductase Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>PLN02780 ketoreductase/ oxidoreductase Back     alignment and domain information
>PRK12550 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK10537 voltage-gated potassium channel; Provisional Back     alignment and domain information
>PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases Back     alignment and domain information
>PRK07634 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase Back     alignment and domain information
>PTZ00325 malate dehydrogenase; Provisional Back     alignment and domain information
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated Back     alignment and domain information
>PRK11559 garR tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>PRK07576 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>TIGR01759 MalateDH-SF1 malate dehydrogenase Back     alignment and domain information
>PRK12921 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional Back     alignment and domain information
>cd01339 LDH-like_MDH L-lactate dehydrogenase-like malate dehydrogenase proteins Back     alignment and domain information
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK09186 flagellin modification protein A; Provisional Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>PRK14982 acyl-ACP reductase; Provisional Back     alignment and domain information
>COG1250 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabolism] Back     alignment and domain information
>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01296 asd_B aspartate-semialdehyde dehydrogenase (peptidoglycan organisms) Back     alignment and domain information
>PRK05708 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK07478 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08339 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09880 L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK05875 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08374 homoserine dehydrogenase; Provisional Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>PRK07679 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>TIGR01915 npdG NADPH-dependent F420 reductase Back     alignment and domain information
>PRK06181 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06928 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PLN02427 UDP-apiose/xylose synthase Back     alignment and domain information
>PF03949 Malic_M: Malic enzyme, NAD binding domain; InterPro: IPR012302 Malic enzymes (malate oxidoreductases) catalyse the oxidative decarboxylation of malate to form pyruvate [], a reaction important in a number of metabolic pathways - e Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>PRK11880 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK07814 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PRK00811 spermidine synthase; Provisional Back     alignment and domain information
>PRK00676 hemA glutamyl-tRNA reductase; Validated Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK06125 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information
>PRK06194 hypothetical protein; Provisional Back     alignment and domain information
>PRK05872 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form Back     alignment and domain information
>cd00650 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PRK00436 argC N-acetyl-gamma-glutamyl-phosphate reductase; Validated Back     alignment and domain information
>PLN02688 pyrroline-5-carboxylate reductase Back     alignment and domain information
>PRK06476 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>cd00762 NAD_bind_malic_enz NAD(P) binding domain of malic enzyme Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>PRK05671 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PRK06249 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK06523 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02240 UDP-glucose 4-epimerase Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>cd08230 glucose_DH Glucose dehydrogenase Back     alignment and domain information
>PRK15409 bifunctional glyoxylate/hydroxypyruvate reductase B; Provisional Back     alignment and domain information
>PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG0240 GpsA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK08655 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK08040 putative semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional Back     alignment and domain information
>PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed Back     alignment and domain information
>PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK12367 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08589 short chain dehydrogenase; Validated Back     alignment and domain information
>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A Back     alignment and domain information
>cd05312 NAD_bind_1_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 1 Back     alignment and domain information
>PRK06138 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01202 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase Back     alignment and domain information
>TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase Back     alignment and domain information
>PRK13403 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK14874 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK06940 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02383 aspartate semialdehyde dehydrogenase Back     alignment and domain information
>PRK12439 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK11259 solA N-methyltryptophan oxidase; Provisional Back     alignment and domain information
>PLN02253 xanthoxin dehydrogenase Back     alignment and domain information
>PTZ00345 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional Back     alignment and domain information
>PRK07453 protochlorophyllide oxidoreductase; Validated Back     alignment and domain information
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK15461 NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK13302 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>TIGR03466 HpnA hopanoid-associated sugar epimerase Back     alignment and domain information
>PRK06057 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>PRK06223 malate dehydrogenase; Reviewed Back     alignment and domain information
>PRK06196 oxidoreductase; Provisional Back     alignment and domain information
>PRK07067 sorbitol dehydrogenase; Provisional Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>PRK06172 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>COG0039 Mdh Malate/lactate dehydrogenases [Energy production and conversion] Back     alignment and domain information
>TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>COG1712 Predicted dinucleotide-utilizing enzyme [General function prediction only] Back     alignment and domain information
>TIGR01771 L-LDH-NAD L-lactate dehydrogenase Back     alignment and domain information
>PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK07024 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08594 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK04207 glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PLN02206 UDP-glucuronate decarboxylase Back     alignment and domain information
>PRK06949 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR00137 gid_trmFO tRNA:m(5)U-54 methyltransferase Back     alignment and domain information
>PRK06728 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PLN02545 3-hydroxybutyryl-CoA dehydrogenase Back     alignment and domain information
>PRK06139 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK13303 L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional Back     alignment and domain information
>PF02629 CoA_binding: CoA binding domain; InterPro: IPR003781 This domain has a Rossmann fold and is found in a number of proteins including succinyl CoA synthetases, malate and ATP-citrate ligases Back     alignment and domain information
>PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PLN02852 ferredoxin-NADP+ reductase Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>PTZ00431 pyrroline carboxylate reductase; Provisional Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>TIGR03376 glycerol3P_DH glycerol-3-phosphate dehydrogenase (NAD(+)) Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PLN02928 oxidoreductase family protein Back     alignment and domain information
>TIGR01377 soxA_mon sarcosine oxidase, monomeric form Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK12829 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07109 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06046 alanine dehydrogenase; Validated Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK06124 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK13301 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>PF03447 NAD_binding_3: Homoserine dehydrogenase, NAD binding domain; InterPro: IPR005106 Bacteria, plants and fungi metabolise aspartic acid to produce four amino acids - lysine, threonine, methionine and isoleucine - in a series of reactions known as the aspartate pathway Back     alignment and domain information
>PRK08303 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07984 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08229 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK12748 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07102 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>COG0281 SfcA Malic enzyme [Energy production and conversion] Back     alignment and domain information
>TIGR01757 Malate-DH_plant malate dehydrogenase, NADP-dependent Back     alignment and domain information
>TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PRK10669 putative cation:proton antiport protein; Provisional Back     alignment and domain information
>PRK12491 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK08818 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK06720 hypothetical protein; Provisional Back     alignment and domain information
>PLN02256 arogenate dehydrogenase Back     alignment and domain information
>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PLN00106 malate dehydrogenase Back     alignment and domain information
>PLN02989 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PRK08264 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>PRK05479 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins Back     alignment and domain information
>PRK13018 cell division protein FtsZ; Provisional Back     alignment and domain information
>PRK06198 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK15438 erythronate-4-phosphate dehydrogenase PdxB; Provisional Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>PRK05876 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09291 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07417 arogenate dehydrogenase; Reviewed Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>PRK08265 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06199 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK00711 D-amino acid dehydrogenase small subunit; Validated Back     alignment and domain information
>TIGR00036 dapB dihydrodipicolinate reductase Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364 Back     alignment and domain information
>PRK06436 glycerate dehydrogenase; Provisional Back     alignment and domain information
>TIGR02028 ChlP geranylgeranyl reductase Back     alignment and domain information
>PRK08277 D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>PRK05717 oxidoreductase; Validated Back     alignment and domain information
>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>PRK12859 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PF08659 KR: KR domain; InterPro: IPR013968 This domain is found in bacterial polyketide synthases that catalyse the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>TIGR02371 ala_DH_arch alanine dehydrogenase, Archaeoglobus fulgidus type Back     alignment and domain information
>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information
>PRK09310 aroDE bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase protein; Reviewed Back     alignment and domain information
>PRK07677 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK00257 erythronate-4-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK08664 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PRK06398 aldose dehydrogenase; Validated Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07856 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN00112 malate dehydrogenase (NADP); Provisional Back     alignment and domain information
>PRK12827 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02968 Probable N-acetyl-gamma-glutamyl-phosphate reductase Back     alignment and domain information
>smart00846 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain Back     alignment and domain information
>cd00704 MDH Malate dehydrogenase Back     alignment and domain information
>PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PRK08125 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated Back     alignment and domain information
>PRK07825 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional Back     alignment and domain information
>PRK06185 hypothetical protein; Provisional Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK09987 dTDP-4-dehydrorhamnose reductase; Provisional Back     alignment and domain information
>PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK05650 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>PRK06841 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>TIGR01772 MDH_euk_gproteo malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 Back     alignment and domain information
>PRK08340 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>TIGR01289 LPOR light-dependent protochlorophyllide reductase Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>PRK12937 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR00465 ilvC ketol-acid reductoisomerase Back     alignment and domain information
>TIGR00065 ftsZ cell division protein FtsZ Back     alignment and domain information
>KOG1298 consensus Squalene monooxygenase [Lipid transport and metabolism] Back     alignment and domain information
>TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase Back     alignment and domain information
>cd05298 GH4_GlvA_pagL_like Glycoside Hydrolases Family 4; GlvA- and pagL-like glycosidases Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC Back     alignment and domain information
>PLN02494 adenosylhomocysteinase Back     alignment and domain information
>PLN02740 Alcohol dehydrogenase-like Back     alignment and domain information
>PF04321 RmlD_sub_bind: RmlD substrate binding domain; InterPro: IPR005913 dTDP-4-dehydrorhamnose reductase (1 Back     alignment and domain information
>PRK08013 oxidoreductase; Provisional Back     alignment and domain information
>PRK08507 prephenate dehydrogenase; Validated Back     alignment and domain information
>PRK07574 formate dehydrogenase; Provisional Back     alignment and domain information
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit Back     alignment and domain information
>PLN02896 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>cd05296 GH4_P_beta_glucosidase Glycoside Hydrolases Family 4; Phospho-beta-glucosidase Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK06114 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG1023 Gnd Predicted 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK07904 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06500 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>PRK11728 hydroxyglutarate oxidase; Provisional Back     alignment and domain information
>PRK06270 homoserine dehydrogenase; Provisional Back     alignment and domain information
>KOG1430 consensus C-3 sterol dehydrogenase/3-beta-hydroxysteroid dehydrogenase and related dehydrogenases [Lipid transport and metabolism; Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>PRK08703 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>cd01337 MDH_glyoxysomal_mitochondrial Glyoxysomal and mitochondrial malate dehydrogenases Back     alignment and domain information
>PRK07889 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06184 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00936 ahcY adenosylhomocysteinase Back     alignment and domain information
>PTZ00075 Adenosylhomocysteinase; Provisional Back     alignment and domain information
>PRK07035 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06487 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PLN02858 fructose-bisphosphate aldolase Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated Back     alignment and domain information
>PRK08226 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08643 acetoin reductase; Validated Back     alignment and domain information
>TIGR02032 GG-red-SF geranylgeranyl reductase family Back     alignment and domain information
>cd01338 MDH_choloroplast_like Chloroplast-like malate dehydrogenases Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>PLN00016 RNA-binding protein; Provisional Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>PRK08268 3-hydroxy-acyl-CoA dehydrogenase; Validated Back     alignment and domain information
>cd08239 THR_DH_like L-threonine dehydrogenase (TDH)-like Back     alignment and domain information
>PLN02166 dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>PRK06701 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins Back     alignment and domain information
>PLN02650 dihydroflavonol-4-reductase Back     alignment and domain information
>cd01076 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 1 Back     alignment and domain information
>PRK08862 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG0409 consensus Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01500 sepiapter_red sepiapterin reductase Back     alignment and domain information
>PLN02985 squalene monooxygenase Back     alignment and domain information
>PRK12744 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>PRK08244 hypothetical protein; Provisional Back     alignment and domain information
>PRK05442 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PLN02366 spermidine synthase Back     alignment and domain information
>PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR02023 BchP-ChlP geranylgeranyl reductase Back     alignment and domain information
>PRK10538 malonic semialdehyde reductase; Provisional Back     alignment and domain information
>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>COG1062 AdhC Zn-dependent alcohol dehydrogenases, class III [Energy production and conversion] Back     alignment and domain information
>PRK07097 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>TIGR01758 MDH_euk_cyt malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PRK07060 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd02201 FtsZ_type1 FtsZ is a GTPase that is similar to the eukaryotic tubulins and is essential for cell division in prokaryotes Back     alignment and domain information
>KOG1205 consensus Predicted dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>cd08281 liver_ADH_like1 Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase) Back     alignment and domain information
>PRK06914 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase Back     alignment and domain information
>PRK01581 speE spermidine synthase; Validated Back     alignment and domain information
>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>PLN02695 GDP-D-mannose-3',5'-epimerase Back     alignment and domain information
>TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase Back     alignment and domain information
>PRK05868 hypothetical protein; Validated Back     alignment and domain information
>PLN03139 formate dehydrogenase; Provisional Back     alignment and domain information
>PRK14188 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK08063 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Back     alignment and domain information
>COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>cd01336 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosolic Malate dehydrogenases Back     alignment and domain information
>PRK08324 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK08410 2-hydroxyacid dehydrogenase; Provisional Back     alignment and domain information
>PRK06179 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>PRK08278 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G Back     alignment and domain information
>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>PLN02464 glycerol-3-phosphate dehydrogenase Back     alignment and domain information
>PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated Back     alignment and domain information
>TIGR02415 23BDH acetoin reductases Back     alignment and domain information
>PRK07045 putative monooxygenase; Reviewed Back     alignment and domain information
>PRK09135 pteridine reductase; Provisional Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated Back     alignment and domain information
>PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01692 HIBADH 3-hydroxyisobutyrate dehydrogenase Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information
>KOG0024 consensus Sorbitol dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query447
2nvu_B805 Structure Of Appbp1-Uba3~nedd8-Nedd8-Mgatp-Ubc12(C1 1e-98
1yov_B444 Insights Into The Ubiquitin Transfer Cascade From T 2e-98
1tt5_B434 Structure Of Appbp1-Uba3-Ubc12n26: A Unique E1-E2 I 2e-98
3gzn_B463 Structure Of Nedd8-Activating Enzyme In Complex Wit 2e-98
3dbl_B434 Structural Dissection Of A Gating Mechanism Prevent 1e-97
1r4m_B431 Appbp1-Uba3-Nedd8, An E1-Ubiquitin-Like Protein Com 1e-97
3dbr_B434 Structural Dissection Of A Gating Mechanism Prevent 3e-97
3dbh_B434 Structural Dissection Of A Gating Mechanism Prevent 7e-97
3kyc_B 660 Human Sumo E1 Complex With A Sumo1-Amp Mimic Length 2e-35
3kyd_B 551 Human Sumo E1~sumo1-amp Tetrahedral Intermediate Mi 2e-35
1y8q_B 640 Sumo E1 Activating Enzyme Sae1-Sae2-Mg-Atp Complex 1e-34
4ii2_A 1001 Crystal Structure Of Ubiquitin Activating Enzyme 1 3e-25
3cmm_A 1015 Crystal Structure Of The Uba1-Ubiquitin Complex Len 1e-24
1jwb_B249 Structure Of The Covalent Acyl-Adenylate Form Of Th 2e-11
3h5n_A353 Crystal Structure Of E. Coli Mccb + Atp Length = 35 3e-10
3h5a_A358 Crystal Structure Of E. Coli Mccb Length = 358 3e-10
1zud_1251 Structure Of This-Thif Protein Complex Length = 251 6e-10
1zfn_A253 Structural Analysis Of Escherichia Coli Thif Length 6e-10
1y8q_A346 Sumo E1 Activating Enzyme Sae1-Sae2-Mg-Atp Complex 1e-08
3rui_A340 Crystal Structure Of Atg7c-Atg8 Complex Length = 34 6e-08
3vh3_A340 Crystal Structure Of Atg7ctd-Atg8 Complex Length = 8e-08
4gsk_A615 Crystal Structure Of An Atg7-Atg10 Crosslinked Comp 8e-08
3t7e_A344 Atg8 Transfer From Atg7 To Atg3: A Distinctive E1-E 8e-08
3vh1_A598 Crystal Structure Of Saccharomyces Cerevisiae Atg7 1e-07
3vh2_A616 Crystal Structure Of Saccharomyces Cerevisiae Atg7 1e-07
4gsl_A615 Crystal Structure Of An Atg7-Atg3 Crosslinked Compl 1e-07
2nvu_A536 Structure Of Appbp1-Uba3~nedd8-Nedd8-Mgatp-Ubc12(C1 2e-05
1tt5_A531 Structure Of Appbp1-Uba3-Ubc12n26: A Unique E1-E2 I 2e-05
1r4m_A529 Appbp1-Uba3-Nedd8, An E1-Ubiquitin-Like Protein Com 2e-05
1yov_A537 Insights Into The Ubiquitin Transfer Cascade From T 2e-05
3gzn_A534 Structure Of Nedd8-Activating Enzyme In Complex Wit 2e-05
3guc_A292 Human Ubiquitin-Activating Enzyme 5 In Complex With 1e-04
>pdb|2NVU|B Chain B, Structure Of Appbp1-Uba3~nedd8-Nedd8-Mgatp-Ubc12(C111a), A Trapped Ubiquitin-Like Protein Activation Complex Length = 805 Back     alignment and structure 
Iteration: 1

 Score =  356 bits (914), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 184/390 (47%), Positives = 248/390 (63%), Gaps = 9/390 (2%)
Query: 19  AGNLVGPTFEPGTELRDDLQEYARILVVGAGGLGCELLKDLALSGFKNLEVIDMDRIEVS 78
           +G    P FEP TE    L +  ++LV+GAGGLGCELLK+LALSGF+ + VIDMD I+VS
Sbjct: 390 SGPFTHPDFEPSTESLQFLLDTCKVLVIGAGGLGCELLKNLALSGFRQIHVIDMDTIDVS 449
Query: 79  NLNRQFLFRMEDVGKPKAEVAAKRVMERVSGVNIVPHFCRIEDKDISFYNDFNIIVLGLD 138
           NLNRQFLFR +D+G+PKAEVAA+ + +RV   N+VPHF +I+D + +FY  F+IIV GLD
Sbjct: 450 NLNRQFLFRPKDIGRPKAEVAAEFLNDRVPNCNVVPHFNKIQDFNDTFYRQFHIIVCGLD 509
Query: 139 SIEARSYINAVACSFLEYETDDKPREETIKPMVDGGTEGFKGHARVIIPGVTPCFECTIW 198
           SI AR +IN +  S L YE D      +I P++DGGTEGFKG+ARVI+PG+T C ECT+ 
Sbjct: 510 SIIARRWINGMLISLLNYE-DGVLDPSSIVPLIDGGTEGFKGNARVILPGMTACIECTLE 568
Query: 199 LFPPQVKFPLCTLAETPRTAAHCIEYAHLIKWDEVH---SGKSFDPDDPEHMQWVYSEAV 255
           L+PPQV FP+CT+A  PR   HCIEY  +++W +      G   D DDPEH+QW++ +++
Sbjct: 569 LYPPQVNFPMCTIASMPRLPEHCIEYVRMLQWPKEQPFGEGVPLDGDDPEHIQWIFQKSL 628
Query: 256 KRAELFGIPGVTYSLTQGVVKXXXXXXXXXXXXXXXXCALETLKIASGCSKTLSNYLTYN 315
           +RA  + I GVTY LTQGVVK                CA E  KIA+     L+NYL +N
Sbjct: 629 ERASQYNIRGVTYRLTQGVVKRIIPAVASTNAVIAAVCATEVFKIATSAYIPLNNYLVFN 688
Query: 316 GVAGLHIKVTEFVKDKDCLVCGP-GVLIELDTSVTLEKFINLLEEHPKLQLAKASV--TY 372
            V GL+    E  + ++C  C      I+   S  L++ ++ L     LQ+   ++  T 
Sbjct: 689 DVDGLYTYTFEAERKENCPACSQLPQNIQFSPSAKLQEVLDYLTNSASLQMKSPAITATL 748
Query: 373 RGKN--LYMQAPPVLEEMTRSNLSLPLYDL 400
            GKN  LY+Q+   +EE TR NLS  L +L
Sbjct: 749 EGKNRTLYLQSVTSIEERTRPNLSKTLKEL 778
>pdb|1YOV|B Chain B, Insights Into The Ubiquitin Transfer Cascade From The Refined Structure Of The Activating Enzyme For Nedd8 Length = 444 Back     alignment and structure
>pdb|1TT5|B Chain B, Structure Of Appbp1-Uba3-Ubc12n26: A Unique E1-E2 Interaction Required For Optimal Conjugation Of The Ubiquitin-Like Protein Nedd8 Length = 434 Back     alignment and structure
>pdb|3GZN|B Chain B, Structure Of Nedd8-Activating Enzyme In Complex With Nedd8 And Mln4924 Length = 463 Back     alignment and structure
>pdb|3DBL|B Chain B, Structural Dissection Of A Gating Mechanism Preventing Misactivation Of Ubiquitin By Nedd8's E1 (Appbp1- Uba3arg190wt-Nedd8ala72gln) Length = 434 Back     alignment and structure
>pdb|1R4M|B Chain B, Appbp1-Uba3-Nedd8, An E1-Ubiquitin-Like Protein Complex Length = 431 Back     alignment and structure
>pdb|3DBR|B Chain B, Structural Dissection Of A Gating Mechanism Preventing Misactivation Of Ubiquitin By Nedd8's E1 (Appbp1- Uba3arg190gln-Nedd8ala72arg) Length = 434 Back     alignment and structure
>pdb|3DBH|B Chain B, Structural Dissection Of A Gating Mechanism Preventing Misactivation Of Ubiquitin By Nedd8's E1 (Appbp1- Uba3arg190ala-Nedd8ala72arg) Length = 434 Back     alignment and structure
>pdb|3KYC|B Chain B, Human Sumo E1 Complex With A Sumo1-Amp Mimic Length = 660 Back     alignment and structure
>pdb|3KYD|B Chain B, Human Sumo E1~sumo1-amp Tetrahedral Intermediate Mimic Length = 551 Back     alignment and structure
>pdb|1Y8Q|B Chain B, Sumo E1 Activating Enzyme Sae1-Sae2-Mg-Atp Complex Length = 640 Back     alignment and structure
>pdb|4II2|A Chain A, Crystal Structure Of Ubiquitin Activating Enzyme 1 (uba1) In Complex With The Ub E2 Ubc4, Ubiquitin, And Atp/mg Length = 1001 Back     alignment and structure
>pdb|3CMM|A Chain A, Crystal Structure Of The Uba1-Ubiquitin Complex Length = 1015 Back     alignment and structure
>pdb|1JWB|B Chain B, Structure Of The Covalent Acyl-Adenylate Form Of The Moeb-Moad Protein Complex Length = 249 Back     alignment and structure
>pdb|3H5N|A Chain A, Crystal Structure Of E. Coli Mccb + Atp Length = 353 Back     alignment and structure
>pdb|3H5A|A Chain A, Crystal Structure Of E. Coli Mccb Length = 358 Back     alignment and structure
>pdb|1ZUD|1 Chain 1, Structure Of This-Thif Protein Complex Length = 251 Back     alignment and structure
>pdb|1ZFN|A Chain A, Structural Analysis Of Escherichia Coli Thif Length = 253 Back     alignment and structure
>pdb|1Y8Q|A Chain A, Sumo E1 Activating Enzyme Sae1-Sae2-Mg-Atp Complex Length = 346 Back     alignment and structure
>pdb|3RUI|A Chain A, Crystal Structure Of Atg7c-Atg8 Complex Length = 340 Back     alignment and structure
>pdb|3VH3|A Chain A, Crystal Structure Of Atg7ctd-Atg8 Complex Length = 340 Back     alignment and structure
>pdb|4GSK|A Chain A, Crystal Structure Of An Atg7-Atg10 Crosslinked Complex Length = 615 Back     alignment and structure
>pdb|3T7E|A Chain A, Atg8 Transfer From Atg7 To Atg3: A Distinctive E1-E2 Architecture And Mechanism In The Autophagy Pathway Length = 344 Back     alignment and structure
>pdb|3VH1|A Chain A, Crystal Structure Of Saccharomyces Cerevisiae Atg7 (1-595) Length = 598 Back     alignment and structure
>pdb|3VH2|A Chain A, Crystal Structure Of Saccharomyces Cerevisiae Atg7 (1-613) Length = 616 Back     alignment and structure
>pdb|4GSL|A Chain A, Crystal Structure Of An Atg7-Atg3 Crosslinked Complex Length = 615 Back     alignment and structure
>pdb|2NVU|A Chain A, Structure Of Appbp1-Uba3~nedd8-Nedd8-Mgatp-Ubc12(C111a), A Trapped Ubiquitin-Like Protein Activation Complex Length = 536 Back     alignment and structure
>pdb|1TT5|A Chain A, Structure Of Appbp1-Uba3-Ubc12n26: A Unique E1-E2 Interaction Required For Optimal Conjugation Of The Ubiquitin-Like Protein Nedd8 Length = 531 Back     alignment and structure
>pdb|1R4M|A Chain A, Appbp1-Uba3-Nedd8, An E1-Ubiquitin-Like Protein Complex Length = 529 Back     alignment and structure
>pdb|1YOV|A Chain A, Insights Into The Ubiquitin Transfer Cascade From The Refined Structure Of The Activating Enzyme For Nedd8 Length = 537 Back     alignment and structure
>pdb|3GZN|A Chain A, Structure Of Nedd8-Activating Enzyme In Complex With Nedd8 And Mln4924 Length = 534 Back     alignment and structure
>pdb|3GUC|A Chain A, Human Ubiquitin-Activating Enzyme 5 In Complex With Amppnp Length = 292 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query447
2nvu_B805 Maltose binding protein/NEDD8-activating enzyme E1 1e-179
1tt5_B434 Ubiquitin-activating enzyme E1C isoform 1; cell cy 1e-170
1y8q_B 640 Anthracycline-, ubiquitin-like 2 activating enzyme 1e-86
1y8q_B640 Anthracycline-, ubiquitin-like 2 activating enzyme 5e-38
3cmm_A 1015 Ubiquitin-activating enzyme E1 1; UBA1, protein tu 2e-56
3cmm_A 1015 Ubiquitin-activating enzyme E1 1; UBA1, protein tu 1e-43
3cmm_A1015 Ubiquitin-activating enzyme E1 1; UBA1, protein tu 2e-36
1tt5_A 531 APPBP1, amyloid protein-binding protein 1; cell cy 1e-50
1y8q_A346 Ubiquitin-like 1 activating enzyme E1A; SUMO, hete 3e-40
3h5n_A353 MCCB protein; ubiquitin-activating enzyme, microci 7e-34
3h8v_A292 Ubiquitin-like modifier-activating enzyme 5; rossm 2e-30
1zud_1251 Adenylyltransferase THIF; thiamin, thiazole, prote 4e-28
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 8e-28
3rui_A340 Ubiquitin-like modifier-activating enzyme ATG7; au 3e-27
3vh1_A598 Ubiquitin-like modifier-activating enzyme ATG7; au 4e-26
1y8x_B98 Ubiquitin-activating enzyme E1C; ubiquitin-conjuga 7e-20
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-10
>2nvu_B Maltose binding protein/NEDD8-activating enzyme E1 catalytic subunit chimera; multifunction macromolecular complex, ubiquitin, ATP, conformational change, thioester, switch, adenylation, protein turnover, ligase; HET: ATP; 2.80A {Homo sapiens} SCOP: c.111.1.2 c.94.1.1 Length = 805 Back     alignment and structure
 Score =  521 bits (1342), Expect = e-179
 Identities = 202/435 (46%), Positives = 274/435 (62%), Gaps = 16/435 (3%)

Query: 6   PSRSRDLDKLLLRAGNLVGPTFEPGTELRDDLQEYARILVVGAGGLGCELLKDLALSGFK 65
             R   + K L R+G    P FEP TE    L +  ++LV+GAGGLGCELLK+LALSGF+
Sbjct: 377 EGRWNHVKKFLERSGPFTHPDFEPSTESLQFLLDTCKVLVIGAGGLGCELLKNLALSGFR 436

Query: 66  NLEVIDMDRIEVSNLNRQFLFRMEDVGKPKAEVAAKRVMERVSGVNIVPHFCRIEDKDIS 125
            + VIDMD I+VSNLNRQFLFR +D+G+PKAEVAA+ + +RV   N+VPHF +I+D + +
Sbjct: 437 QIHVIDMDTIDVSNLNRQFLFRPKDIGRPKAEVAAEFLNDRVPNCNVVPHFNKIQDFNDT 496

Query: 126 FYNDFNIIVLGLDSIEARSYINAVACSFLEYETDDKPREETIKPMVDGGTEGFKGHARVI 185
           FY  F+IIV GLDSI AR +IN +  S L YE D      +I P++DGGTEGFKG+ARVI
Sbjct: 497 FYRQFHIIVCGLDSIIARRWINGMLISLLNYE-DGVLDPSSIVPLIDGGTEGFKGNARVI 555

Query: 186 IPGVTPCFECTIWLFPPQVKFPLCTLAETPRTAAHCIEYAHLIKWDEVH---SGKSFDPD 242
           +PG+T C ECT+ L+PPQV FP+CT+A  PR   HCIEY  +++W +      G   D D
Sbjct: 556 LPGMTACIECTLELYPPQVNFPMCTIASMPRLPEHCIEYVRMLQWPKEQPFGEGVPLDGD 615

Query: 243 DPEHMQWVYSEAVKRAELFGIPGVTYSLTQGVVKNIIPAIASTNAIISAACALETLKIAS 302
           DPEH+QW++ ++++RA  + I GVTY LTQGVVK IIPA+ASTNA+I+A CA E  KIA+
Sbjct: 616 DPEHIQWIFQKSLERASQYNIRGVTYRLTQGVVKRIIPAVASTNAVIAAVCATEVFKIAT 675

Query: 303 GCSKTLSNYLTYNGVAGLHIKVTEFVKDKDCLVCGP-GVLIELDTSVTLEKFINLLEEHP 361
                L+NYL +N V GL+    E  + ++C  C      I+   S  L++ ++ L    
Sbjct: 676 SAYIPLNNYLVFNDVDGLYTYTFEAERKENCPACSQLPQNIQFSPSAKLQEVLDYLTNSA 735

Query: 362 KLQLAKASVT----YRGKNLYMQAPPVLEEMTRSNLSLPLYDLMDKVAKDILHVTGVTGQ 417
            LQ+   ++T     + + LY+Q+   +EE TR NLS  L +L   V    L V      
Sbjct: 736 SLQMKSPAITATLEGKNRTLYLQSVTSIEERTRPNLSKTLKEL-GLVDGQELAVA----- 789

Query: 418 SDKKTSCLRKLRVVF 432
            D  T      ++ F
Sbjct: 790 -DVTTPQTVLFKLHF 803
>1tt5_B Ubiquitin-activating enzyme E1C isoform 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbl_B 3dbr_B 3dbh_B 3gzn_B* 1yov_B 1r4m_B 1r4n_B* Length = 434 Back     alignment and structure
>1y8q_B Anthracycline-, ubiquitin-like 2 activating enzyme E1B; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_B* 3kyc_B* 3kyd_B* 2px9_A Length = 640 Back     alignment and structure
>1y8q_B Anthracycline-, ubiquitin-like 2 activating enzyme E1B; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_B* 3kyc_B* 3kyd_B* 2px9_A Length = 640 Back     alignment and structure
>3cmm_A Ubiquitin-activating enzyme E1 1; UBA1, protein turnover, ligase, conformationa thioester, adenylation, transthioesterification, ATP-bindin nucleotide-binding; 2.70A {Saccharomyces cerevisiae} Length = 1015 Back     alignment and structure
>3cmm_A Ubiquitin-activating enzyme E1 1; UBA1, protein turnover, ligase, conformationa thioester, adenylation, transthioesterification, ATP-bindin nucleotide-binding; 2.70A {Saccharomyces cerevisiae} Length = 1015 Back     alignment and structure
>3cmm_A Ubiquitin-activating enzyme E1 1; UBA1, protein turnover, ligase, conformationa thioester, adenylation, transthioesterification, ATP-bindin nucleotide-binding; 2.70A {Saccharomyces cerevisiae} Length = 1015 Back     alignment and structure
>1tt5_A APPBP1, amyloid protein-binding protein 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbh_A 3dbl_A 3dbr_A 1r4m_A 1r4n_A* 2nvu_A* 1yov_A 3gzn_A* Length = 531 Back     alignment and structure
>1y8q_A Ubiquitin-like 1 activating enzyme E1A; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_A* 3kyc_A* 3kyd_A* Length = 346 Back     alignment and structure
>3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Length = 292 Back     alignment and structure
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Length = 251 Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Length = 249 Back     alignment and structure
>3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* Length = 340 Back     alignment and structure
>3vh1_A Ubiquitin-like modifier-activating enzyme ATG7; autophagy, zinc binding, metal binding protein; 3.00A {Saccharomyces cerevisiae} PDB: 3vh2_A Length = 598 Back     alignment and structure
>1y8x_B Ubiquitin-activating enzyme E1C; ubiquitin-conjugating enzyme E2 M, ligase; 2.40A {Homo sapiens} SCOP: c.111.1.2 PDB: 3fn1_A Length = 98 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query447
1tt5_B434 Ubiquitin-activating enzyme E1C isoform 1; cell cy 100.0
2nvu_B805 Maltose binding protein/NEDD8-activating enzyme E1 100.0
1y8q_B640 Anthracycline-, ubiquitin-like 2 activating enzyme 100.0
3cmm_A1015 Ubiquitin-activating enzyme E1 1; UBA1, protein tu 100.0
1y8q_A346 Ubiquitin-like 1 activating enzyme E1A; SUMO, hete 100.0
3h8v_A292 Ubiquitin-like modifier-activating enzyme 5; rossm 100.0
1zud_1251 Adenylyltransferase THIF; thiamin, thiazole, prote 100.0
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 100.0
3h5n_A353 MCCB protein; ubiquitin-activating enzyme, microci 100.0
1tt5_A 531 APPBP1, amyloid protein-binding protein 1; cell cy 100.0
3rui_A340 Ubiquitin-like modifier-activating enzyme ATG7; au 100.0
4gsl_A615 Ubiquitin-like modifier-activating enzyme ATG7; ub 100.0
3cmm_A 1015 Ubiquitin-activating enzyme E1 1; UBA1, protein tu 100.0
3vh1_A598 Ubiquitin-like modifier-activating enzyme ATG7; au 100.0
1y8x_B98 Ubiquitin-activating enzyme E1C; ubiquitin-conjuga 99.73
1z7l_A276 Ubiquitin-activating enzyme E1 1; SCCH, second cat 99.34
3jyo_A283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 97.85
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 97.57
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 97.46
3t4e_A312 Quinate/shikimate dehydrogenase; structural genomi 97.27
3tum_A269 Shikimate dehydrogenase family protein; rossmann-f 97.17
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 96.99
3pwz_A272 Shikimate dehydrogenase 3; alpha-beta, oxidoreduct 96.91
3o8q_A281 Shikimate 5-dehydrogenase I alpha; structural geno 96.9
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 96.9
4ina_A405 Saccharopine dehydrogenase; structural genomics, P 96.87
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 96.81
3abi_A365 Putative uncharacterized protein PH1688; L-lysine 96.8
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 96.76
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 96.49
1lss_A140 TRK system potassium uptake protein TRKA homolog; 96.47
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 96.44
3onh_A127 Ubiquitin-activating enzyme E1-like; ligase, SUMO 96.38
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 96.29
1kyq_A274 Met8P, siroheme biosynthesis protein Met8; homodim 96.24
2z2v_A365 Hypothetical protein PH1688; L-lysine dehydrogenas 96.21
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 96.13
1id1_A153 Putative potassium channel protein; RCK domain, E. 96.13
4ezb_A317 Uncharacterized conserved protein; structural geno 96.1
2ph5_A480 Homospermidine synthase; alpha-beta protein, struc 96.09
3qsg_A312 NAD-binding phosphogluconate dehydrogenase-like P; 96.02
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 96.02
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 95.99
1npy_A271 Hypothetical shikimate 5-dehydrogenase-like protei 95.98
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 95.98
2hk9_A275 Shikimate dehydrogenase; shikimate pathway, drug d 95.98
3rku_A287 Oxidoreductase YMR226C; substrate fingerprint, sho 95.89
1pjq_A457 CYSG, siroheme synthase; rossman fold, nucleotide 95.89
3d1l_A266 Putative NADP oxidoreductase BF3122; structural ge 95.87
3gvi_A324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 95.79
3vku_A326 L-LDH, L-lactate dehydrogenase; rossmann fold, NAD 95.77
3c85_A183 Putative glutathione-regulated potassium-efflux S 95.69
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 95.67
2h78_A302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 95.59
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 95.48
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 95.47
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 95.47
1nvt_A287 Shikimate 5'-dehydrogenase; structural genomics, P 95.45
3ius_A286 Uncharacterized conserved protein; APC63810, silic 95.45
3pqe_A326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 95.4
4g65_A461 TRK system potassium uptake protein TRKA; structur 95.39
2d4a_B308 Malate dehydrogenase; archaea, hyperthermophIle, o 95.36
3t4x_A267 Oxidoreductase, short chain dehydrogenase/reducta; 95.35
3p7m_A321 Malate dehydrogenase; putative dehydrogenase, enzy 95.32
3pef_A287 6-phosphogluconate dehydrogenase, NAD-binding; gam 95.25
3doj_A310 AT3G25530, dehydrogenase-like protein; gamma-hydro 95.2
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 95.18
3ruf_A351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 95.15
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 95.13
2hjr_A328 Malate dehydrogenase; malaria, structural genomics 95.07
3nyw_A250 Putative oxidoreductase; fatty acid synthesis,3-ox 95.05
1ldn_A316 L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA 95.0
1y1p_A342 ARII, aldehyde reductase II; rossmann fold, short 94.98
4id9_A347 Short-chain dehydrogenase/reductase; putative dehy 94.97
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 94.96
3lf2_A265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 94.91
3nzo_A399 UDP-N-acetylglucosamine 4,6-dehydratase; structura 94.9
1xg5_A279 ARPG836; short chain dehydrogenase, human, SGC, st 94.88
2pv7_A298 T-protein [includes: chorismate mutase (EC 5.4.99 94.86
4e21_A358 6-phosphogluconate dehydrogenase (decarboxylating; 94.86
3d0o_A317 L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly 94.82
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 94.8
2dc1_A236 L-aspartate dehydrogenase; NAD, oxidoreductase; HE 94.8
1hyh_A309 L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 94.75
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 94.7
1t2d_A322 LDH-P, L-lactate dehydrogenase; ternary complex, o 94.69
1a5z_A319 L-lactate dehydrogenase; oxidoreductase, glycolysi 94.66
2x0j_A294 Malate dehydrogenase; oxidoreductase, hyperthermop 94.63
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 94.63
3gvx_A290 Glycerate dehydrogenase related protein; NYSGXRC, 94.59
3pdu_A287 3-hydroxyisobutyrate dehydrogenase family protein; 94.58
1oju_A294 MDH, malate dehydrogenase; hyperthermophilic, oxid 94.55
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 94.53
2axq_A467 Saccharopine dehydrogenase; rossmann fold variant, 94.52
2v6b_A304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 94.48
3m2p_A311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 94.48
1bg6_A359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 94.47
3tl2_A315 Malate dehydrogenase; center for structural genomi 94.46
1sby_A254 Alcohol dehydrogenase; ternary complex, NAD, trifl 94.46
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 94.43
3g0o_A303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 94.42
3ioy_A319 Short-chain dehydrogenase/reductase SDR; structura 94.35
2f1k_A279 Prephenate dehydrogenase; tyrosine synthesis, X-RA 94.33
1p9l_A245 Dihydrodipicolinate reductase; oxidoreductase, lys 94.3
2pzm_A330 Putative nucleotide sugar epimerase/ dehydratase; 94.28
3ggo_A314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 94.27
1ez4_A318 Lactate dehydrogenase; rossmann fold, oxidoreducta 94.27
1iy8_A267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 94.25
3qha_A296 Putative oxidoreductase; seattle structural genomi 94.23
4dll_A320 2-hydroxy-3-oxopropionate reductase; structural ge 94.23
3o26_A311 Salutaridine reductase; short chain dehydrogenase/ 94.23
3obb_A300 Probable 3-hydroxyisobutyrate dehydrogenase; struc 94.22
2zqz_A326 L-LDH, L-lactate dehydrogenase; oxidoreductase, ro 94.21
2g5c_A281 Prephenate dehydrogenase; TYRA, oxidoreductase; HE 94.21
1ur5_A309 Malate dehydrogenase; oxidoreductase, tricarboxyli 94.2
2gn4_A344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 94.2
3slg_A372 PBGP3 protein; structural genomics, seattle struct 94.18
2cvz_A289 Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; 94.17
4gbj_A297 6-phosphogluconate dehydrogenase NAD-binding; stru 94.16
4aj2_A331 L-lactate dehydrogenase A chain; oxidoreductase-in 94.16
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 94.14
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 94.09
3don_A277 Shikimate dehydrogenase; alpha-beta structure, ros 94.07
3nep_X314 Malate dehydrogenase; halophIle, molecular adpatat 94.05
3l6d_A306 Putative oxidoreductase; structural genomics, prot 94.04
3fbt_A282 Chorismate mutase and shikimate 5-dehydrogenase fu 94.03
4dgs_A340 Dehydrogenase; structural genomics, PSI-biology, N 94.01
3evt_A324 Phosphoglycerate dehydrogenase; structural genomic 93.99
3gt0_A247 Pyrroline-5-carboxylate reductase; structural geno 93.98
4egb_A346 DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce 93.98
1x7d_A350 Ornithine cyclodeaminase; binds NAD+, binds L-orni 93.97
2x4g_A342 Nucleoside-diphosphate-sugar epimerase; isomerase; 93.95
2zyd_A480 6-phosphogluconate dehydrogenase, decarboxylating; 93.95
3tri_A280 Pyrroline-5-carboxylate reductase; amino acid bios 93.94
3c24_A286 Putative oxidoreductase; YP_511008.1, structural g 93.9
1vl6_A388 Malate oxidoreductase; TM0542, NAD-dependent malic 93.89
1sb8_A352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 93.84
1xu9_A286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 93.84
2rcy_A262 Pyrroline carboxylate reductase; malaria, structur 93.83
2z1n_A260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 93.82
3ldh_A330 Lactate dehydrogenase; oxidoreductase, CHOH donor, 93.81
3u62_A253 Shikimate dehydrogenase; shikimate pathway, oxidor 93.8
2q1s_A377 Putative nucleotide sugar epimerase/ dehydratase; 93.78
2i99_A312 MU-crystallin homolog; thyroid hormine binding pro 93.75
2xxj_A310 L-LDH, L-lactate dehydrogenase; oxidoreductase, hy 93.67
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 93.67
3i1j_A247 Oxidoreductase, short chain dehydrogenase/reducta; 93.65
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 93.58
3l9w_A413 Glutathione-regulated potassium-efflux system Pro 93.56
3sju_A279 Keto reductase; short-chain dehydrogenase, oxidore 93.47
3ko8_A312 NAD-dependent epimerase/dehydratase; isomerase, UD 93.45
3pk0_A262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 93.45
3svt_A281 Short-chain type dehydrogenase/reductase; ssgcid, 93.43
2c5a_A379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 93.41
3l77_A235 Short-chain alcohol dehydrogenase; oxidoreductase; 93.34
2a9f_A398 Putative malic enzyme ((S)-malate:NAD+ oxidoreduct 93.33
3sxp_A362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 93.32
1y6j_A318 L-lactate dehydrogenase; southeast collaboratory f 93.27
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 93.25
3vps_A321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 93.23
3i6i_A346 Putative leucoanthocyanidin reductase 1; rossmann 93.23
3qlj_A322 Short chain dehydrogenase; structural genomics, se 93.22
2p4q_A497 6-phosphogluconate dehydrogenase, decarboxylating; 93.19
2ae2_A260 Protein (tropinone reductase-II); oxidoreductase, 93.19
2iz1_A474 6-phosphogluconate dehydrogenase, decarboxylating; 93.13
3k96_A356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 93.09
3e48_A289 Putative nucleoside-diphosphate-sugar epimerase; a 93.05
3gaf_A256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 93.04
3enk_A341 UDP-glucose 4-epimerase; seattle structural genomi 93.02
3pxx_A287 Carveol dehydrogenase; structural genomics, seattl 93.01
4gwg_A484 6-phosphogluconate dehydrogenase, decarboxylating; 92.97
3ijr_A291 Oxidoreductase, short chain dehydrogenase/reducta; 92.96
3hdj_A313 Probable ornithine cyclodeaminase; APC62486, borde 92.94
2zat_A260 Dehydrogenase/reductase SDR family member 4; alpha 92.93
1wma_A276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 92.92
3afn_B258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 92.85
4hb9_A412 Similarities with probable monooxygenase; flavin, 92.82
2gf2_A296 Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct 92.8
3dtt_A245 NADP oxidoreductase; structural genomics, joint ce 92.8
1omo_A322 Alanine dehydrogenase; two-domain, beta-sandwich-d 92.78
4fc7_A277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 92.76
1i36_A264 Conserved hypothetical protein MTH1747; NADP bindi 92.76
2jah_A247 Clavulanic acid dehydrogenase; short-chain dehydro 92.73
2gdz_A267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 92.72
1gpj_A404 Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro 92.7
1yxm_A303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 92.69
3s55_A281 Putative short-chain dehydrogenase/reductase; stru 92.69
1ff9_A450 Saccharopine reductase; lysine biosynthesis, alpha 92.68
3tjr_A301 Short chain dehydrogenase; structural genomics, se 92.66
2ewd_A317 Lactate dehydrogenase,; protein-substrate_cofactor 92.65
1lld_A319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 92.61
3b1f_A290 Putative prephenate dehydrogenase; enzyme, 4-hydro 92.6
2aef_A234 Calcium-gated potassium channel MTHK; rossmann fol 92.6
3ai3_A263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 92.6
3rft_A267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 92.57
3rwb_A247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 92.57
1fmc_A255 7 alpha-hydroxysteroid dehydrogenase; short-chain 92.56
2r00_A336 Aspartate-semialdehyde dehydrogenase; conformation 92.54
3uve_A286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 92.53
4dqv_A478 Probable peptide synthetase NRP (peptide synthase; 92.51
3tfo_A264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 92.51
3sc4_A285 Short chain dehydrogenase (A0QTM2 homolog); ssgcid 92.5
2dvm_A439 Malic enzyme, 439AA long hypothetical malate oxido 92.45
2ywl_A180 Thioredoxin reductase related protein; uncharacter 92.44
1gee_A261 Glucose 1-dehydrogenase; short-chain dehydrogenase 92.42
3ucx_A264 Short chain dehydrogenase; ssgcid, seattle structu 92.41
3pgx_A280 Carveol dehydrogenase; structural genomics, seattl 92.39
3qy9_A243 DHPR, dihydrodipicolinate reductase; rossmann fold 92.39
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 92.38
3awd_A260 GOX2181, putative polyol dehydrogenase; oxidoreduc 92.34
1ja9_A274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 92.33
4iin_A271 3-ketoacyl-acyl carrier protein reductase (FABG); 92.32
1oaa_A259 Sepiapterin reductase; tetrahydrobiopterin, oxidor 92.32
3ftp_A270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 92.31
4imr_A275 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor 92.28
2d5c_A263 AROE, shikimate 5-dehydrogenase; substrate, dimer, 92.28
3rih_A293 Short chain dehydrogenase or reductase; structural 92.27
4e6p_A259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 92.25
2pd6_A264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 92.2
1yb4_A295 Tartronic semialdehyde reductase; structural genom 92.18
3oh8_A516 Nucleoside-diphosphate sugar epimerase (SULA FAMI; 92.18
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 92.18
1o6z_A303 MDH, malate dehydrogenase; halophilic, ION-binding 92.17
1ek6_A348 UDP-galactose 4-epimerase; short-chain dehydrogena 92.15
4fs3_A256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 92.13
1spx_A278 Short-chain reductase family member (5L265); paral 92.11
4eso_A255 Putative oxidoreductase; NADP, structural genomics 92.08
3ehe_A313 UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, 92.08
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 92.07
3v2h_A281 D-beta-hydroxybutyrate dehydrogenase; structural g 92.07
3tox_A280 Short chain dehydrogenase; structural genomics, PS 92.06
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 92.02
1zem_A262 Xylitol dehydrogenase; rossmann fold, dinucleotide 92.0
2q1w_A333 Putative nucleotide sugar epimerase/ dehydratase; 92.0
1f0y_A302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 91.97
3gg2_A450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 91.96
4iiu_A267 3-oxoacyl-[acyl-carrier protein] reductase; struct 91.93
1xq1_A266 Putative tropinone reducatse; structural genomics, 91.9
3pwk_A366 Aspartate-semialdehyde dehydrogenase; NADP binding 91.89
4da9_A280 Short-chain dehydrogenase/reductase; structural ge 91.89
3tsc_A277 Putative oxidoreductase; structural genomics, seat 91.89
1ks9_A291 KPA reductase;, 2-dehydropantoate 2-reductase; PAN 91.85
4huj_A220 Uncharacterized protein; PSI-biology, nysgrc, stru 91.82
2pgd_A482 6-phosphogluconate dehydrogenase; oxidoreductase ( 91.79
2b69_A343 UDP-glucuronate decarboxylase 1; UDP-glucoronic ac 91.78
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 91.77
3v2g_A271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 91.75
3i83_A320 2-dehydropantoate 2-reductase; structural genomics 91.73
3hhp_A312 Malate dehydrogenase; MDH, citric acid cycle, TCA 91.72
2jl1_A287 Triphenylmethane reductase; oxidoreductase, biorem 91.71
2rir_A300 Dipicolinate synthase, A chain; structural genomic 91.7
1yb1_A272 17-beta-hydroxysteroid dehydrogenase type XI; shor 91.68
2bd0_A244 Sepiapterin reductase; oxidoreductase; HET: NAP BI 91.68
2bgk_A278 Rhizome secoisolariciresinol dehydrogenase; oxidor 91.68
1mxh_A276 Pteridine reductase 2; SDR topology, protein-subst 91.63
4egf_A266 L-xylulose reductase; structural genomics, ssgcid, 91.61
4ibo_A271 Gluconate dehydrogenase; enzyme function initiativ 91.56
3rd5_A291 Mypaa.01249.C; ssgcid, structural genomics, seattl 91.54
1w6u_A302 2,4-dienoyl-COA reductase, mitochondrial precursor 91.53
1pzg_A331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 91.51
3sx2_A278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 91.51
3ksu_A262 3-oxoacyl-acyl carrier protein reductase; structur 91.51
2ew2_A316 2-dehydropantoate 2-reductase, putative; alpha-str 91.47
2pnf_A248 3-oxoacyl-[acyl-carrier-protein] reductase; short 91.45
1orr_A347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 91.42
3ghy_A335 Ketopantoate reductase protein; oxidoreductase, NA 91.37
2wyu_A261 Enoyl-[acyl carrier protein] reductase; oxidoreduc 91.31
1vl8_A267 Gluconate 5-dehydrogenase; TM0441, structural geno 91.28
3osu_A246 3-oxoacyl-[acyl-carrier-protein] reductase; struct 91.18
3imf_A257 Short chain dehydrogenase; structural genomics, in 91.16
2p91_A285 Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD 91.16
3g17_A294 Similar to 2-dehydropantoate 2-reductase; structur 91.15
2qq5_A260 DHRS1, dehydrogenase/reductase SDR family member 1 91.09
3v8b_A283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 91.06
3hn2_A312 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str 91.02
3n74_A261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 91.02
1qyd_A313 Pinoresinol-lariciresinol reductase; NADPH-depende 91.02
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 91.0
2rhc_B277 Actinorhodin polyketide ketoreductase; oxidoreduct 90.99
1n2s_A299 DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold 90.92
3oig_A266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 90.92
4fgw_A391 Glycerol-3-phosphate dehydrogenase [NAD(+)] 1; oxi 90.87
3grp_A266 3-oxoacyl-(acyl carrierprotein) reductase; structu 90.86
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 90.86
1c0p_A363 D-amino acid oxidase; alpha-beta-alpha motif, flav 90.83
3l6e_A235 Oxidoreductase, short-chain dehydrogenase/reducta; 90.83
4dry_A281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 90.82
2zcu_A286 Uncharacterized oxidoreductase YTFG; alpha-beta sa 90.8
3fpc_A352 NADP-dependent alcohol dehydrogenase; oxydoreducta 90.8
3ak4_A263 NADH-dependent quinuclidinone reductase; SDR, (R)- 90.78
3dje_A438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 90.77
2cul_A232 Glucose-inhibited division protein A-related PROT 90.75
1xkq_A280 Short-chain reductase family member (5D234); parra 90.75
3tz6_A344 Aspartate-semialdehyde dehydrogenase; asadh, ASD, 90.74
1edo_A244 Beta-keto acyl carrier protein reductase; nucleoti 90.74
3kvo_A346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 90.71
4a7p_A446 UDP-glucose dehydrogenase; oxidoreductase, carbohy 90.66
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 90.58
2hun_A336 336AA long hypothetical DTDP-glucose 4,6-dehydrat; 90.58
3ip1_A404 Alcohol dehydrogenase, zinc-containing; structural 90.57
1yqg_A263 Pyrroline-5-carboxylate reductase; structural geno 90.54
2x9g_A288 PTR1, pteridine reductase; short chain dehydrogena 90.5
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 90.49
3f1l_A252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 90.47
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 90.47
3gvc_A277 Oxidoreductase, probable short-chain type dehydrog 90.44
1nff_A260 Putative oxidoreductase RV2002; directed evolution 90.4
2d8a_A348 PH0655, probable L-threonine 3-dehydrogenase; pyro 90.39
1ae1_A273 Tropinone reductase-I; oxidoreductase, tropane alk 90.39
3u9l_A324 3-oxoacyl-[acyl-carrier-protein] reductase; struct 90.39
3t7c_A299 Carveol dehydrogenase; structural genomics, seattl 90.38
3rp8_A407 Flavoprotein monooxygenase; FAD-binding protein, o 90.31
3rc1_A350 Sugar 3-ketoreductase; sugar biosynthesis, TDP bin 90.3
3ijp_A288 DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, 90.27
2c20_A330 UDP-glucose 4-epimerase; carbohydrate metabolism, 90.22
3uf0_A273 Short-chain dehydrogenase/reductase SDR; gluconate 90.21
3c7a_A404 Octopine dehydrogenase; L) stereospecific opine de 90.15
4fgs_A273 Probable dehydrogenase protein; PSI-biology, nysgr 90.14
1np3_A338 Ketol-acid reductoisomerase; A DEEP figure-OF-eigh 90.14
2hq1_A247 Glucose/ribitol dehydrogenase; CTH-1438, structura 90.13
3uko_A378 Alcohol dehydrogenase class-3; alcohol dehydrogena 90.12
1qsg_A265 Enoyl-[acyl-carrier-protein] reductase; enoyl redu 90.11
4f6c_A427 AUSA reductase domain protein; thioester reductase 90.11
2hrz_A342 AGR_C_4963P, nucleoside-diphosphate-sugar epimeras 90.1
2cfc_A250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 90.09
2q2v_A255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 90.09
4dyv_A272 Short-chain dehydrogenase/reductase SDR; structura 90.09
3ek2_A271 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 90.08
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 90.08
3sc6_A287 DTDP-4-dehydrorhamnose reductase; RFBD, structural 90.07
3st7_A369 Capsular polysaccharide synthesis enzyme CAP5F; ro 90.05
2b4q_A276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 90.03
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 90.03
3oec_A317 Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; 90.02
3ego_A307 Probable 2-dehydropantoate 2-reductase; structural 90.0
3r3s_A294 Oxidoreductase; structural genomics, csgid, center 90.0
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 89.97
1hye_A313 L-lactate/malate dehydrogenase; nucleotide binding 89.95
1f8f_A371 Benzyl alcohol dehydrogenase; rossmann fold, oxido 89.93
1pl8_A356 Human sorbitol dehydrogenase; NAD, oxidoreductase; 89.91
3un1_A260 Probable oxidoreductase; structural genomics, PSI- 89.86
3ado_A319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 89.86
3grk_A293 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 89.85
1zk4_A251 R-specific alcohol dehydrogenase; short chain redu 89.84
3c96_A410 Flavin-containing monooxygenase; FAD, oxidoreducta 89.84
3is3_A270 17BETA-hydroxysteroid dehydrogenase; short chain d 89.82
2ep5_A350 350AA long hypothetical aspartate-semialdehyde deh 89.81
2uvd_A246 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k 89.78
1r6d_A337 TDP-glucose-4,6-dehydratase; rossmann fold, short- 89.77
3edm_A259 Short chain dehydrogenase; structural genomics, ox 89.77
1sny_A267 Sniffer CG10964-PA; alpha and beta protein, rossma 89.76
2bll_A345 Protein YFBG; decarboxylase, short chain dehydroge 89.75
3uuw_A308 Putative oxidoreductase with NAD(P)-binding rossm 89.74
3fi9_A343 Malate dehydrogenase; structural genomics, oxidore 89.73
3e03_A274 Short chain dehydrogenase; structural genomics, PS 89.73
4ej6_A370 Putative zinc-binding dehydrogenase; structural ge 89.68
1dih_A273 Dihydrodipicolinate reductase; oxidoreductase; HET 89.68
3ppi_A281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 89.63
4dmm_A269 3-oxoacyl-[acyl-carrier-protein] reductase; rossma 89.61
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 89.58
1y56_B382 Sarcosine oxidase; dehydrogenase, protein-protein 89.54
3c1o_A321 Eugenol synthase; phenylpropene, PIP reductase, sh 89.54
3ond_A488 Adenosylhomocysteinase; plant protein, enzyme-subs 89.53
2dpo_A319 L-gulonate 3-dehydrogenase; structural genomics, N 89.51
3oz2_A397 Digeranylgeranylglycerophospholipid reductase; str 89.45
2glx_A332 1,5-anhydro-D-fructose reductase; NADP(H) dependen 89.44
2c07_A285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 89.43
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 89.42
1zej_A293 HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural 89.42
2gf3_A389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 89.41
3db2_A354 Putative NADPH-dependent oxidoreductase; two domai 89.38
3tzq_B271 Short-chain type dehydrogenase/reductase; ssgcid, 89.37
3f9i_A249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 89.35
2z5l_A511 Tylkr1, tylactone synthase starter module and modu 89.28
3lk7_A451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 89.27
3cky_A301 2-hydroxymethyl glutarate dehydrogenase; rossmann 89.26
2uzz_A372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 89.24
3u5t_A267 3-oxoacyl-[acyl-carrier-protein] reductase; struct 89.2
1z82_A335 Glycerol-3-phosphate dehydrogenase; TM0378, struct 89.13
3op4_A248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 89.11
2xdo_A398 TETX2 protein; tetracycline degradation, tigecycli 89.1
2ekl_A313 D-3-phosphoglycerate dehydrogenase; structural gen 89.1
2nwq_A272 Probable short-chain dehydrogenase; oxidoreductase 89.07
1z7e_A660 Protein aRNA; rossmann fold, OB-like fold, hydrola 89.03
3i4f_A264 3-oxoacyl-[acyl-carrier protein] reductase; struct 89.0
4dqx_A277 Probable oxidoreductase protein; structural genomi 89.0
3cxt_A291 Dehydrogenase with different specificities; rossma 88.97
3ay3_A267 NAD-dependent epimerase/dehydratase; glucuronic ac 88.95
1geg_A256 Acetoin reductase; SDR family, oxidoreductase; HET 88.94
4a2c_A346 Galactitol-1-phosphate 5-dehydrogenase; oxidoreduc 88.92
1oc2_A348 DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos 88.88
3oid_A258 Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa 88.82
3ezl_A256 Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA 88.79
1wwk_A307 Phosphoglycerate dehydrogenase; riken structural g 88.79
1txg_A335 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid 88.76
2izz_A322 Pyrroline-5-carboxylate reductase 1; amino-acid bi 88.75
3dme_A369 Conserved exported protein; structural genomics, P 88.7
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 88.68
2d0i_A333 Dehydrogenase; structural genomics, NPPSFA, nation 88.67
1dxy_A333 D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxyc 88.66
4g81_D255 Putative hexonate dehydrogenase; enzyme function i 88.62
3eag_A326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME 88.61
1xhl_A297 Short-chain dehydrogenase/reductase family member 88.57
1j4a_A333 D-LDH, D-lactate dehydrogenase; NAD-dependent dehy 88.53
3alj_A379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 88.53
3hwr_A318 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A 88.52
2uyy_A316 N-PAC protein; long-chain dehydrogenase, cytokine; 88.52
3nv9_A487 Malic enzyme; rossmann fold, oxidoreductase; 2.25A 88.51
1xdw_A331 NAD+-dependent (R)-2-hydroxyglutarate dehydrogenas 88.5
2vou_A397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 88.49
1f06_A320 MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH 88.45
2dbq_A334 Glyoxylate reductase; D-3-phosphoglycerate dehydro 88.44
3ihm_A430 Styrene monooxygenase A; rossman fold, anti-parall 88.44
1gy8_A397 UDP-galactose 4-epimerase; oxidoreductase; HET: NA 88.39
2fr1_A486 Erythromycin synthase, eryai; short chain dehydrog 88.39
1e6u_A321 GDP-fucose synthetase; epimerase/reductase, SDR, R 88.38
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 88.37
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 88.37
3euw_A344 MYO-inositol dehydrogenase; protein structure init 88.31
2dph_A398 Formaldehyde dismutase; dismutation of aldehydes, 88.31
3guy_A230 Short-chain dehydrogenase/reductase SDR; structura 88.31
2qhx_A328 Pteridine reductase 1; oxidoreductase, short-chain 88.27
1k0i_A394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 88.23
1leh_A364 Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi 88.19
2gcg_A330 Glyoxylate reductase/hydroxypyruvate reductase; NA 88.17
1x13_A401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 88.16
2dtx_A264 Glucose 1-dehydrogenase related protein; rossmann 88.11
1z7l_A276 Ubiquitin-activating enzyme E1 1; SCCH, second cat 88.05
2j6i_A364 Formate dehydrogenase; oxidoreductase, D-specific- 88.05
3q2i_A354 Dehydrogenase; rossmann fold, UDP-sugar binding, N 88.05
1a4i_A301 Methylenetetrahydrofolate dehydrogenase / methenyl 88.04
3nix_A421 Flavoprotein/dehydrogenase; structural genomics, P 88.03
3a28_C258 L-2.3-butanediol dehydrogenase; chiral substrate r 88.03
3ctm_A279 Carbonyl reductase; alcohol dehydrogenase, short-c 88.03
1e3j_A352 NADP(H)-dependent ketose reductase; oxidoreductase 87.98
1g0o_A283 Trihydroxynaphthalene reductase; protein-NADPH-act 87.97
3vrd_B401 FCCB subunit, flavocytochrome C flavin subunit; su 87.92
2h7i_A269 Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi 87.91
2cuk_A311 Glycerate dehydrogenase/glyoxylate reductase; stru 87.89
3m6i_A363 L-arabinitol 4-dehydrogenase; medium chain dehydro 87.87
4e3z_A272 Putative oxidoreductase protein; PSI-biology, stru 87.85
2ejw_A332 HDH, homoserine dehydrogenase; NAD-dependent, oxid 87.85
2oln_A397 NIKD protein; flavoprotein, rossmann fold, oxidore 87.84
3icc_A255 Putative 3-oxoacyl-(acyl carrier protein) reducta; 87.84
7mdh_A375 Protein (malate dehydrogenase); chloroplastic mala 87.83
3tpc_A257 Short chain alcohol dehydrogenase-related dehydro; 87.81
1rjw_A339 ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD 87.8
2aqj_A 538 Tryptophan halogenase, pRNA; flavin-dependent halo 87.8
3pp8_A315 Glyoxylate/hydroxypyruvate reductase A; structural 87.79
4gx0_A565 TRKA domain protein; membrane protein, ION channel 87.78
1vpd_A299 Tartronate semialdehyde reductase; structural geno 87.71
3vtz_A269 Glucose 1-dehydrogenase; rossmann fold, oxidoreduc 87.69
3mje_A496 AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1. 87.66
1uay_A242 Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid 87.58
3gk3_A269 Acetoacetyl-COA reductase; acetoacetyl-CO reductas 87.56
3hg7_A324 D-isomer specific 2-hydroxyacid dehydrogenase FAM 87.51
3e9m_A330 Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, 87.37
1zcj_A463 Peroxisomal bifunctional enzyme; peroxisomal multi 87.36
1evy_A366 Glycerol-3-phosphate dehydrogenase; rossmann fold, 87.34
2hjs_A340 USG-1 protein homolog; aspartate-semialdehyde dehy 87.32
2c2x_A281 Methylenetetrahydrofolate dehydrogenase- methenylt 87.31
3ba1_A333 HPPR, hydroxyphenylpyruvate reductase; two domain 87.29
2o7s_A523 DHQ-SDH PR, bifunctional 3-dehydroquinate dehydrat 87.26
1gdh_A320 D-glycerate dehydrogenase; oxidoreductase(CHOH (D) 87.26
1h5q_A265 NADP-dependent mannitol dehydrogenase; oxidoreduct 87.26
3ajr_A317 NDP-sugar epimerase; L-threonine dehydrogenase, L- 87.25
3s2e_A340 Zinc-containing alcohol dehydrogenase superfamily; 87.22
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 87.15
2x3n_A399 Probable FAD-dependent monooxygenase; oxidoreducta 87.11
2g76_A335 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor 87.08
4hkt_A331 Inositol 2-dehydrogenase; structural genomics, nys 87.04
1x0v_A354 GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase 87.03
3i3l_A 591 Alkylhalidase CMLS; flavin-dependent halogenase, c 87.01
3adn_A294 Spermidine synthase; aminopropyltransferase, polya 86.98
2pi1_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 86.97
2y0c_A478 BCEC, UDP-glucose dehydrogenase; oxidoreductase, c 86.94
2ahr_A259 Putative pyrroline carboxylate reductase; pyrrolin 86.94
3r9u_A315 Thioredoxin reductase; structural genomics, center 86.93
1guz_A310 Malate dehydrogenase; oxidoreductase, tricarboxyli 86.91
3ktd_A341 Prephenate dehydrogenase; structural genomics, joi 86.85
3gdg_A267 Probable NADP-dependent mannitol dehydrogenase; ro 86.83
2e4g_A 550 Tryptophan halogenase; flavin-binding, rebeccamyci 86.83
3dr3_A337 N-acetyl-gamma-glutamyl-phosphate reductase; csgid 86.81
3evn_A329 Oxidoreductase, GFO/IDH/MOCA family; structural ge 86.79
2rh8_A338 Anthocyanidin reductase; flavonoids, rossmann fold 86.75
3k6j_A460 Protein F01G10.3, confirmed by transcript evidenc; 86.69
1mx3_A347 CTBP1, C-terminal binding protein 1; nuclear prote 86.66
1qp8_A303 Formate dehydrogenase; oxidoreductase; HET: NDP; 2 86.65
3gg9_A352 D-3-phosphoglycerate dehydrogenase oxidoreductase; 86.65
4dpk_A359 Malonyl-COA/succinyl-COA reductase; dinucleotide b 86.64
4dpl_A359 Malonyl-COA/succinyl-COA reductase; dinucleotide b 86.64
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 86.63
2nm0_A253 Probable 3-oxacyl-(acyl-carrier-protein) reductas; 86.61
1yo6_A250 Putative carbonyl reductase sniffer; tyrosine-depe 86.58
2w2k_A348 D-mandelate dehydrogenase; 2-hydroxyacid dehydroge 86.57
3qp9_A525 Type I polyketide synthase pikaii; rossmann fold, 86.51
1pj5_A 830 N,N-dimethylglycine oxidase; channelling, FAD bind 86.47
1l7d_A384 Nicotinamide nucleotide transhydrogenase, subunit 86.46
2yq5_A343 D-isomer specific 2-hydroxyacid dehydrogenase; oxi 86.46
1rkx_A357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 86.44
>1tt5_B Ubiquitin-activating enzyme E1C isoform 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbl_B 3dbr_B 3dbh_B 3gzn_B* 1yov_B 1r4m_B 1r4n_B* Back     alignment and structure
Probab=100.00  E-value=2e-88  Score=701.70  Aligned_cols=423  Identities=47%  Similarity=0.808  Sum_probs=386.6

Q ss_pred             CCCCCCCccchhHHhhccCCCCCCCCccCCHHHHHHH-hcCCeEEEEcCchHHHHHHHHHHHhCCCeEEEEeCCccCccc
Q 013224            1 MADTAPSRSRDLDKLLLRAGNLVGPTFEPGTELRDDL-QEYARILVVGAGGLGCELLKDLALSGFKNLEVIDMDRIEVSN   79 (447)
Q Consensus         1 ~~~~~~~~~~~~~~~l~~~~~~~r~~~~~G~~~q~~L-~~~~~VlvvG~GglG~eiak~La~~Gvg~i~lvD~D~Ve~sN   79 (447)
                      |-.+..+||..+++++.+.++|....|.+|.+.++++ + ++||+|||+||+||+++++|+++|||+|+|+|+|+|+.||
T Consensus         1 ~~~~~~~r~~~vntl~~~~g~~~g~gf~~g~e~~~~~L~-~~~VlvvG~GGlGs~va~~La~aGvg~i~ivD~D~Ve~sN   79 (434)
T 1tt5_B            1 MKLDWEGRWNHVKKFLERSGPFTHPDFEPSTESLQFLLD-TCKVLVIGAGGLGCELLKNLALSGFRQIHVIDMDTIDVSN   79 (434)
T ss_dssp             CCSSCTTTTHHHHHHHHSCCSSCCTTCCCCSSHHHHHHH-TCCEEEECSSTHHHHHHHHHHHTTCCCEEEEECCBCCGGG
T ss_pred             CccchhhhhccceEEEcCCCcccccccccCHHHHHHHhc-CCEEEEECcCHHHHHHHHHHHHcCCCEEEEEcCCEechhc
Confidence            6778999999999999999999999999999998765 8 9999999999999999999999999999999999999999


Q ss_pred             CccccCCCCCCCCChHHHHHHHHHHhhCCceEEEEEeccCccchhhccCCceEEEcccCCHHHHHHHHHHHHhhccccCC
Q 013224           80 LNRQFLFRMEDVGKPKAEVAAKRVMERVSGVNIVPHFCRIEDKDISFYNDFNIIVLGLDSIEARSYINAVACSFLEYETD  159 (447)
Q Consensus        80 L~RqfLf~~~diG~~Ka~~a~~~l~~~np~v~i~~~~~~i~~~~~~~~~~~DvVi~~~Dn~~~r~~in~~~~~l~~~~~~  159 (447)
                      |+|||||+++|||++||++++++++++||+++|+++..++.+.+.++++++|+||+|+||+++|++||++|+.+.++.+ 
T Consensus        80 L~RQ~l~~~~diG~~Ka~~a~~~l~~lnp~v~v~~~~~~i~~~~~~~~~~~DlVi~~~Dn~~~R~~in~~c~~~~~~~~-  158 (434)
T 1tt5_B           80 LNRQFLFRPKDIGRPKAEVAAEFLNDRVPNCNVVPHFNKIQDFNDTFYRQFHIIVCGLDSIIARRWINGMLISLLNYED-  158 (434)
T ss_dssp             TTTCTTCCGGGTTSBHHHHHHHHHHHHSTTCCCEEEESCGGGBCHHHHTTCSEEEECCSCHHHHHHHHHHHHHTCCBSS-
T ss_pred             cCCCcCCChhHcCcHHHHHHHHHHHhhCCCCEEEEEecccchhhHHHhcCCCEEEECCCCHHHHHHHHHHHHHhhhccc-
Confidence            9999999999999999999999999999999999999999887789999999999999999999999999987665543 


Q ss_pred             CcccccCCCcEEEeeeccccceEEEEeCCCCCccccccCCCCCCCCCCcccccCCcCChhhHHHHHHhhhhhhccCCC--
Q 013224          160 DKPREETIKPMVDGGTEGFKGHARVIIPGVTPCFECTIWLFPPQVKFPLCTLAETPRTAAHCIEYAHLIKWDEVHSGK--  237 (447)
Q Consensus       160 ~~~~~~~~~pli~~g~~g~~G~v~~~~p~~t~c~~C~~~~~p~~~~~p~ct~~~~p~~~~hci~~a~~~~~~~~~~~~--  237 (447)
                      |.+++.+++|+|++|+.|+.|+++++.|+.++||+|.++..|++..+|.|+++++|+.|+|||+||+.+.|+..++..  
T Consensus       159 g~~~~~~~iPli~~~~~g~~G~v~v~~p~~t~Cy~C~~~~~p~~~~~p~Ct~~~~p~~~~h~i~~a~~i~~~~~~~~~~~  238 (434)
T 1tt5_B          159 GVLDPSSIVPLIDGGTEGFKGNARVILPGMTACIECTLELYPPQVNFPMCTIASMPRLPEHCIEYVRMLQWPKEQPFGEG  238 (434)
T ss_dssp             SCBCGGGCCCEEEEEEETTEEEEEEECTTTSCCGGGGGGGSCCCCCCCHHHHHHCCCSHHHHHHHHHHTHHHHSCTTCTT
T ss_pred             cccccccCCcEEEeccccceeEEEEECCCCCCCcccccCCCCCcCCCcccccccCCcchhHHHHHHHHHHHhhhcccccc
Confidence            677777899999999999999999999999999999998888889999999999999999999999999999887654  


Q ss_pred             -CCCCCChhHHHHHHHHHHHHHHHhCCCCCccccccccccccccccccHHHHHHHHHHHHHHHHHhCCCCCCcceEEEEc
Q 013224          238 -SFDPDDPEHMQWVYSEAVKRAELFGIPGVTYSLTQGVVKNIIPAIASTNAIISAACALETLKIASGCSKTLSNYLTYNG  316 (447)
Q Consensus       238 -~~d~dd~~~l~~i~~~a~~ra~~~~I~~~~~~~~~gv~~~iiPaia~t~Aivagl~a~EalK~ltg~~~~l~n~~~~~~  316 (447)
                       .||+|+++|++|+++.+++||..|||.+++++.++|++++|+|+|+||+|||||++|+|++|+|+|..++++|+++|++
T Consensus       239 ~~~d~d~~~~~~~v~~~a~~~~~~~gi~~~~~~~~~gv~~~iipaia~t~aiig~l~a~EaiK~l~g~~~~l~~~l~~d~  318 (434)
T 1tt5_B          239 VPLDGDDPEHIQWIFQKSLERASQYNIRGVTYRLTQGVVKRIIPAVASTNAVIAAVCATEVFKIATSAYIPLNNYLVFND  318 (434)
T ss_dssp             CCCCTTCHHHHHHHHHHHHHHHHHTTCCCCCHHHHHHHHTTCCCCCHHHHHHHHHHHHHHHHHHHHTCSCCCCSEEEEEC
T ss_pred             cccCCCcHHHHHHHHHHHHHHHHHcCCCccCHHHHHhHhhccCcccccHHHHHHHHHHHHHHHHHhCCCcccCceEEEEc
Confidence             8999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCeeEeEeeeecCCCCccCCC-ceeEecCCCCCHHHHHHHHhcCCCcceeeceeee----cccEEEecCCCChhhhhcc
Q 013224          317 VAGLHIKVTEFVKDKDCLVCGP-GVLIELDTSVTLEKFINLLEEHPKLQLAKASVTY----RGKNLYMQAPPVLEEMTRS  391 (447)
Q Consensus       317 ~~~~~~~~~~~~~~p~C~vC~~-~~~~~~~~~~tl~~l~~~l~~~~~~~~~~~~i~~----~~~~ly~~~~~~l~~~~~~  391 (447)
                      ..+.+..++.++++|+|++|+. |..+.+++++||++|++.|+++++++++.|+|++    ++++||++++|++++++++
T Consensus       319 ~~~~~~~~~~~~~~~~C~vC~~~~~~~~~~~~~tl~~~~~~l~~~~~~~~~~~~is~~~~~~~~~ly~~~~~~~~~~~~~  398 (434)
T 1tt5_B          319 VDGLYTYTFEAERKENCPACSQLPQNIQFSPSAKLQEVLDYLTNSASLQMKSPAITATLEGKNRTLYLQSVTSIEERTRP  398 (434)
T ss_dssp             SBSCEEEEECCCCCTTCTTTCSSCBCCCC-----CTTHHHHHHHCSSCCCSSCCCEET----TEECCCCCCTTTTTTSCC
T ss_pred             CCCceeEEEeccCCCCCCccCCCCceEEECCCccHHHHHHHHhccCccceEccEEEEEccCCCcEEEecCCcchhhhhHh
Confidence            9988777888999999999998 8888898889999999999998899999999988    5789999999999999999


Q ss_pred             ccCCchHHh-hcccccceeeeccccccccCCcceeEEEEEEEe
Q 013224          392 NLSLPLYDL-MDKVAKDILHVTGVTGQSDKKTSCLRKLRVVFR  433 (447)
Q Consensus       392 ~L~k~l~el-~~~g~~~~~~~~~~~~v~d~~~~~~~~~~~~~~  433 (447)
                      ||+|+|+|| +.+|  ++|      .|+|+..+.+++++|+|+
T Consensus       399 ~l~~~l~~l~~~~g--~~~------~v~d~~~~~~~~~~~~~~  433 (434)
T 1tt5_B          399 NLSKTLKELGLVDG--QEL------AVADVTTPQTVLFKLHFT  433 (434)
T ss_dssp             -CCC-----CCCSS--CCE------ECCCTTCSSCCEEC----
T ss_pred             hhcCCHHHcCCCCC--CEE------EEECCCCcccEEEEEEec
Confidence            999999999 9999  899      999999999999999997
>2nvu_B Maltose binding protein/NEDD8-activating enzyme E1 catalytic subunit chimera; multifunction macromolecular complex, ubiquitin, ATP, conformational change, thioester, switch, adenylation, protein turnover, ligase; HET: ATP; 2.80A {Homo sapiens} SCOP: c.111.1.2 c.94.1.1 Back     alignment and structure
>1y8q_B Anthracycline-, ubiquitin-like 2 activating enzyme E1B; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_B* 3kyc_B* 3kyd_B* 2px9_A Back     alignment and structure
>3cmm_A Ubiquitin-activating enzyme E1 1; UBA1, protein turnover, ligase, conformationa thioester, adenylation, transthioesterification, ATP-bindin nucleotide-binding; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1y8q_A Ubiquitin-like 1 activating enzyme E1A; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_A* 3kyc_A* 3kyd_A* Back     alignment and structure
>3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Back     alignment and structure
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>1tt5_A APPBP1, amyloid protein-binding protein 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbh_A 3dbl_A 3dbr_A 1r4m_A 1r4n_A* 2nvu_A* 1yov_A 3gzn_A* Back     alignment and structure
>3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* Back     alignment and structure
>4gsl_A Ubiquitin-like modifier-activating enzyme ATG7; ubiquitin-like protein activation enzyme, ubiquitin-like Pro transfer enzyme, protein transport; 2.70A {Saccharomyces cerevisiae} PDB: 3vh2_A 4gsk_A 3vh1_A Back     alignment and structure
>3cmm_A Ubiquitin-activating enzyme E1 1; UBA1, protein turnover, ligase, conformationa thioester, adenylation, transthioesterification, ATP-bindin nucleotide-binding; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3vh1_A Ubiquitin-like modifier-activating enzyme ATG7; autophagy, zinc binding, metal binding protein; 3.00A {Saccharomyces cerevisiae} PDB: 3vh2_A Back     alignment and structure
>1y8x_B Ubiquitin-activating enzyme E1C; ubiquitin-conjugating enzyme E2 M, ligase; 2.40A {Homo sapiens} SCOP: c.111.1.2 PDB: 3fn1_A Back     alignment and structure
>1z7l_A Ubiquitin-activating enzyme E1 1; SCCH, second catalytic cysteine half-domain, ligase; HET: TBR; 2.80A {Mus musculus} Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} Back     alignment and structure
>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>3onh_A Ubiquitin-activating enzyme E1-like; ligase, SUMO conjugation, UBC9; 1.60A {Saccharomyces cerevisiae} PDB: 3ong_A Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>2ph5_A Homospermidine synthase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: NAD; 2.50A {Legionella pneumophila subsp} Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>1npy_A Hypothetical shikimate 5-dehydrogenase-like protein HI0607; structural genomics, PSI, protein structure initiative; 1.75A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} SCOP: c.2.1.11 c.90.1.1 e.37.1.1 PDB: 1pjs_A* 1pjt_A* Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>2d4a_B Malate dehydrogenase; archaea, hyperthermophIle, oxidoreductase; 2.87A {Aeropyrum pernix} Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>2dc1_A L-aspartate dehydrogenase; NAD, oxidoreductase; HET: CIT NAD; 1.90A {Archaeoglobus fulgidus} Back     alignment and structure
>1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>2x0j_A Malate dehydrogenase; oxidoreductase, hyperthermophilic, tricarboxylic acid cycle; HET: ENA; 2.79A {Archaeoglobus fulgidus dsm 4304} PDB: 2x0i_A* Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A* Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>1p9l_A Dihydrodipicolinate reductase; oxidoreductase, lysine biosynthesis, NADH binding specificity, TB structural genomics consortium; HET: NAD PDC PG4; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.3 d.81.1.3 PDB: 1c3v_A* 1yl5_A 1yl7_A* 1yl6_A* Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>1ez4_A Lactate dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.30A {Lactobacillus pentosus} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 Back     alignment and structure
>3obb_A Probable 3-hydroxyisobutyrate dehydrogenase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: EPE; 2.20A {Pseudomonas aeruginosa} PDB: 3q3c_A* Back     alignment and structure
>2zqz_A L-LDH, L-lactate dehydrogenase; oxidoreductase, rossmann fold, cytoplasm, glycolysis, NAD, phosphoprotein; 2.50A {Lactobacillus casei} PDB: 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* Back     alignment and structure
>4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} Back     alignment and structure
>4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>3nep_X Malate dehydrogenase; halophIle, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle; 1.55A {Salinibacter ruber} Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} Back     alignment and structure
>3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} Back     alignment and structure
>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} Back     alignment and structure
>1x7d_A Ornithine cyclodeaminase; binds NAD+, binds L-ornithine, binds L-proline, 2 bundle, beta barrel, rossmann fold, lyase; HET: NAD ORN MES; 1.60A {Pseudomonas putida} SCOP: c.2.1.13 PDB: 1u7h_A* Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Back     alignment and structure
>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Back     alignment and structure
>2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Back     alignment and structure
>3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 Back     alignment and structure
>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Back     alignment and structure
>2i99_A MU-crystallin homolog; thyroid hormine binding protein, oxidoreductase; HET: NDP; 2.60A {Homo sapiens} Back     alignment and structure
>2xxj_A L-LDH, L-lactate dehydrogenase; oxidoreductase, hyperthermophIle; HET: NAD; 1.964A {Thermus thermophilus} PDB: 2xxb_A* 3zzn_A* 2v7p_A* 2e37_A* 2v6m_A* 2xxe_A 4a73_A Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* Back     alignment and structure
>2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Back     alignment and structure
>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} Back     alignment and structure
>2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Back     alignment and structure
>2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>3hdj_A Probable ornithine cyclodeaminase; APC62486, bordetella pertussis TOH structural genomics, PSI-2, protein structure initiative; 1.70A {Bordetella pertussis} Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Back     alignment and structure
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>1omo_A Alanine dehydrogenase; two-domain, beta-sandwich-dimer, rossmann-fold NAD domain, human MU crystallin homolog; HET: NAD; 2.32A {Archaeoglobus fulgidus} SCOP: c.2.1.13 PDB: 1vll_A Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Back     alignment and structure
>1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6 Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure
>2r00_A Aspartate-semialdehyde dehydrogenase; conformational change, half-OF-sites-reactivity, protein evolution, sequence homology; HET: HTI; 2.03A {Vibrio cholerae} PDB: 2qz9_A* 2r00_C* Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* Back     alignment and structure
>4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Back     alignment and structure
>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Back     alignment and structure
>2dvm_A Malic enzyme, 439AA long hypothetical malate oxidoreductase; NAD, structural genomics, NPPSFA; HET: NAD MES; 1.60A {Pyrococcus horikoshii} PDB: 1ww8_A* Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3qy9_A DHPR, dihydrodipicolinate reductase; rossmann fold, NADH, NADPH, oxidoreductase; 1.80A {Staphylococcus aureus} Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Back     alignment and structure
>4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A Back     alignment and structure
>1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} Back     alignment and structure
>2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Back     alignment and structure
>1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} Back     alignment and structure
>3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>1o6z_A MDH, malate dehydrogenase; halophilic, ION-binding, protein-solvent interaction, oxidoreductase; HET: NAD; 1.95A {Haloarcula marismortui} SCOP: c.2.1.5 d.162.1.1 PDB: 1gt2_A* 2x0r_A* 2j5k_A 2j5q_A 2j5r_A 1d3a_A 1hlp_A* 2hlp_A Back     alignment and structure
>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Back     alignment and structure
>3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0 Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A* Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Back     alignment and structure
>3pwk_A Aspartate-semialdehyde dehydrogenase; NADP binding, oxidoreductase-oxidoreductase I complex; HET: 25A L14; 1.50A {Streptococcus pneumoniae} PDB: 2gyy_A* 2gz2_A* 2gz3_A* 2gz1_A* 3pws_A* 3pyl_A 3pyx_A* 3pzb_A* 3q11_A* 3q1l_A Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 Back     alignment and structure
>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* Back     alignment and structure
>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>3hhp_A Malate dehydrogenase; MDH, citric acid cycle, TCA cycle, NAD, oxidoreductase, tricarboxylic acid cycle; 1.45A {Escherichia coli k-12} PDB: 2pwz_A 2cmd_A* 1emd_A* 1ib6_A* 1ie3_A* 4e0b_A* Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Back     alignment and structure
>1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Back     alignment and structure
>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Back     alignment and structure
>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Back     alignment and structure
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} Back     alignment and structure
>2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A* Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Back     alignment and structure
>2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} Back     alignment and structure
>3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Back     alignment and structure
>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Back     alignment and structure
>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Back     alignment and structure
>1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>4fgw_A Glycerol-3-phosphate dehydrogenase [NAD(+)] 1; oxidoreductase; 2.45A {Saccharomyces cerevisiae} Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* Back     alignment and structure
>3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3tz6_A Aspartate-semialdehyde dehydrogenase; asadh, ASD, ASA, amino-acid biosynthesis, diaminopimelate biosynthesis, lysine biosynthesis; HET: SO4; 1.95A {Mycobacterium tuberculosis} PDB: 3vos_A* 3kub_A 3llg_A Back     alignment and structure
>1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Back     alignment and structure
>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} Back     alignment and structure
>1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A* Back     alignment and structure
>2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Back     alignment and structure
>3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>3rc1_A Sugar 3-ketoreductase; sugar biosynthesis, TDP binding, NADP binding binding protein; HET: TLO NAP; 1.71A {Actinomadura kijaniata} PDB: 3rbv_A* 3rc2_A* 3rcb_A* 3rc7_A* 3rc9_A* Back     alignment and structure
>3ijp_A DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, decode biostructures, niaid, amino-acid biosynthesis, cytoplasm; HET: NAP; 2.30A {Bartonella henselae} Back     alignment and structure
>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 Back     alignment and structure
>3c7a_A Octopine dehydrogenase; L) stereospecific opine dehydrogenas, oxidorecutase, oxidoreductase; HET: NAD; 2.10A {Pecten maximus} PDB: 3c7c_B* 3c7d_B* 3iqd_B* Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
>1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6 Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Back     alignment and structure
>3uko_A Alcohol dehydrogenase class-3; alcohol dehydrogenase III, homodimer, reduction of GSNO, NAD binding, oxidoreductase; HET: NAD SO4; 1.40A {Arabidopsis thaliana} Back     alignment and structure
>1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* Back     alignment and structure
>4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} Back     alignment and structure
>2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Back     alignment and structure
>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 Back     alignment and structure
>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 Back     alignment and structure
>3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} Back     alignment and structure
>3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} Back     alignment and structure
>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>1hye_A L-lactate/malate dehydrogenase; nucleotide binding domain, oxidoreductase; HET: NAP; 1.90A {Methanocaldococcus jannaschii} SCOP: c.2.1.5 d.162.1.1 PDB: 1hyg_A* Back     alignment and structure
>1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Back     alignment and structure
>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Back     alignment and structure
>2ep5_A 350AA long hypothetical aspartate-semialdehyde dehydrogenase; oxidoreductase, structural genomics, NPPSFA; 2.40A {Sulfolobus tokodaii} Back     alignment and structure
>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} Back     alignment and structure
>1r6d_A TDP-glucose-4,6-dehydratase; rossmann fold, short-chain dehydrogenase/reductase, lyase; HET: NAD DAU; 1.35A {Streptomyces venezuelae} SCOP: c.2.1.2 PDB: 1r66_A* Back     alignment and structure
>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Back     alignment and structure
>2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A Back     alignment and structure
>3uuw_A Putative oxidoreductase with NAD(P)-binding rossm domain; structural genomics, center for structural genomics of infec diseases, csgid; HET: 1PE PGE; 1.63A {Clostridium difficile} Back     alignment and structure
>3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Back     alignment and structure
>4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* Back     alignment and structure
>1dih_A Dihydrodipicolinate reductase; oxidoreductase; HET: NDP; 2.20A {Escherichia coli} SCOP: c.2.1.3 d.81.1.3 PDB: 1arz_A* 1dru_A* 1drv_A* 1drw_A* Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Back     alignment and structure
>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>2glx_A 1,5-anhydro-D-fructose reductase; NADP(H) dependent reductase, rossmann-fold, sugar metabolism, 1,5-anhydro-D-mannitol, oxidoreductase; HET: NDP; 2.20A {Ensifer adhaerens} Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>3db2_A Putative NADPH-dependent oxidoreductase; two domain protein, rossman fold, putative dehydrogenase, ST genomics; 1.70A {Desulfitobacterium hafniense dcb-2} Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 Back     alignment and structure
>2z5l_A Tylkr1, tylactone synthase starter module and modules 1 & 2; short-chain dehydrogenase/reductase, rossman fold; 1.95A {Streptomyces fradiae} Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Back     alignment and structure
>3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} Back     alignment and structure
>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} Back     alignment and structure
>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 Back     alignment and structure
>3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} SCOP: c.2.1.0 Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Back     alignment and structure
>3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Back     alignment and structure
>4a2c_A Galactitol-1-phosphate 5-dehydrogenase; oxidoreductase, metal binding-site; 1.87A {Escherichia coli} Back     alignment and structure
>1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* Back     alignment and structure
>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* Back     alignment and structure
>3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 Back     alignment and structure
>2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} Back     alignment and structure
>1dxy_A D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarboxylate dehydrogenase, D-lactate dehydrogenas oxidoreductase; HET: NAD; 1.86A {Lactobacillus casei} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1j4a_A D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp} SCOP: c.2.1.4 c.23.12.1 PDB: 1j49_A* 2dld_A* Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Back     alignment and structure
>3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>3nv9_A Malic enzyme; rossmann fold, oxidoreductase; 2.25A {Entamoeba histolytica} Back     alignment and structure
>1xdw_A NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans} Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure
>1f06_A MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH-inhibitor ternary complex, oxidoreductase; HET: NDP 2NP; 2.10A {Corynebacterium glutamicum} SCOP: c.2.1.3 d.81.1.3 PDB: 1dap_A* 2dap_A* 3dap_A* Back     alignment and structure
>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Back     alignment and structure
>1gy8_A UDP-galactose 4-epimerase; oxidoreductase; HET: NAD UDP; 2.0A {Trypanosoma brucei} SCOP: c.2.1.2 PDB: 2cnb_A* Back     alignment and structure
>2fr1_A Erythromycin synthase, eryai; short chain dehydrogenase/reductase, oxidoreductase; HET: NDP; 1.79A {Saccharopolyspora erythraea} SCOP: c.2.1.2 c.2.1.2 PDB: 2fr0_A* Back     alignment and structure
>1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A* Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>3euw_A MYO-inositol dehydrogenase; protein structure initiative II (PSI II), NYSGXRC, MYO-inosi dehydrogenase, oxidoreductase, tetramer; 2.30A {Corynebacterium glutamicum} Back     alignment and structure
>2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} Back     alignment and structure
>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Back     alignment and structure
>2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Back     alignment and structure
>1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Back     alignment and structure
>1z7l_A Ubiquitin-activating enzyme E1 1; SCCH, second catalytic cysteine half-domain, ligase; HET: TBR; 2.80A {Mus musculus} Back     alignment and structure
>2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A Back     alignment and structure
>3q2i_A Dehydrogenase; rossmann fold, UDP-sugar binding, NAD binding oxidoreductase; HET: NAD HP7; 1.50A {Chromobacterium violaceum} PDB: 3q2k_A* Back     alignment and structure
>1a4i_A Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase...; THF, bifunctional, oxidoreductase; HET: NDP; 1.50A {Homo sapiens} SCOP: c.2.1.7 c.58.1.2 PDB: 1dia_A* 1dib_A* 1dig_A* Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} Back     alignment and structure
>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} Back     alignment and structure
>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ... Back     alignment and structure
>2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structur genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus} Back     alignment and structure
>3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} Back     alignment and structure
>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} Back     alignment and structure
>2ejw_A HDH, homoserine dehydrogenase; NAD-dependent, oxidoreductase; 1.70A {Thermus thermophilus} Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str} Back     alignment and structure
>7mdh_A Protein (malate dehydrogenase); chloroplastic malate dehydrogenase (NADP+), activated by LIG chloroplastic malate dehydrogenase; 2.40A {Sorghum bicolor} SCOP: c.2.1.5 d.162.1.1 PDB: 1civ_A* Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Back     alignment and structure
>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* Back     alignment and structure
>3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A Back     alignment and structure
>4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} Back     alignment and structure
>3mje_A AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1.36A {Streptomyces nodosus} PDB: 3mjc_A* 3mjs_A* 3mjv_A* 3mjt_A* Back     alignment and structure
>1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} Back     alignment and structure
>3e9m_A Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, PSI-II, dimeric dihydodiol dehydrogenase, structural genomics; 2.70A {Enterococcus faecalis} Back     alignment and structure
>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} Back     alignment and structure
>1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* Back     alignment and structure
>2hjs_A USG-1 protein homolog; aspartate-semialdehyde dehydrogenase, probable hydrolase, PS aeruginosa, structurual genomics; 2.20A {Pseudomonas aeruginosa} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>2c2x_A Methylenetetrahydrofolate dehydrogenase- methenyltetrahydrofolate cyclohydrolase; NADP; 2.0A {Mycobacterium tuberculosis} PDB: 2c2y_A Back     alignment and structure
>3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* Back     alignment and structure
>2o7s_A DHQ-SDH PR, bifunctional 3-dehydroquinate dehydratase/shikima dehydrogenase; shikimate, NADPH, dehydroshikimate, bifunctional enzyme; HET: DHK TLA NAP; 1.78A {Arabidopsis thaliana} PDB: 2o7q_A* 2gpt_A* Back     alignment and structure
>1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Back     alignment and structure
>3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A* Back     alignment and structure
>3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} Back     alignment and structure
>4hkt_A Inositol 2-dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium, oxidoreductase; HET: MSE; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>1x0v_A GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic; two independent domains, GXGXXG motif, oxidoreductase; 2.30A {Homo sapiens} PDB: 1x0x_A* 1wpq_A* 2pla_A* Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Back     alignment and structure
>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* Back     alignment and structure
>2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* Back     alignment and structure
>3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} SCOP: c.2.1.0 PDB: 3gdf_A Back     alignment and structure
>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A Back     alignment and structure
>3dr3_A N-acetyl-gamma-glutamyl-phosphate reductase; csgid target, ARGC, essential gene, amino-acid biosynthesis, arginine biosynthesis, cytoplasm; HET: MLT; 2.00A {Shigella flexneri} PDB: 2g17_A Back     alignment and structure
>3evn_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics; 2.00A {Streptococcus agalactiae serogroup V} Back     alignment and structure
>2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Back     alignment and structure
>1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepresso transcription repressor; HET: NAD; 1.95A {Homo sapiens} SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A* 3ga0_A 2ome_A* Back     alignment and structure
>1qp8_A Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A {Pyrobaculum aerophilum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} Back     alignment and structure
>4dpk_A Malonyl-COA/succinyl-COA reductase; dinucleotide binding, dimerization domain, NADP, oxidoreductase; 2.05A {Sulfolobus tokodaii} PDB: 4dpm_A* Back     alignment and structure
>4dpl_A Malonyl-COA/succinyl-COA reductase; dinucleotide binding, dimerization domain, NADP, oxidoreductase; HET: NAP; 1.90A {Sulfolobus tokodaii} PDB: 4dpk_A* 4dpm_A* Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B Back     alignment and structure
>3qp9_A Type I polyketide synthase pikaii; rossmann fold, ketoreductase, epimerization, oxidoreductase; 1.88A {Streptomyces venezuelae} Back     alignment and structure
>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>2yq5_A D-isomer specific 2-hydroxyacid dehydrogenase; oxidoreductase; HET: NAD; 2.75A {Lactobacillus delbrueckii subsp} PDB: 2yq4_A* Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 447
d1yovb1426 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [T 1e-141
d1yova1 529 c.111.1.2 (A:6-534) Amyloid beta precursor protein 4e-53
d1y8xb192 c.111.1.2 (B:349-440) UBA3 {Human (Homo sapiens) [ 2e-20
d1jw9b_247 c.111.1.1 (B:) Molybdenum cofactor biosynthesis pr 6e-17
d1jw9b_247 c.111.1.1 (B:) Molybdenum cofactor biosynthesis pr 0.001
>d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Length = 426 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Activating enzymes of the ubiquitin-like proteins
superfamily: Activating enzymes of the ubiquitin-like proteins
family: Ubiquitin activating enzymes (UBA)
domain: UBA3
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  408 bits (1049), Expect = e-141
 Identities = 197/418 (47%), Positives = 266/418 (63%), Gaps = 10/418 (2%)

Query: 6   PSRSRDLDKLLLRAGNLVGPTFEPGTELRDDLQEYARILVVGAGGLGCELLKDLALSGFK 65
             R   + K L R+G    P FEP TE    L +  ++LV+GAGGLGCELLK+LALSGF+
Sbjct: 3   EGRWNHVKKFLERSGPFTHPDFEPSTESLQFLLDTCKVLVIGAGGLGCELLKNLALSGFR 62

Query: 66  NLEVIDMDRIEVSNLNRQFLFRMEDVGKPKAEVAAKRVMERVSGVNIVPHFCRIEDKDIS 125
            + VIDMD I+VSNLNRQFLFR +D+G+PKAEVAA+ + +RV   N+VPHF +I+D + +
Sbjct: 63  QIHVIDMDTIDVSNLNRQFLFRPKDIGRPKAEVAAEFLNDRVPNCNVVPHFNKIQDFNDT 122

Query: 126 FYNDFNIIVLGLDSIEARSYINAVACSFLEYETDDKPREETIKPMVDGGTEGFKGHARVI 185
           FY  F+IIV GLDSI AR +IN      L    D      +I P++DGGTEGFKG+ARVI
Sbjct: 123 FYRQFHIIVCGLDSIIARRWING-MLISLLNYEDGVLDPSSIVPLIDGGTEGFKGNARVI 181

Query: 186 IPGVTPCFECTIWLFPPQVKFPLCTLAETPRTAAHCIEYAHLIKWDEVHS---GKSFDPD 242
           +PG+T C ECT+ L+PPQV FP+CT+A  PR   HCIEY  +++W +      G   D D
Sbjct: 182 LPGMTACIECTLELYPPQVNFPMCTIASMPRLPEHCIEYVRMLQWPKEQPFGEGVPLDGD 241

Query: 243 DPEHMQWVYSEAVKRAELFGIPGVTYSLTQGVVKNIIPAIASTNAIISAACALETLKIAS 302
           DPEH+QW++ ++++RA  + I GVTY LTQGVVK IIPA+ASTNA+I+A CA E  KIA+
Sbjct: 242 DPEHIQWIFQKSLERASQYNIRGVTYRLTQGVVKRIIPAVASTNAVIAAVCATEVFKIAT 301

Query: 303 GCSKTLSNYLTYNGVAGLHIKVTEFVKDKDCLVCGP-GVLIELDTSVTLEKFINLLEEHP 361
                L+NYL +N V GL+    E  + ++C  C      I+   S  L++ ++ L    
Sbjct: 302 SAYIPLNNYLVFNDVDGLYTYTFEAERKENCPACSQLPQNIQFSPSAKLQEVLDYLTNSA 361

Query: 362 KLQLAKASVT----YRGKNLYMQAPPVLEEMTRSNLSLPLYDLMDKVAKDILHVTGVT 415
            LQ+   ++T     + + LY+Q+   +EE TR NLS  L +L        L V  VT
Sbjct: 362 SLQMKSPAITATLEGKNRTLYLQSVTSIEERTRPNLSKTLKELGLVDG-QELAVADVT 418
>d1yova1 c.111.1.2 (A:6-534) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1y8xb1 c.111.1.2 (B:349-440) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Length = 247 Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Length = 247 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query447
d1yovb1426 UBA3 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 100.0
d1yova1 529 Amyloid beta precursor protein-binding protein 1, 100.0
d1y8xb192 UBA3 {Human (Homo sapiens) [TaxId: 9606]} 99.66
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 97.48
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 97.47
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 97.36
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 97.25
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 96.99
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 96.94
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 96.94
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 96.84
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 96.77
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 96.7
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 96.59
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 96.58
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 96.5
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 96.44
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 96.42
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 96.38
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 96.33
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 96.31
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 96.23
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 96.23
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 96.21
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 96.15
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 96.14
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 96.13
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 96.04
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 95.99
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 95.98
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 95.95
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 95.89
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 95.89
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 95.8
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 95.78
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 95.77
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 95.76
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 95.74
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 95.69
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 95.68
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 95.67
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 95.64
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 95.6
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 95.6
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 95.54
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 95.54
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 95.51
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 95.48
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 95.47
d1vm6a3128 Dihydrodipicolinate reductase {Thermotoga maritima 95.46
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 95.43
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 95.4
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 95.37
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 95.37
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 95.36
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 95.34
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 95.3
d1id1a_153 Rck domain from putative potassium channel Kch {Es 95.25
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 95.23
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 95.22
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 95.19
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 95.16
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 95.13
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 95.12
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 95.07
d1j5pa4132 Hypothetical protein TM1643 {Thermotoga maritima [ 95.05
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 95.04
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 94.99
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 94.97
d1yxma1297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 94.95
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 94.95
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 94.92
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 94.83
d1xhla_274 Hypothetical protein F25D1.5 {Caenorhabditis elega 94.68
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 94.6
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 94.5
d1yl7a1135 Dihydrodipicolinate reductase {Mycobacterium tuber 94.48
d1xkqa_272 Hypothetical protein R05D8.7 {Caenorhabditis elega 94.47
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 94.46
d2hjsa1144 Usg-1 protein homolog PA3116 {Pseudomonas aerugino 94.44
d1spxa_264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 94.38
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 94.38
d1w6ua_294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 94.37
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 94.28
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 94.22
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 94.2
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 94.19
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 94.04
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 94.0
d1sbya1254 Drosophila alcohol dehydrogenase {Fly (Drosophila 93.91
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 93.76
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 93.71
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 93.61
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 93.56
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 93.51
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 93.47
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 93.47
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 93.47
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 93.44
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 93.43
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 93.43
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 93.36
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 93.34
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 93.33
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 93.24
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 93.23
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 93.19
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 93.19
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 93.14
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 93.03
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 92.99
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 92.98
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 92.95
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 92.93
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 92.92
d1k2wa_256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 92.81
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 92.8
d1gega_255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 92.8
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 92.72
d1diha1162 Dihydrodipicolinate reductase {Escherichia coli [T 92.72
d1wmaa1275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 92.65
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 92.64
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 92.61
d2ew8a1247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 92.61
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 92.59
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 92.51
d2cvza2156 Hydroxyisobutyrate dehydrogenase {Thermus thermoph 92.44
d1x1ta1260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 92.35
d1vl6a1222 Malate oxidoreductase (malic enzyme) {Thermotoga m 92.31
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 92.25
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 92.23
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 92.1
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 91.99
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 91.96
d1up7a1162 6-phospho-beta-glucosidase {Thermotoga maritima [T 91.96
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 91.92
d1bdba_276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 91.85
d2ag5a1245 Dehydrogenase/reductase SDR family member 6, DHRS6 91.84
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 91.7
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 91.68
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 91.6
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 91.6
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 91.56
d2rhca1257 beta-keto acyl carrier protein reductase {Streptom 91.36
d1j6ua189 UDP-N-acetylmuramate-alanine ligase MurC {Thermoto 91.36
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 91.25
d1orra_338 CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 91.25
d1nvmb1157 Acetaldehyde dehydrogenase (acylating) {Pseudomona 91.22
d1c1da1201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 91.13
d2gz1a1154 Aspartate beta-semialdehyde dehydrogenase {Strepto 91.12
d2bkaa1232 TAT-interacting protein TIP30 {Human (Homo sapiens 91.09
d1ja9a_259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 90.96
d1u8xx1167 Maltose-6'-phosphate glucosidase GlvA {Bacillus su 90.88
d1tlta1164 Virulence factor MviM {Escherichia coli [TaxId: 56 90.79
d1g0oa_272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 90.78
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 90.69
d1obba1171 Alpha-glucosidase AglA {Thermotoga maritima [TaxId 90.59
d1hdca_254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 90.52
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 90.52
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 90.51
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 90.42
d1gz6a_302 (3R)-hydroxyacyl-CoA dehydrogenase domain of estra 90.41
d2dw4a2449 Lysine-specific histone demethylase 1, LSD1 {Human 90.33
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 90.13
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 90.08
d1q7ba_243 beta-keto acyl carrier protein reductase {Escheric 89.94
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 89.9
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 89.82
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 89.8
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 89.71
d2fr1a1259 Erythromycin synthase, eryAI, 1st ketoreductase mo 89.68
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 89.3
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 89.27
d2fyta1311 Protein arginine N-methyltransferase 3, PRMT3 {Hum 89.26
d1y7ta1154 Malate dehydrogenase {Thermus thermophilus [TaxId: 89.22
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 89.04
d1edoa_244 beta-keto acyl carrier protein reductase {Oil seed 89.0
d2q46a1252 Hypothetical protein At5g02240 (T7H20_290) {Thale 88.95
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 88.41
d2blla1342 Polymyxin resistance protein ArnA (PrmI) {Escheric 88.3
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 88.14
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 88.14
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 88.02
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 88.02
d2pd4a1274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 88.01
d1oaaa_259 Sepiapterin reductase {Mouse (Mus musculus) [TaxId 87.92
d1ydwa1184 Probable oxidoreductase At4g09670 {Thale cress (Ar 87.89
d1db3a_357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 87.88
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 87.65
d1xeaa1167 Putative oxidoreductase VCA1048 {Vibrio cholerae [ 87.54
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 87.53
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 87.5
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 87.37
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 87.1
d1gdha1191 D-glycerate dehydrogenase {Hyphomicrobium methylov 87.05
d1sc6a1188 Phosphoglycerate dehydrogenase {Escherichia coli [ 86.96
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 86.61
d2fy8a1129 Potassium channel-related protein MthK {Archaeon M 86.54
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 86.49
d2czca2172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 86.48
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 86.46
d1vl0a_281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 86.38
d2h7ma1268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 86.3
d3bswa1193 Acetyltransferase PglD {Campylobacter jejuni [TaxI 86.27
d1y1pa1342 Aldehyde reductase II {Sporobolomyces salmonicolor 86.19
d1w5fa1194 Cell-division protein FtsZ {Thermotoga maritima [T 86.14
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 86.07
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 86.01
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 85.94
d1f06a1170 Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb 85.89
d1rkxa_356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 85.89
d1pj3a1294 Mitochondrial NAD(P)-dependent malic enzyme {Human 85.78
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 85.77
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 85.76
d1ofua1198 Cell-division protein FtsZ {Pseudomonas aeruginosa 85.68
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 85.65
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 85.61
d1ooea_235 Dihydropteridin reductase (pteridine reductase) {N 85.57
d1kewa_361 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 85.5
d1qsga_258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 85.48
d2bd0a1240 Bacterial sepiapterin reductase {Chlorobium tepidu 84.97
d2vapa1209 Cell-division protein FtsZ {Archaeon Methanococcus 84.76
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 84.76
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 84.65
d1gq2a1298 Mitochondrial NAD(P)-dependent malic enzyme {Domes 84.58
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 84.43
d2o23a1248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 84.43
d1pn0a1360 Phenol hydroxylase {Soil-living yeast (Trichosporo 84.3
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 84.28
d1o5ia_234 beta-keto acyl carrier protein reductase {Thermoto 84.11
d1o0sa1308 Mitochondrial NAD(P)-dependent malic enzyme {Pig r 84.07
d2dt5a2126 Transcriptional repressor Rex, C-terminal domain { 84.06
d1s6ya1169 6-phospho-beta-glucosidase {Bacillus stearothermop 84.02
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 83.95
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 83.8
d1ulua_256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 83.75
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 83.74
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 83.61
d1wzna1251 Hypothetical methyltransferase PH1305 {Archaeon Py 83.5
d1hxha_253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 83.46
d1xu9a_269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 83.45
d1uzma1237 beta-keto acyl carrier protein reductase {Mycobact 83.37
d1aoga1238 Trypanothione reductase {Trypanosoma cruzi [TaxId: 83.26
d1leha1230 Leucine dehydrogenase {Bacillus sphaericus [TaxId: 82.75
d2f5va1379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 82.23
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 82.23
d1ygya1184 Phosphoglycerate dehydrogenase {Mycobacterium tube 82.19
d1b7go1178 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 82.13
d1t4ba1146 Aspartate beta-semialdehyde dehydrogenase {Escheri 82.07
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 81.9
d1cf2o1171 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 81.88
d1d7oa_297 Enoyl-ACP reductase {Oil seed rape (Brassica napus 81.8
d1dhra_236 Dihydropteridin reductase (pteridine reductase) {R 81.79
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 81.72
d1ps9a2162 2,4-dienoyl-CoA reductase, C-terminal domain {Esch 81.71
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 81.67
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 81.47
d7mdha1175 Malate dehydrogenase {Sorghum (Sorghum vulgare), c 81.08
d1g6q1_328 Arginine methyltransferase, HMT1 {Baker's yeast (S 80.98
d1sb8a_341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 80.97
d1z45a2347 Uridine diphosphogalactose-4-epimerase (UDP-galact 80.96
d1r6da_322 dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces 80.89
d1e7wa_284 Dihydropteridin reductase (pteridine reductase) {L 80.81
d1gy8a_383 Uridine diphosphogalactose-4-epimerase (UDP-galact 80.73
d1dlja2196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 80.63
d1uaya_241 Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t 80.43
d2d1ya1248 Hypothetical protein TTHA0369 {Thermus thermophilu 80.42
d2a35a1212 Hypothetical protein PA4017 {Pseudomonas aeruginos 80.33
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 80.19
>d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Activating enzymes of the ubiquitin-like proteins
superfamily: Activating enzymes of the ubiquitin-like proteins
family: Ubiquitin activating enzymes (UBA)
domain: UBA3
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=1e-94  Score=745.64  Aligned_cols=416  Identities=48%  Similarity=0.828  Sum_probs=369.1

Q ss_pred             CCCCccchhHHhhccCCCCCCCCccCCHHH-HHHHhcCCeEEEEcCchHHHHHHHHHHHhCCCeEEEEeCCccCcccCcc
Q 013224            4 TAPSRSRDLDKLLLRAGNLVGPTFEPGTEL-RDDLQEYARILVVGAGGLGCELLKDLALSGFKNLEVIDMDRIEVSNLNR   82 (447)
Q Consensus         4 ~~~~~~~~~~~~l~~~~~~~r~~~~~G~~~-q~~L~~~~~VlvvG~GglG~eiak~La~~Gvg~i~lvD~D~Ve~sNL~R   82 (447)
                      +|++||.+++++|.|+++|+++.+.+|.|. |++|+ ++||||||+||+|||+||+|+++|||+|+|+|+|+|+.|||+|
T Consensus         1 ~~~~~~~~~~~~~~r~~~~~~~~~~~~~e~~~~~l~-~~kVlvvG~GglG~ei~k~L~~~Gvg~i~lvD~D~Ve~sNL~R   79 (426)
T d1yovb1           1 DWEGRWNHVKKFLERSGPFTHPDFEPSTESLQFLLD-TCKVLVIGAGGLGCELLKNLALSGFRQIHVIDMDTIDVSNLNR   79 (426)
T ss_dssp             CCTTTTHHHHHHHHSCCTTCCTTCCCCSSHHHHHHH-HCCEEEECSSTTHHHHHHHHHTTTCCCEEEECCCBCCGGGGGT
T ss_pred             CcccchhhHHHHHhcCCCCcCcccccChHHHHHHHh-cCeEEEECCCHHHHHHHHHHHHcCCCeEEEEECCCcchhhhcc
Confidence            689999999999999999999999998665 77788 9999999999999999999999999999999999999999999


Q ss_pred             ccCCCCCCCCChHHHHHHHHHHhhCCceEEEEEeccCccchhhccCCceEEEcccCCHHHHHHHHHHHHhhccccCCCcc
Q 013224           83 QFLFRMEDVGKPKAEVAAKRVMERVSGVNIVPHFCRIEDKDISFYNDFNIIVLGLDSIEARSYINAVACSFLEYETDDKP  162 (447)
Q Consensus        83 qfLf~~~diG~~Ka~~a~~~l~~~np~v~i~~~~~~i~~~~~~~~~~~DvVi~~~Dn~~~r~~in~~~~~l~~~~~~~~~  162 (447)
                      ||||+++|||++||++|+++++++||+++|+++..++.+.+.+|+++||+||+|+||+++|+++|++|+.+..+. ++..
T Consensus        80 Qflf~~~diG~~Ka~~a~~~l~~~np~v~i~~~~~~i~~~~~~~~~~~DlVi~~~Dn~~aR~~in~~c~~l~k~~-~~~~  158 (426)
T d1yovb1          80 QFLFRPKDIGRPKAEVAAEFLNDRVPNCNVVPHFNKIQDFNDTFYRQFHIIVCGLDSIIARRWINGMLISLLNYE-DGVL  158 (426)
T ss_dssp             CTTCCGGGTTSBHHHHHHHHHHHHSTTCCCEEECSCGGGBCHHHHTTCSEEEECCSCHHHHHHHHHHHHHTCCEE-TTEE
T ss_pred             cccCChhHcCcHHHHHHHHHHHhhCCCCceEeeeccccchHHHHHHhcchheeccCcHHHHHHHHHHHHHhhccc-cccc
Confidence            999999999999999999999999999999999999999889999999999999999999999999998776542 4556


Q ss_pred             cccCCCcEEEeeeccccceEEEEeCCCCCccccccCCCCCCCCCCcccccCCcCChhhHHHHHHhhhhhhccC---CCCC
Q 013224          163 REETIKPMVDGGTEGFKGHARVIIPGVTPCFECTIWLFPPQVKFPLCTLAETPRTAAHCIEYAHLIKWDEVHS---GKSF  239 (447)
Q Consensus       163 ~~~~~~pli~~g~~g~~G~v~~~~p~~t~c~~C~~~~~p~~~~~p~ct~~~~p~~~~hci~~a~~~~~~~~~~---~~~~  239 (447)
                      +++.++|+|++|+.|+.||+++++|+.|+||+|.++..|+++++|.||++++|+.|+|||+||+.++|...++   +.++
T Consensus       159 ~~~~~iPlI~gg~~G~~G~~~vi~p~~t~Cy~C~~~~~p~~~~~p~CTi~~~P~~~~hci~~ak~l~~~~~~~~~~~~~~  238 (426)
T d1yovb1         159 DPSSIVPLIDGGTEGFKGNARVILPGMTACIECTLELYPPQVNFPMCTIASMPRLPEHCIEYVRMLQWPKEQPFGEGVPL  238 (426)
T ss_dssp             CGGGCCCEEEEEEETTEEEEEEECTTTSCCGGGGGGGSCCCCCCCHHHHHHCCCSHHHHHHHHHHTHHHHSCTTSTTCCC
T ss_pred             ccccCCceEEeEEeeeEEEEEEECCCCCCCcCcCCCCCCCCCCCCcccccCCCCCchheeehhhhhcccccccccccCCC
Confidence            6788999999999999999999999999999999999999999999999999999999999999999988764   6789


Q ss_pred             CCCChhHHHHHHHHHHHHHHHhCCCCCccccccccccccccccccHHHHHHHHHHHHHHHHHhCCCCCCcceEEEEcCCC
Q 013224          240 DPDDPEHMQWVYSEAVKRAELFGIPGVTYSLTQGVVKNIIPAIASTNAIISAACALETLKIASGCSKTLSNYLTYNGVAG  319 (447)
Q Consensus       240 d~dd~~~l~~i~~~a~~ra~~~~I~~~~~~~~~gv~~~iiPaia~t~Aivagl~a~EalK~ltg~~~~l~n~~~~~~~~~  319 (447)
                      |+||++|++||++++++||.+|+|++++++++++++++||||||||||||||++++|++|+++++..+++|+++|++..+
T Consensus       239 d~dd~~~i~~i~~~a~~ra~~~~I~~~~~~~~k~ia~nIIPaiatTnAIVagl~~~E~iK~lt~~~~p~~n~~~~~~~~~  318 (426)
T d1yovb1         239 DGDDPEHIQWIFQKSLERASQYNIRGVTYRLTQGVVKRIIPAVASTNAVIAAVCATEVFKIATSAYIPLNNYLVFNDVDG  318 (426)
T ss_dssp             CTTCHHHHHHHHHHHHHHHHHTTCCCCCHHHHHHHHTTCCCCCHHHHHHHHHHHHHHHHHHHHCSSCCCCSEEEEECSBS
T ss_pred             CCCCHHHHHHHHHHHHHHHHhcCCCCccHHHHHHHhhccccccccHHHHHHHHHHHHHHHHHhcCCccccceEEEecCCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eeEeEeeeecCCCCccCCC-ceeEecCCCCCHHHHHHHHhcCCCcceeeceeee----cccEEEecCCCChhhhhccccC
Q 013224          320 LHIKVTEFVKDKDCLVCGP-GVLIELDTSVTLEKFINLLEEHPKLQLAKASVTY----RGKNLYMQAPPVLEEMTRSNLS  394 (447)
Q Consensus       320 ~~~~~~~~~~~p~C~vC~~-~~~~~~~~~~tl~~l~~~l~~~~~~~~~~~~i~~----~~~~ly~~~~~~l~~~~~~~L~  394 (447)
                      .+..+++++|+|+|++|+. +..+.+++++||++|++.++++..+++..|++..    ++++||+.++|++++++++||+
T Consensus       319 ~~~~~~~~~k~~~C~vC~~~~~~~~~~~~~tL~~li~~~~~~~~l~~~~p~~~~~~~~~~~~Ly~~~~~~le~~~~~nl~  398 (426)
T d1yovb1         319 LYTYTFEAERKENCPACSQLPQNIQFSPSAKLQEVLDYLTNSASLQMKSPAITATLEGKNRTLYLQSVTSIEERTRPNLS  398 (426)
T ss_dssp             CEEEEECCCCCTTCTTTCSSCBCCC------CTTHHHHTTTCSSSCCSSCCEECC-----CEECCCC----CGGGSTTC-
T ss_pred             ceEeeeeccCCCCCCeeCCceEEEEECCCCCHHHHHHHHHHhhCcCccCCcceeeecCCCcEEEecCCchhhHHhhhhhc
Confidence            9998999999999999998 7778888899999999999877778888887743    5679999999999999999999


Q ss_pred             CchHHh-hcccccceeeeccccccccCCcceeEEEE
Q 013224          395 LPLYDL-MDKVAKDILHVTGVTGQSDKKTSCLRKLR  429 (447)
Q Consensus       395 k~l~el-~~~g~~~~~~~~~~~~v~d~~~~~~~~~~  429 (447)
                      |+|+|| +.+|  ++|      .|||++.|.++.||
T Consensus       399 k~L~eL~~~~g--~~l------~v~D~~~~~~~~~~  426 (426)
T d1yovb1         399 KTLKELGLVDG--QEL------AVADVTTPQTVLFK  426 (426)
T ss_dssp             ---------------C------BCCBTTBSSCCBBC
T ss_pred             CCHHHhCCCCC--CEE------EEECCCCCcceecC
Confidence            999999 9999  899      99999999887664
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yova1 c.111.1.2 (A:6-534) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y8xb1 c.111.1.2 (B:349-440) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1diha1 c.2.1.3 (A:2-130,A:241-273) Dihydrodipicolinate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2cvza2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1vl6a1 c.2.1.7 (A:155-376) Malate oxidoreductase (malic enzyme) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1up7a1 c.2.1.5 (A:1-162) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1nvmb1 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d2gz1a1 c.2.1.3 (A:2-127,A:330-357) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1u8xx1 c.2.1.5 (X:3-169) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1tlta1 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1obba1 c.2.1.5 (A:2-172) Alpha-glucosidase AglA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1xeaa1 c.2.1.3 (A:2-122,A:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d3bswa1 b.81.1.8 (A:3-195) Acetyltransferase PglD {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d1w5fa1 c.32.1.1 (A:22-215) Cell-division protein FtsZ {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1pj3a1 c.2.1.7 (A:280-573) Mitochondrial NAD(P)-dependent malic enzyme {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ofua1 c.32.1.1 (A:11-208) Cell-division protein FtsZ {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2vapa1 c.32.1.1 (A:23-231) Cell-division protein FtsZ {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1gq2a1 c.2.1.7 (A:280-580) Mitochondrial NAD(P)-dependent malic enzyme {Domestic pigeon (Columba livia) [TaxId: 8932]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1o0sa1 c.2.1.7 (A:296-603) Mitochondrial NAD(P)-dependent malic enzyme {Pig roundworm (Ascaris suum) [TaxId: 6253]} Back     information, alignment and structure
>d2dt5a2 c.2.1.12 (A:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1s6ya1 c.2.1.5 (A:4-172) 6-phospho-beta-glucosidase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1t4ba1 c.2.1.3 (A:1-133,A:355-367) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1cf2o1 c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} Back     information, alignment and structure
>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} Back     information, alignment and structure
>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure