Citrus Sinensis ID: 013262


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------
MLGFTSKTRFTVKKAENHSSTCIFTLFHCRKGKMHKLLLALSVSVFTSVCQYCLPFLADCKACDPSFPETCPTNGRSGNFKQFNCPNGHYNDLATLLLTTNDDAVRNIFSSNTPTEFQPSSILIFFILYCILGLITFGIAVPSGLFLPIILMGSAYGRLLGMAMGSYTNIDQGLYAVLGAASLMAGSMRMTVSLCVIFLELTNNLLLLPITMIVLLIAKTVGDSFNPSIYEIILELKGLPFLDAHPEPWMRTLTVGELIDAKPPVITLSGIEKVSQIVDVLRNTTHNGFPVLDEGVVPPSGLANVATELHGLILRAHLVLALKKKWFLQEKRRTEEWEVREKFSWVELAEREGKIEEVAVTSEEMEMYIDLHPLTNTTPYTVIESMSVAKAMVLFRQVGLRHLLVVPKYEAAGVSPVVGILTRQDLRAFNILTAFPHLERSKSGQKH
cccccHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHcHHHHHcccccccccccccccccccccccccccccccccHHHHHcccccHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHcccEEEEEEEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHccccccccccccccccccEEEcccccccEEEccccccHHHHHHHHHcccccccEEEEcccccccccccccccHHHHHcHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHccccccccccccEEcccccHHHHHHHHHHccccEEEEEccccccccccEEEEEEHHHHHHHHHHHHccccccccccccc
ccccccccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHcHHHHHcccccccHHHHHHccccccccccEEEEcccccccHHHHHHccccHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHccccccccccccHHccEEHHHcccccccEEEEccccEHHHHHHHHHccccccccEEcccccccccccccccEEEEEEHHHHHHHHHHHccccccccccccHHHHHHccHHHcccccccccccccccccccccEEccccccccccEccccccHHHHHHHHHHHcccEEEEEccccccccccEEEEEEcHHHHHHHHHHHccccccccccccc
mlgftsktrftvkkaenhsstcIFTLFHCRKGKMHKLLLALSVSVFTSVCQYclpfladckacdpsfpetcptngrsgnfkqfncpnghyndLATLLLttnddavrnifssntptefqpssiLIFFILYCILGLITFGiavpsglfLPIILMGSAYGRLLGMAMGSYTNIDQGLYAVLGAASLMAGSMRMTVSLCVIFLELTNNLLLLPITMIVLLIAKtvgdsfnpSIYEIILElkglpfldahpepwmrtltvgelidakppvitlsgieKVSQIVDVLRntthngfpvldegvvppsglaNVATELHGLILRAHLVLALKKKWFLQEKRRTEEWEVREKFSWVELAEREGKIEEVAVTSEEMEMYidlhpltnttpytVIESMSVAKAMVLFRQVGLRHLlvvpkyeaagvspvvgiltrqdlrafniltafphlersksgqkh
mlgftsktrftvkkaenhsstCIFTLFHCRKGKMHKLLLALSVSVFTSVCQYCLPFLADCKACDPSFPETCPTNGRSGNFKQFNCPNGHYNDLATLLLTTNDDAVRNIFSsntptefqpsSILIFFILYCILGLITFGIAVPSGLFLPIILMGSAYGRLLGMAMGSYTNIDQGLYAVLGAASLMAGSMRMTVSLCVIFLELTNNLLLLPITMIVLLIAKTVGDSFNPSIYEIILELKGLPFLDAHPEPWMRTLTVGELIDAKPPVITLSGIEKVSQIVDVLRNTTHNGFPVLDEGVVPPSGLANVATELHGLILRAHLVLALKKKWflqekrrteewevrekfswvelaeregkieeVAVTSEEMEMYIDLHPLTNTTPYTVIESMSVAKAMVLFRQVGLRHLLVVpkyeaagvspVVGILTRQDLRAFNILtafphlersksgqkh
MLGFTSKTRFTVKKAENHSSTCIFTLFHCRKGKMHKLLLALSVSVFTSVCQYCLPFLADCKACDPSFPETCPTNGRSGNFKQFNCPNGHYndlatlllttnddaVRNIFSSNTPTEFQPSSILIFFILYCILGLITFGIAVPSGLFLPIILMGSAYGRLLGMAMGSYTNIDQGLYAVLGAASLMAGSMRMTVSLCVIFleltnnllllpitmivlliAKTVGDSFNPSIYEIILELKGLPFLDAHPEPWMRTLTVGELIDAKPPVITLSGIEKVSQIVDVLRNTTHNGFPVLDEGVVPPSGLANVATELHGLILRAHLVLALKKKWFLQEKRRTEEWEVREKFSWVELAEREGKIEEVAVTSEEMEMYIDLHPLTNTTPYTVIESMSVAKAMVLFRQVGLRHLLVVPKYEAAGVSPVVGILTRQDLRAFNILTAFPHLERSKSGQKH
******************SSTCIFTLFHCRKGKMHKLLLALSVSVFTSVCQYCLPFLADCKACDPSFPETCPTNGRSGNFKQFNCPNGHYNDLATLLLTTNDDAVRNIFSSNTPTEFQPSSILIFFILYCILGLITFGIAVPSGLFLPIILMGSAYGRLLGMAMGSYTNIDQGLYAVLGAASLMAGSMRMTVSLCVIFLELTNNLLLLPITMIVLLIAKTVGDSFNPSIYEIILELKGLPFLDAHPEPWMRTLTVGELIDAKPPVITLSGIEKVSQIVDVLRNTTHNGFPVLDEGVVPPSGLANVATELHGLILRAHLVLALKKKWFLQEKRRTEEWEVREKFSWVELAEREGKIEEVAVTSEEMEMYIDLHPLTNTTPYTVIESMSVAKAMVLFRQVGLRHLLVVPKYEAAGVSPVVGILTRQDLRAFNILTAFPH**********
MLGFTSKTRFTVKKAENHSSTCIFTLFHCRKGKMHKLLLALSVSVFTSVCQYCLPFLADCKACDPSFPETCPTNGRSGNFKQFNCPNGHYNDLATLLLTTNDDAVRNIFSSNTPTEFQPSSILIFFILYCILGLITFGIAVPSGLFLPIILMGSAYGRLLGMAMGSYTNIDQGLYAVLGAASLMAGSMRMTVSLCVIFLELTNNLLLLPITMIVLLIAKTVGDSFNPSIYEIILELKGLPFLDAHPEPWMRTLTVGELIDAKPPVITLSGIEKVSQIVDVLRNTTHNGFPVLDEGVVPPSGLANVATELHGLILRAHLVLALKKKWFLQEKRRTEEWEVREKFSWVELAEREGKIEEVAVTSEEMEMYIDLHPLTNTTPYTVIESMSVAKAMVLFRQVGLRHLLVVPKYEAAGVSPVVGILTRQDLRAFNIL***************
MLGFTSKTRFTVKKAENHSSTCIFTLFHCRKGKMHKLLLALSVSVFTSVCQYCLPFLADCKACDPSFPETCPTNGRSGNFKQFNCPNGHYNDLATLLLTTNDDAVRNIFSSNTPTEFQPSSILIFFILYCILGLITFGIAVPSGLFLPIILMGSAYGRLLGMAMGSYTNIDQGLYAVLGAASLMAGSMRMTVSLCVIFLELTNNLLLLPITMIVLLIAKTVGDSFNPSIYEIILELKGLPFLDAHPEPWMRTLTVGELIDAKPPVITLSGIEKVSQIVDVLRNTTHNGFPVLDEGVVPPSGLANVATELHGLILRAHLVLALKKKWFLQEKRRTEEWEVREKFSWVELAEREGKIEEVAVTSEEMEMYIDLHPLTNTTPYTVIESMSVAKAMVLFRQVGLRHLLVVPKYEAAGVSPVVGILTRQDLRAFNILTAFPHL*********
*LGFTSKTRFTVKKAENHSSTCIFTLFHCRKGKMHKLLLALSVSVFTSVCQYCLPFLADCKACDPSFPETCPTNGRSGNFKQFNCPNGHYNDLATLLLTTNDDAVRNIFSSNTPTEFQPSSILIFFILYCILGLITFGIAVPSGLFLPIILMGSAYGRLLGMAMGSYTNIDQGLYAVLGAASLMAGSMRMTVSLCVIFLELTNNLLLLPITMIVLLIAKTVGDSFNPSIYEIILELKGLPFLDAHPEPWMRTLTVGELIDAKPPVITLSGIEKVSQIVDVLRNTTHNGFPVLDEGVVPPSGLANVATELHGLILRAHLVLALKKKWFLQEKRRTEEWEVREKFSWVELAEREGKIEEVAVTSEEMEMYIDLHPLTNTTPYTVIESMSVAKAMVLFRQVGLRHLLVVPKYEAAGVSPVVGILTRQDLRAFNILTAFPHL*********
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLGFTSKTRFTVKKAENHSSTCIFTLFHCRKGKMHKLLLALSVSVFTSVCQYCLPFLADCKACDPSFPETCPTNGRSGNFKQFNCPNGHYNDLATLLLTTNDDAVRNIFSSNTPTEFQPSSILIFFILYCILGLITFGIAVPSGLFLPIILMGSAYGRLLGMAMGSYTNIDQGLYAVLGAASLMAGSMRMTVSLCVIFLELTNNLLLLPITMIVLLIAKTVGDSFNPSIYEIILELKGLPFLDAHPEPWMRTLTVGELIDAKPPVITLSGIEKVSQIVDVLRNTTHNGFPVLDEGVVPPSGLANVATELHGLILRAHLVLALKKKWFLQEKRRTEEWEVREKFSWVELAEREGKIEEVAVTSEEMEMYIDLHPLTNTTPYTVIESMSVAKAMVLFRQVGLRHLLVVPKYEAAGVSPVVGILTRQDLRAFNILTAFPHLERSKSGQKH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query447 2.2.26 [Sep-21-2011]
P92942780 Chloride channel protein yes no 0.935 0.535 0.811 0.0
P92941775 Chloride channel protein no no 0.917 0.529 0.802 0.0
P60300765 Putative chloride channel no no 0.899 0.525 0.522 1e-114
Q96282779 Chloride channel protein no no 0.890 0.510 0.487 1e-105
P92943792 Chloride channel protein no no 0.859 0.484 0.434 2e-79
Q86AZ6815 Chloride channel protein yes no 0.865 0.474 0.348 2e-55
Q75JF3757 Chloride channel protein no no 0.838 0.495 0.329 3e-52
P51799803 H(+)/Cl(-) exchange trans yes no 0.816 0.454 0.335 9e-52
O70496803 H(+)/Cl(-) exchange trans yes no 0.816 0.454 0.333 2e-51
P51798805 H(+)/Cl(-) exchange trans yes no 0.818 0.454 0.326 9e-50
>sp|P92942|CLCB_ARATH Chloride channel protein CLC-b OS=Arabidopsis thaliana GN=CLC-B PE=1 SV=1 Back     alignment and function desciption
 Score =  686 bits (1769), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/418 (81%), Positives = 374/418 (89%)

Query: 30  RKGKMHKLLLALSVSVFTSVCQYCLPFLADCKACDPSFPETCPTNGRSGNFKQFNCPNGH 89
            KGK+HK+LL+L+VS+FTSVC Y LPFLA CK CDPS  E CPTNGRSGNFKQF+CP G+
Sbjct: 363 EKGKIHKVLLSLTVSLFTSVCLYGLPFLAKCKPCDPSIDEICPTNGRSGNFKQFHCPKGY 422

Query: 90  YNDLATLLLTTNDDAVRNIFSSNTPTEFQPSSILIFFILYCILGLITFGIAVPSGLFLPI 149
           YNDLATLLLTTNDDAVRN+FSSNTP EF   S+ IFF+LYCILGL TFGIA PSGLFLPI
Sbjct: 423 YNDLATLLLTTNDDAVRNLFSSNTPNEFGMGSLWIFFVLYCILGLFTFGIATPSGLFLPI 482

Query: 150 ILMGSAYGRLLGMAMGSYTNIDQGLYAVLGAASLMAGSMRMTVSLCVIFLELTNNLLLLP 209
           ILMG+AYGR+LG AMGSYT+IDQGLYAVLGAA+LMAGSMRMTVSLCVIFLELTNNLLLLP
Sbjct: 483 ILMGAAYGRMLGAAMGSYTSIDQGLYAVLGAAALMAGSMRMTVSLCVIFLELTNNLLLLP 542

Query: 210 ITMIVLLIAKTVGDSFNPSIYEIILELKGLPFLDAHPEPWMRTLTVGELIDAKPPVITLS 269
           ITMIVLLIAKTVGDSFNPSIY+IIL LKGLPFL+A+PEPWMR LTVGEL DAKPPV+TL 
Sbjct: 543 ITMIVLLIAKTVGDSFNPSIYDIILHLKGLPFLEANPEPWMRNLTVGELGDAKPPVVTLQ 602

Query: 270 GIEKVSQIVDVLRNTTHNGFPVLDEGVVPPSGLANVATELHGLILRAHLVLALKKKWFLQ 329
           G+EKVS IVDVL+NTTHN FPVLDE  VP  GLA  ATELHGLILRAHLV  LKK+WFL 
Sbjct: 603 GVEKVSNIVDVLKNTTHNAFPVLDEAEVPQVGLATGATELHGLILRAHLVKVLKKRWFLT 662

Query: 330 EKRRTEEWEVREKFSWVELAEREGKIEEVAVTSEEMEMYIDLHPLTNTTPYTVIESMSVA 389
           EKRRTEEWEVREKF W ELAERE   ++VA+TS EMEMY+DLHPLTNTTPYTV+E+MSVA
Sbjct: 663 EKRRTEEWEVREKFPWDELAEREDNFDDVAITSAEMEMYVDLHPLTNTTPYTVMENMSVA 722

Query: 390 KAMVLFRQVGLRHLLVVPKYEAAGVSPVVGILTRQDLRAFNILTAFPHLERSKSGQKH 447
           KA+VLFRQVGLRHLL+VPK +A+G+ PVVGILTRQDLRA+NIL AFP LE+SK G+ H
Sbjct: 723 KALVLFRQVGLRHLLIVPKIQASGMCPVVGILTRQDLRAYNILQAFPLLEKSKGGKTH 780




Voltage-gated chloride channel.
Arabidopsis thaliana (taxid: 3702)
>sp|P92941|CLCA_ARATH Chloride channel protein CLC-a OS=Arabidopsis thaliana GN=CLC-A PE=1 SV=2 Back     alignment and function description
>sp|P60300|CLCG_ARATH Putative chloride channel-like protein CLC-g OS=Arabidopsis thaliana GN=CBSCLC6 PE=2 SV=2 Back     alignment and function description
>sp|Q96282|CLCC_ARATH Chloride channel protein CLC-c OS=Arabidopsis thaliana GN=CLC-C PE=1 SV=1 Back     alignment and function description
>sp|P92943|CLCD_ARATH Chloride channel protein CLC-d OS=Arabidopsis thaliana GN=CLC-D PE=1 SV=2 Back     alignment and function description
>sp|Q86AZ6|CLCB_DICDI Chloride channel protein B OS=Dictyostelium discoideum GN=clcB PE=3 SV=1 Back     alignment and function description
>sp|Q75JF3|CLCC_DICDI Chloride channel protein C OS=Dictyostelium discoideum GN=clcC PE=3 SV=1 Back     alignment and function description
>sp|P51799|CLCN7_RAT H(+)/Cl(-) exchange transporter 7 OS=Rattus norvegicus GN=Clcn7 PE=2 SV=1 Back     alignment and function description
>sp|O70496|CLCN7_MOUSE H(+)/Cl(-) exchange transporter 7 OS=Mus musculus GN=Clcn7 PE=1 SV=1 Back     alignment and function description
>sp|P51798|CLCN7_HUMAN H(+)/Cl(-) exchange transporter 7 OS=Homo sapiens GN=CLCN7 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query447
255536929 787 chloride channel clc, putative [Ricinus 0.935 0.531 0.854 0.0
224060241 785 Cl-channel clc-7 [Populus trichocarpa] g 0.957 0.545 0.829 0.0
359488503 789 PREDICTED: chloride channel protein CLC- 0.957 0.542 0.825 0.0
356571521 790 PREDICTED: chloride channel protein CLC- 0.964 0.545 0.802 0.0
301318134 789 chloride channel ClC4 [Vitis vinifera] 0.957 0.542 0.822 0.0
351722961 783 chloride channel [Glycine max] gi|662201 0.948 0.541 0.8 0.0
4768916 786 CLC-Nt2 protein [Nicotiana tabacum] 0.961 0.547 0.789 0.0
15232105 780 chloride channel protein CLC-b [Arabidop 0.935 0.535 0.811 0.0
449441686 789 PREDICTED: chloride channel protein CLC- 0.959 0.543 0.784 0.0
297814954 779 CLC-B [Arabidopsis lyrata subsp. lyrata] 0.935 0.536 0.806 0.0
>gi|255536929|ref|XP_002509531.1| chloride channel clc, putative [Ricinus communis] gi|223549430|gb|EEF50918.1| chloride channel clc, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  728 bits (1878), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/418 (85%), Positives = 391/418 (93%)

Query: 30  RKGKMHKLLLALSVSVFTSVCQYCLPFLADCKACDPSFPETCPTNGRSGNFKQFNCPNGH 89
           +KGKMHKLLL+L+VS+FTSVC Y LPFLA C+ CDPS  E CPTN RSGNFKQFNCP GH
Sbjct: 369 QKGKMHKLLLSLTVSLFTSVCLYGLPFLAKCQPCDPSVTELCPTNDRSGNFKQFNCPKGH 428

Query: 90  YNDLATLLLTTNDDAVRNIFSSNTPTEFQPSSILIFFILYCILGLITFGIAVPSGLFLPI 149
           YNDLATLLLTTNDDAVRNIFSSNTP EFQP+++LIFF LYC+LGL TFGIAVPSGLFLPI
Sbjct: 429 YNDLATLLLTTNDDAVRNIFSSNTPHEFQPATLLIFFALYCVLGLFTFGIAVPSGLFLPI 488

Query: 150 ILMGSAYGRLLGMAMGSYTNIDQGLYAVLGAASLMAGSMRMTVSLCVIFLELTNNLLLLP 209
           ILMGSAYGRLLG+AMGSYTN+DQGLYAVLGAASLMAGSMRMTVSLCVIFLELTNNLLLLP
Sbjct: 489 ILMGSAYGRLLGVAMGSYTNLDQGLYAVLGAASLMAGSMRMTVSLCVIFLELTNNLLLLP 548

Query: 210 ITMIVLLIAKTVGDSFNPSIYEIILELKGLPFLDAHPEPWMRTLTVGELIDAKPPVITLS 269
           ITMIVLLIAKTVGDSFNPSIYEIIL LKGLPFLDA+PEPWMR LTVGEL DAKPP++TL 
Sbjct: 549 ITMIVLLIAKTVGDSFNPSIYEIILHLKGLPFLDANPEPWMRNLTVGELADAKPPLVTLC 608

Query: 270 GIEKVSQIVDVLRNTTHNGFPVLDEGVVPPSGLANVATELHGLILRAHLVLALKKKWFLQ 329
           G+EKVS+IVDVL+NTT+NGFPV+D+GV+PP GLA  ATELHGLILRAHLV A+KKKWFL+
Sbjct: 609 GVEKVSRIVDVLKNTTYNGFPVVDDGVIPPVGLATGATELHGLILRAHLVQAIKKKWFLR 668

Query: 330 EKRRTEEWEVREKFSWVELAEREGKIEEVAVTSEEMEMYIDLHPLTNTTPYTVIESMSVA 389
           EKRRTEEWEVR+KF+WV+LAERE KIEEVAVT +EMEMY+DLHPLTNTTPYTV+ESMSVA
Sbjct: 669 EKRRTEEWEVRQKFTWVDLAERELKIEEVAVTRDEMEMYVDLHPLTNTTPYTVVESMSVA 728

Query: 390 KAMVLFRQVGLRHLLVVPKYEAAGVSPVVGILTRQDLRAFNILTAFPHLERSKSGQKH 447
           KAMVLFRQVGLRHLL+VPKYEA+GV PVVGILTRQDLRA+NIL+AFPHL RSK  +K 
Sbjct: 729 KAMVLFRQVGLRHLLIVPKYEASGVPPVVGILTRQDLRAYNILSAFPHLARSKDREKR 786




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224060241|ref|XP_002300101.1| Cl-channel clc-7 [Populus trichocarpa] gi|222847359|gb|EEE84906.1| Cl-channel clc-7 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359488503|ref|XP_002273594.2| PREDICTED: chloride channel protein CLC-b [Vitis vinifera] gi|296082356|emb|CBI21361.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356571521|ref|XP_003553925.1| PREDICTED: chloride channel protein CLC-b-like [Glycine max] Back     alignment and taxonomy information
>gi|301318134|gb|ADK66982.1| chloride channel ClC4 [Vitis vinifera] Back     alignment and taxonomy information
>gi|351722961|ref|NP_001236494.1| chloride channel [Glycine max] gi|66220164|gb|AAY43007.1| chloride channel [Glycine max] Back     alignment and taxonomy information
>gi|4768916|gb|AAD29679.1|AF133209_1 CLC-Nt2 protein [Nicotiana tabacum] Back     alignment and taxonomy information
>gi|15232105|ref|NP_189353.1| chloride channel protein CLC-b [Arabidopsis thaliana] gi|41688457|sp|P92942.1|CLCB_ARATH RecName: Full=Chloride channel protein CLC-b; Short=AtCLC-b; AltName: Full=CBS domain-containing protein CBSCLC7 gi|1742955|emb|CAA96058.1| CLC-b chloride channel protein [Arabidopsis thaliana] gi|9294082|dbj|BAB01934.1| CLC-d chloride channel; anion channel protein [Arabidopsis thaliana] gi|17064884|gb|AAL32596.1| CLC-d chloride channel; anion channel protein [Arabidopsis thaliana] gi|332643754|gb|AEE77275.1| chloride channel protein CLC-b [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449441686|ref|XP_004138613.1| PREDICTED: chloride channel protein CLC-b-like [Cucumis sativus] gi|449523299|ref|XP_004168661.1| PREDICTED: chloride channel protein CLC-b-like [Cucumis sativus] gi|386649465|gb|AFJ15538.1| chloride channel a [Cucumis sativus] Back     alignment and taxonomy information
>gi|297814954|ref|XP_002875360.1| CLC-B [Arabidopsis lyrata subsp. lyrata] gi|297321198|gb|EFH51619.1| CLC-B [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query447
TAIR|locus:2095123780 CLC-B "chloride channel B" [Ar 0.959 0.55 0.716 7.1e-164
TAIR|locus:2164466775 CLC-A "chloride channel A" [Ar 0.941 0.543 0.714 9.6e-160
TAIR|locus:2158809779 CLC-C "chloride channel C" [Ar 0.894 0.513 0.428 1.6e-86
TAIR|locus:2179724792 CLC-D "chloride channel D" [Ar 0.859 0.484 0.382 6.7e-65
DICTYBASE|DDB_G0276865815 clcB "CLC 6/7 family protein" 0.588 0.322 0.360 2.3e-51
ZFIN|ZDB-GENE-061103-196795 clcn7 "chloride channel 7" [Da 0.836 0.470 0.313 7.2e-45
UNIPROTKB|F1RG09809 LOC100626534 "Uncharacterized 0.762 0.421 0.330 5.7e-43
DICTYBASE|DDB_G0276229757 clcC "CLC 6/7 family protein" 0.841 0.496 0.305 8.8e-43
RGD|61836803 Clcn7 "chloride channel, volta 0.769 0.428 0.327 9.1e-43
UNIPROTKB|E2R0Q0747 CLCN7 "Uncharacterized protein 0.765 0.457 0.326 1.4e-42
TAIR|locus:2095123 CLC-B "chloride channel B" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1595 (566.5 bits), Expect = 7.1e-164, P = 7.1e-164
 Identities = 308/430 (71%), Positives = 346/430 (80%)

Query:    18 HSSTCIFTLFHCRKGKMHKLLLALSVSVFTSVCQYCLPFLADCKACDPSFPETCPTNGRS 77
             H    ++ L +  KGK+HK+LL+L+VS+FTSVC Y LPFLA CK CDPS  E CPTNGRS
Sbjct:   352 HKVLRLYNLIN-EKGKIHKVLLSLTVSLFTSVCLYGLPFLAKCKPCDPSIDEICPTNGRS 410

Query:    78 GNFKQFNCPNGHYXXXXXXXXXXXXXXVRNIFSSNTPTEFQPSSILIFFILYCILGLITF 137
             GNFKQF+CP G+Y              VRN+FSSNTP EF   S+ IFF+LYCILGL TF
Sbjct:   411 GNFKQFHCPKGYYNDLATLLLTTNDDAVRNLFSSNTPNEFGMGSLWIFFVLYCILGLFTF 470

Query:   138 GIAVPSGLFLPIILMGSAYGRLLGMAMGSYTNIDQGLYAVLGAASLMAGSMRMTVSLCVI 197
             GIA PSGLFLPIILMG+AYGR+LG AMGSYT+IDQGLYAVLGAA+LMAGSMRMTVSLCVI
Sbjct:   471 GIATPSGLFLPIILMGAAYGRMLGAAMGSYTSIDQGLYAVLGAAALMAGSMRMTVSLCVI 530

Query:   198 FXXXXXXXXXXXXXXXXXXXAKTVGDSFNPSIYEIILELKGLPFLDAHPEPWMRTLTVGE 257
             F                   AKTVGDSFNPSIY+IIL LKGLPFL+A+PEPWMR LTVGE
Sbjct:   531 FLELTNNLLLLPITMIVLLIAKTVGDSFNPSIYDIILHLKGLPFLEANPEPWMRNLTVGE 590

Query:   258 LIDAKPPVITLSGIEKVSQIVDVLRNTTHNGFPVLDEGVVPPSGLANVATELHGLILRAH 317
             L DAKPPV+TL G+EKVS IVDVL+NTTHN FPVLDE  VP  GLA  ATELHGLILRAH
Sbjct:   591 LGDAKPPVVTLQGVEKVSNIVDVLKNTTHNAFPVLDEAEVPQVGLATGATELHGLILRAH 650

Query:   318 LVLALKKKWFLQEKRRTEEWEVREKFSWVELAEREGKIEEVAVTSEEMEMYIDLHPLTNT 377
             LV  LKK+WFL EKRRTEEWEVREKF W ELAERE   ++VA+TS EMEMY+DLHPLTNT
Sbjct:   651 LVKVLKKRWFLTEKRRTEEWEVREKFPWDELAEREDNFDDVAITSAEMEMYVDLHPLTNT 710

Query:   378 TPYTVIESMSVAKAMVLFRQVGLRHLLVVPKYEAAGVSPVVGILTRQDLRAFNILTAFPH 437
             TPYTV+E+MSVAKA+VLFRQVGLRHLL+VPK +A+G+ PVVGILTRQDLRA+NIL AFP 
Sbjct:   711 TPYTVMENMSVAKALVLFRQVGLRHLLIVPKIQASGMCPVVGILTRQDLRAYNILQAFPL 770

Query:   438 LERSKSGQKH 447
             LE+SK G+ H
Sbjct:   771 LEKSKGGKTH 780




GO:0005216 "ion channel activity" evidence=IEA
GO:0005247 "voltage-gated chloride channel activity" evidence=IEA;ISS
GO:0005253 "anion channel activity" evidence=ISS
GO:0005634 "nucleus" evidence=ISM
GO:0006821 "chloride transport" evidence=IEA;ISS
GO:0016020 "membrane" evidence=IEA
GO:0055085 "transmembrane transport" evidence=IEA
GO:0009671 "nitrate:hydrogen symporter activity" evidence=IDA
GO:0009705 "plant-type vacuole membrane" evidence=IDA
GO:0005622 "intracellular" evidence=TAS
TAIR|locus:2164466 CLC-A "chloride channel A" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2158809 CLC-C "chloride channel C" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2179724 CLC-D "chloride channel D" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0276865 clcB "CLC 6/7 family protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-061103-196 clcn7 "chloride channel 7" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1RG09 LOC100626534 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0276229 clcC "CLC 6/7 family protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
RGD|61836 Clcn7 "chloride channel, voltage-sensitive 7" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E2R0Q0 CLCN7 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P92942CLCB_ARATHNo assigned EC number0.81100.93510.5358yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
estExt_fgenesh4_pm.C_LG_I0924
Cl-channel clc-7 (785 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query447
cd03685466 cd03685, ClC_6_like, ClC-6-like chloride channel p 5e-67
cd01036416 cd01036, ClC_euk, Chloride channel, ClC 1e-32
cd03684445 cd03684, ClC_3_like, ClC-3-like chloride channel p 4e-28
cd03683426 cd03683, ClC_1_like, ClC-1-like chloride channel p 2e-23
pfam00654345 pfam00654, Voltage_CLC, Voltage gated chloride cha 2e-21
cd04591105 cd04591, CBS_pair_EriC_assoc_euk_bac, This cd cont 4e-19
COG0038443 COG0038, EriC, Chloride channel protein EriC [Inor 2e-15
cd00400383 cd00400, Voltage_gated_ClC, CLC voltage-gated chlo 6e-14
cd01031402 cd01031, EriC, ClC chloride channel EriC 8e-13
PRK05277438 PRK05277, PRK05277, chloride channel protein; Prov 7e-10
PRK01862574 PRK01862, PRK01862, putative voltage-gated ClC-typ 1e-06
cd02205113 cd02205, CBS_pair, The CBS domain, named after hum 3e-05
cd01034390 cd01034, EriC_like, ClC chloride channel family 7e-04
cd04610107 cd04610, CBS_pair_ParBc_assoc, This cd contains tw 0.001
pfam0057157 pfam00571, CBS, CBS domain 0.002
cd01033388 cd01033, ClC_like, Putative ClC chloride channel 0.003
>gnl|CDD|239657 cd03685, ClC_6_like, ClC-6-like chloride channel proteins Back     alignment and domain information
 Score =  220 bits (564), Expect = 5e-67
 Identities = 83/127 (65%), Positives = 103/127 (81%), Gaps = 3/127 (2%)

Query: 119 PSSILIFFILYCILGLITFGIAVPSGLFLPIILMGSAYGRLLGMAMGSY---TNIDQGLY 175
           P ++LIFF+LY  L   TFGIAVPSGLF+P+IL+G+AYGRL+G+ +GSY   T+ID GLY
Sbjct: 333 PQTLLIFFVLYYFLACWTFGIAVPSGLFIPMILIGAAYGRLVGILLGSYFGFTSIDPGLY 392

Query: 176 AVLGAASLMAGSMRMTVSLCVIFLELTNNLLLLPITMIVLLIAKTVGDSFNPSIYEIILE 235
           A+LGAA+ + G MRMTVSL VI LELTNNL  LP  M+VL+IAK VGD FN  IY+II++
Sbjct: 393 ALLGAAAFLGGVMRMTVSLTVILLELTNNLTYLPPIMLVLMIAKWVGDYFNEGIYDIIIQ 452

Query: 236 LKGLPFL 242
           LKG+PFL
Sbjct: 453 LKGVPFL 459


This CD includes ClC-6, ClC-7 and ClC-B, C, D in plants. Proteins in this family are ubiquitous in eukarotes and their functions are unclear. They are expressed in intracellular organelles membranes. This family belongs to the ClC superfamily of chloride ion channels, which share the unique double-barreled architecture and voltage-dependent gating mechanism. The gating is conferred by the permeating anion itself, acting as the gating charge. ClC chloride ion channel superfamily perform a variety of functions including cellular excitability regulation, cell volume regulation, membrane potential stabilization, acidification of intracellular organelles, signal transduction, and transepithelial transport in animals. Length = 466

>gnl|CDD|238507 cd01036, ClC_euk, Chloride channel, ClC Back     alignment and domain information
>gnl|CDD|239656 cd03684, ClC_3_like, ClC-3-like chloride channel proteins Back     alignment and domain information
>gnl|CDD|239655 cd03683, ClC_1_like, ClC-1-like chloride channel proteins Back     alignment and domain information
>gnl|CDD|216046 pfam00654, Voltage_CLC, Voltage gated chloride channel Back     alignment and domain information
>gnl|CDD|239964 cd04591, CBS_pair_EriC_assoc_euk_bac, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes and bacteria Back     alignment and domain information
>gnl|CDD|223116 COG0038, EriC, Chloride channel protein EriC [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|238233 cd00400, Voltage_gated_ClC, CLC voltage-gated chloride channel Back     alignment and domain information
>gnl|CDD|238504 cd01031, EriC, ClC chloride channel EriC Back     alignment and domain information
>gnl|CDD|235385 PRK05277, PRK05277, chloride channel protein; Provisional Back     alignment and domain information
>gnl|CDD|234987 PRK01862, PRK01862, putative voltage-gated ClC-type chloride channel ClcB; Provisional Back     alignment and domain information
>gnl|CDD|239067 cd02205, CBS_pair, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|238506 cd01034, EriC_like, ClC chloride channel family Back     alignment and domain information
>gnl|CDD|239983 cd04610, CBS_pair_ParBc_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a ParBc (ParB-like nuclease) domain downstream Back     alignment and domain information
>gnl|CDD|201313 pfam00571, CBS, CBS domain Back     alignment and domain information
>gnl|CDD|238505 cd01033, ClC_like, Putative ClC chloride channel Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 447
KOG0474762 consensus Cl- channel CLC-7 and related proteins ( 100.0
KOG0475696 consensus Cl- channel CLC-3 and related proteins ( 100.0
PRK01862574 putative voltage-gated ClC-type chloride channel C 100.0
KOG0476 931 consensus Cl- channel CLC-2 and related proteins ( 100.0
cd03684445 ClC_3_like ClC-3-like chloride channel proteins. T 99.96
cd03685466 ClC_6_like ClC-6-like chloride channel proteins. T 99.95
cd03683426 ClC_1_like ClC-1-like chloride channel proteins. T 99.93
PRK01610418 putative voltage-gated ClC-type chloride channel C 99.93
cd01031402 EriC ClC chloride channel EriC. This domain is fou 99.92
cd01036416 ClC_euk Chloride channel, ClC. These domains are f 99.92
PF00654355 Voltage_CLC: Voltage gated chloride channel Mutati 99.91
PRK05277438 chloride channel protein; Provisional 99.91
COG0038443 EriC Chloride channel protein EriC [Inorganic ion 99.9
cd01034390 EriC_like ClC chloride channel family. These prote 99.88
cd01033388 ClC_like Putative ClC chloride channel. Clc protei 99.88
cd00400383 Voltage_gated_ClC CLC voltage-gated chloride chann 99.84
cd03682378 ClC_sycA_like ClC sycA-like chloride channel prote 99.83
PRK03655414 putative ion channel protein; Provisional 99.71
COG2524294 Predicted transcriptional regulator, contains C-te 99.68
PRK11543321 gutQ D-arabinose 5-phosphate isomerase; Provisiona 99.66
COG3448382 CBS-domain-containing membrane protein [Signal tra 99.66
PRK10892326 D-arabinose 5-phosphate isomerase; Provisional 99.65
COG4109 432 Predicted transcriptional regulator containing CBS 99.63
cd04641120 CBS_pair_28 The CBS domain, named after human CBS, 99.52
cd04603111 CBS_pair_KefB_assoc This cd contains two tandem re 99.5
cd04619114 CBS_pair_6 The CBS domain, named after human CBS, 99.5
COG3620187 Predicted transcriptional regulator with C-termina 99.49
PRK07807 479 inosine 5-monophosphate dehydrogenase; Validated 99.49
cd0461898 CBS_pair_5 The CBS domain, named after human CBS, 99.48
PRK15094292 magnesium/cobalt efflux protein CorC; Provisional 99.48
TIGR03520408 GldE gliding motility-associated protein GldE. Mem 99.47
cd04600124 CBS_pair_HPP_assoc This cd contains two tandem rep 99.44
cd04639111 CBS_pair_26 The CBS domain, named after human CBS, 99.44
cd04593115 CBS_pair_EriC_assoc_bac_arch This cd contains two 99.44
cd04617118 CBS_pair_4 The CBS domain, named after human CBS, 99.42
cd04596108 CBS_pair_DRTGG_assoc This cd contains two tandem r 99.42
cd04605110 CBS_pair_MET2_assoc This cd contains two tandem re 99.42
cd04608124 CBS_pair_PALP_assoc This cd contains two tandem re 99.42
PRK07107 502 inosine 5-monophosphate dehydrogenase; Validated 99.41
cd04623113 CBS_pair_10 The CBS domain, named after human CBS, 99.4
cd0461496 CBS_pair_1 The CBS domain, named after human CBS, 99.4
cd04801114 CBS_pair_M50_like This cd contains two tandem repe 99.39
cd04630114 CBS_pair_17 The CBS domain, named after human CBS, 99.39
cd04583109 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tan 99.39
cd04803122 CBS_pair_15 The CBS domain, named after human CBS, 99.39
TIGR01137454 cysta_beta cystathionine beta-synthase. Members of 99.39
cd04586135 CBS_pair_BON_assoc This cd contains two tandem rep 99.39
cd04582106 CBS_pair_ABC_OpuCA_assoc This cd contains two tand 99.39
cd04607113 CBS_pair_NTP_transferase_assoc This cd contains tw 99.38
cd04632128 CBS_pair_19 The CBS domain, named after human CBS, 99.38
cd04629114 CBS_pair_16 The CBS domain, named after human CBS, 99.38
cd04613114 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two 99.38
cd04615113 CBS_pair_2 The CBS domain, named after human CBS, 99.37
cd04624112 CBS_pair_11 The CBS domain, named after human CBS, 99.37
cd04627123 CBS_pair_14 The CBS domain, named after human CBS, 99.37
cd04588110 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains 99.36
cd04604114 CBS_pair_KpsF_GutQ_assoc This cd contains two tand 99.36
cd04636132 CBS_pair_23 The CBS domain, named after human CBS, 99.36
cd04595110 CBS_pair_DHH_polyA_Pol_assoc This cd contains two 99.36
cd04631125 CBS_pair_18 The CBS domain, named after human CBS, 99.36
cd04642126 CBS_pair_29 The CBS domain, named after human CBS, 99.36
cd04635122 CBS_pair_22 The CBS domain, named after human CBS, 99.35
cd04643116 CBS_pair_30 The CBS domain, named after human CBS, 99.35
cd04626111 CBS_pair_13 The CBS domain, named after human CBS, 99.35
cd04591105 CBS_pair_EriC_assoc_euk_bac This cd contains two t 99.35
cd04620115 CBS_pair_7 The CBS domain, named after human CBS, 99.34
TIGR00400 449 mgtE Mg2+ transporter (mgtE). This family of proka 99.34
cd04602114 CBS_pair_IMPDH_2 This cd contains two tandem repea 99.33
cd04621135 CBS_pair_8 The CBS domain, named after human CBS, 99.32
cd04585122 CBS_pair_ACT_assoc2 This cd contains two tandem re 99.32
PLN02274 505 inosine-5'-monophosphate dehydrogenase 99.32
cd04622113 CBS_pair_9 The CBS domain, named after human CBS, 99.32
PRK11573413 hypothetical protein; Provisional 99.32
cd04612111 CBS_pair_SpoIVFB_EriC_assoc This cd contains two t 99.31
cd04611111 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two 99.31
TIGR00393268 kpsF KpsF/GutQ family protein. This model describe 99.31
TIGR01303 475 IMP_DH_rel_1 IMP dehydrogenase family protein. Thi 99.31
cd04637122 CBS_pair_24 The CBS domain, named after human CBS, 99.31
cd04640126 CBS_pair_27 The CBS domain, named after human CBS, 99.31
cd04590111 CBS_pair_CorC_HlyC_assoc This cd contains two tand 99.31
cd04800111 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains 99.3
cd04625112 CBS_pair_12 The CBS domain, named after human CBS, 99.3
cd04587113 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains 99.3
cd04601110 CBS_pair_IMPDH This cd contains two tandem repeats 99.3
cd04589111 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains 99.29
PRK05567 486 inosine 5'-monophosphate dehydrogenase; Reviewed 99.29
PTZ00314 495 inosine-5'-monophosphate dehydrogenase; Provisiona 99.29
TIGR01302 450 IMP_dehydrog inosine-5'-monophosphate dehydrogenas 99.29
cd00400383 Voltage_gated_ClC CLC voltage-gated chloride chann 99.28
cd04802112 CBS_pair_3 The CBS domain, named after human CBS, 99.28
cd04599105 CBS_pair_GGDEF_assoc2 This cd contains two tandem 99.27
cd02205113 CBS_pair The CBS domain, named after human CBS, is 99.27
cd04606109 CBS_pair_Mg_transporter This cd contains two tande 99.26
PRK14869 546 putative manganese-dependent inorganic pyrophospha 99.26
cd04609110 CBS_pair_PALP_assoc2 This cd contains two tandem r 99.26
cd04594104 CBS_pair_EriC_assoc_archaea This cd contains two t 99.25
COG0517117 FOG: CBS domain [General function prediction only] 99.25
cd01031402 EriC ClC chloride channel EriC. This domain is fou 99.25
cd04633121 CBS_pair_20 The CBS domain, named after human CBS, 99.24
cd04610107 CBS_pair_ParBc_assoc This cd contains two tandem r 99.24
cd04584121 CBS_pair_ACT_assoc This cd contains two tandem rep 99.22
cd04598119 CBS_pair_GGDEF_assoc This cd contains two tandem r 99.2
cd04634143 CBS_pair_21 The CBS domain, named after human CBS, 99.18
cd04638106 CBS_pair_25 The CBS domain, named after human CBS, 99.17
COG2905 610 Predicted signal-transduction protein containing c 99.16
COG1253429 TlyC Hemolysins and related proteins containing CB 99.14
PRK05277438 chloride channel protein; Provisional 99.14
COG2239 451 MgtE Mg/Co/Ni transporter MgtE (contains CBS domai 99.08
COG4536423 CorB Putative Mg2+ and Co2+ transporter CorB [Inor 99.06
cd04592133 CBS_pair_EriC_assoc_euk This cd contains two tande 98.98
cd03682378 ClC_sycA_like ClC sycA-like chloride channel prote 98.93
PF0057157 CBS: CBS domain CBS domain web page. Mutations in 98.92
COG4535293 CorC Putative Mg2+ and Co2+ transporter CorC [Inor 98.79
PRK01862 574 putative voltage-gated ClC-type chloride channel C 98.78
PF00654355 Voltage_CLC: Voltage gated chloride channel Mutati 98.78
PF0057157 CBS: CBS domain CBS domain web page. Mutations in 98.76
COG0038443 EriC Chloride channel protein EriC [Inorganic ion 98.74
PRK01610418 putative voltage-gated ClC-type chloride channel C 98.68
KOG1764381 consensus 5'-AMP-activated protein kinase, gamma s 98.67
cd01036416 ClC_euk Chloride channel, ClC. These domains are f 98.64
cd03685466 ClC_6_like ClC-6-like chloride channel proteins. T 98.63
cd01034390 EriC_like ClC chloride channel family. These prote 98.59
cd01033388 ClC_like Putative ClC chloride channel. Clc protei 98.59
KOG2550 503 consensus IMP dehydrogenase/GMP reductase [Nucleot 98.54
TIGR01186363 proV glycine betaine/L-proline transport ATP bindi 98.51
cd03684445 ClC_3_like ClC-3-like chloride channel proteins. T 98.48
PRK10070400 glycine betaine transporter ATP-binding subunit; P 98.48
COG3448382 CBS-domain-containing membrane protein [Signal tra 98.33
PRK03655414 putative ion channel protein; Provisional 98.31
cd03683426 ClC_1_like ClC-1-like chloride channel proteins. T 98.3
cd04597113 CBS_pair_DRTGG_assoc2 This cd contains two tandem 98.2
TIGR00400 449 mgtE Mg2+ transporter (mgtE). This family of proka 98.12
PRK14869 546 putative manganese-dependent inorganic pyrophospha 98.05
cd04597113 CBS_pair_DRTGG_assoc2 This cd contains two tandem 98.01
cd04603111 CBS_pair_KefB_assoc This cd contains two tandem re 97.91
COG3620187 Predicted transcriptional regulator with C-termina 97.87
COG2524294 Predicted transcriptional regulator, contains C-te 97.85
cd04619114 CBS_pair_6 The CBS domain, named after human CBS, 97.84
cd04641120 CBS_pair_28 The CBS domain, named after human CBS, 97.72
cd0461898 CBS_pair_5 The CBS domain, named after human CBS, 97.67
cd04607113 CBS_pair_NTP_transferase_assoc This cd contains tw 97.62
smart0011649 CBS Domain in cystathionine beta-synthase and othe 97.62
cd04600124 CBS_pair_HPP_assoc This cd contains two tandem rep 97.61
cd04592133 CBS_pair_EriC_assoc_euk This cd contains two tande 97.58
cd04620115 CBS_pair_7 The CBS domain, named after human CBS, 97.57
cd04606109 CBS_pair_Mg_transporter This cd contains two tande 97.56
cd0461496 CBS_pair_1 The CBS domain, named after human CBS, 97.53
cd04585122 CBS_pair_ACT_assoc2 This cd contains two tandem re 97.52
cd04627123 CBS_pair_14 The CBS domain, named after human CBS, 97.52
PRK05567 486 inosine 5'-monophosphate dehydrogenase; Reviewed 97.51
cd04596108 CBS_pair_DRTGG_assoc This cd contains two tandem r 97.51
cd04615113 CBS_pair_2 The CBS domain, named after human CBS, 97.5
cd04608124 CBS_pair_PALP_assoc This cd contains two tandem re 97.47
cd04625112 CBS_pair_12 The CBS domain, named after human CBS, 97.46
cd04604114 CBS_pair_KpsF_GutQ_assoc This cd contains two tand 97.46
cd04630114 CBS_pair_17 The CBS domain, named after human CBS, 97.45
cd04610107 CBS_pair_ParBc_assoc This cd contains two tandem r 97.45
cd04587113 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains 97.43
cd04635122 CBS_pair_22 The CBS domain, named after human CBS, 97.41
cd04611111 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two 97.41
cd04803122 CBS_pair_15 The CBS domain, named after human CBS, 97.39
cd04583109 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tan 97.38
cd04639111 CBS_pair_26 The CBS domain, named after human CBS, 97.38
PRK07107 502 inosine 5-monophosphate dehydrogenase; Validated 97.38
cd04582106 CBS_pair_ABC_OpuCA_assoc This cd contains two tand 97.37
cd04602114 CBS_pair_IMPDH_2 This cd contains two tandem repea 97.37
cd04621135 CBS_pair_8 The CBS domain, named after human CBS, 97.36
smart0011649 CBS Domain in cystathionine beta-synthase and othe 97.36
cd04605110 CBS_pair_MET2_assoc This cd contains two tandem re 97.35
cd04624112 CBS_pair_11 The CBS domain, named after human CBS, 97.35
cd04613114 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two 97.35
cd04622113 CBS_pair_9 The CBS domain, named after human CBS, 97.34
PRK11543321 gutQ D-arabinose 5-phosphate isomerase; Provisiona 97.34
cd04631125 CBS_pair_18 The CBS domain, named after human CBS, 97.33
cd04801114 CBS_pair_M50_like This cd contains two tandem repe 97.33
cd04802112 CBS_pair_3 The CBS domain, named after human CBS, 97.33
cd04595110 CBS_pair_DHH_polyA_Pol_assoc This cd contains two 97.33
cd04623113 CBS_pair_10 The CBS domain, named after human CBS, 97.32
PRK10892326 D-arabinose 5-phosphate isomerase; Provisional 97.32
cd04643116 CBS_pair_30 The CBS domain, named after human CBS, 97.32
cd04586135 CBS_pair_BON_assoc This cd contains two tandem rep 97.32
cd04588110 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains 97.32
cd04617118 CBS_pair_4 The CBS domain, named after human CBS, 97.3
cd04601110 CBS_pair_IMPDH This cd contains two tandem repeats 97.3
cd04593115 CBS_pair_EriC_assoc_bac_arch This cd contains two 97.27
cd04632128 CBS_pair_19 The CBS domain, named after human CBS, 97.26
PRK07807 479 inosine 5-monophosphate dehydrogenase; Validated 97.25
cd04589111 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains 97.24
cd04629114 CBS_pair_16 The CBS domain, named after human CBS, 97.23
cd04800111 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains 97.23
PLN02274 505 inosine-5'-monophosphate dehydrogenase 97.22
cd04642126 CBS_pair_29 The CBS domain, named after human CBS, 97.22
cd04612111 CBS_pair_SpoIVFB_EriC_assoc This cd contains two t 97.21
COG0517117 FOG: CBS domain [General function prediction only] 97.2
cd04594104 CBS_pair_EriC_assoc_archaea This cd contains two t 97.2
cd04633121 CBS_pair_20 The CBS domain, named after human CBS, 97.2
TIGR01303 475 IMP_DH_rel_1 IMP dehydrogenase family protein. Thi 97.2
cd04599105 CBS_pair_GGDEF_assoc2 This cd contains two tandem 97.19
TIGR01137454 cysta_beta cystathionine beta-synthase. Members of 97.19
cd04636132 CBS_pair_23 The CBS domain, named after human CBS, 97.19
cd04591105 CBS_pair_EriC_assoc_euk_bac This cd contains two t 97.19
cd04626111 CBS_pair_13 The CBS domain, named after human CBS, 97.15
cd04640126 CBS_pair_27 The CBS domain, named after human CBS, 97.14
cd04637122 CBS_pair_24 The CBS domain, named after human CBS, 97.13
cd04590111 CBS_pair_CorC_HlyC_assoc This cd contains two tand 97.11
cd04584121 CBS_pair_ACT_assoc This cd contains two tandem rep 97.1
cd02205113 CBS_pair The CBS domain, named after human CBS, is 97.09
TIGR00393268 kpsF KpsF/GutQ family protein. This model describe 97.08
KOG1764381 consensus 5'-AMP-activated protein kinase, gamma s 97.08
COG4109432 Predicted transcriptional regulator containing CBS 97.06
COG2905 610 Predicted signal-transduction protein containing c 96.89
cd04609110 CBS_pair_PALP_assoc2 This cd contains two tandem r 96.88
TIGR01302 450 IMP_dehydrog inosine-5'-monophosphate dehydrogenas 96.86
cd04598119 CBS_pair_GGDEF_assoc This cd contains two tandem r 96.83
PTZ00314 495 inosine-5'-monophosphate dehydrogenase; Provisiona 96.82
TIGR03520 408 GldE gliding motility-associated protein GldE. Mem 96.81
cd04638106 CBS_pair_25 The CBS domain, named after human CBS, 96.63
COG4175386 ProV ABC-type proline/glycine betaine transport sy 96.6
cd04634143 CBS_pair_21 The CBS domain, named after human CBS, 96.6
PRK15094 292 magnesium/cobalt efflux protein CorC; Provisional 96.56
TIGR03415382 ABC_choXWV_ATP choline ABC transporter, ATP-bindin 96.55
COG2239451 MgtE Mg/Co/Ni transporter MgtE (contains CBS domai 96.33
TIGR01186363 proV glycine betaine/L-proline transport ATP bindi 96.11
KOG0474 762 consensus Cl- channel CLC-7 and related proteins ( 95.4
PRK10070400 glycine betaine transporter ATP-binding subunit; P 95.11
PRK11573 413 hypothetical protein; Provisional 94.66
KOG2550 503 consensus IMP dehydrogenase/GMP reductase [Nucleot 94.24
COG1253 429 TlyC Hemolysins and related proteins containing CB 93.69
KOG0476 931 consensus Cl- channel CLC-2 and related proteins ( 92.84
KOG0475 696 consensus Cl- channel CLC-3 and related proteins ( 90.8
TIGR03415382 ABC_choXWV_ATP choline ABC transporter, ATP-bindin 89.25
KOG2118 498 consensus Predicted membrane protein, contains two 86.94
COG4535 293 CorC Putative Mg2+ and Co2+ transporter CorC [Inor 86.77
COG4175386 ProV ABC-type proline/glycine betaine transport sy 83.64
COG1125309 OpuBA ABC-type proline/glycine betaine transport s 80.07
>KOG0474 consensus Cl- channel CLC-7 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism] Back     alignment and domain information
Probab=100.00  E-value=7.3e-81  Score=626.57  Aligned_cols=406  Identities=61%  Similarity=0.975  Sum_probs=373.5

Q ss_pred             hhcccceeeEeeehhcccCCcchHHHHHHHHHHHHHhHcchhhhhcCCCCCCCCCC-CCCCCCCCCCcccccCCCCCcch
Q 013262           14 KAENHSSTCIFTLFHCRKGKMHKLLLALSVSVFTSVCQYCLPFLADCKACDPSFPE-TCPTNGRSGNFKQFNCPNGHYND   92 (447)
Q Consensus        14 ~~~~~~~~~~~~~~~~~~~~~~~~~e~~~v~~~t~~~~~~~~~~~~c~~~~~~~~~-~c~~~~~~~~~~~~~c~~~~y~~   92 (447)
                      |.+|.+.+.+..+  ++++|.+|++|+++|+++|++++|.+|++..|+||+.+..+ .||+         |+||+|+|||
T Consensus       355 N~Ln~~~~~~r~~--~~k~k~~kvlea~~Vs~~ts~~af~l~~l~~C~P~~~~~~~~~~p~---------f~Cp~~~YNd  423 (762)
T KOG0474|consen  355 NYLNLKKVLRRYN--YEKGKIGKVLEALLVSLVTSVLAFGLPFLADCQPCPPSITEGQCPT---------FFCPDGEYND  423 (762)
T ss_pred             HHHHHHHHHHHHh--ccCchHHHHHHHHHHHHHHHHHHhhhHHHhcCCCCCCCcccccCcc---------ccCCCCchhH
Confidence            5566666655555  89999999999999999999999999999999999876443 6764         9999999999


Q ss_pred             hHHhhcCChHHHHHHHhcCCCCCCcchHHHHHHHHHHHHHHHHHhhccCCccchhhHHHHHHHHHHHHHHHhhccCCcch
Q 013262           93 LATLLLTTNDDAVRNIFSSNTPTEFQPSSILIFFILYCILGLITFGIAVPSGLFLPIILMGSAYGRLLGMAMGSYTNIDQ  172 (447)
Q Consensus        93 l~~l~~~~~~~~i~~l~~~~~~~~~~~~~l~~~~~~k~~~~~~t~g~g~~gG~f~P~l~iGa~~G~~~g~~~~~~~~~~~  172 (447)
                      ||+|||++++++|++|||.++ ++|...+|++|++.+++++++|||+.+|.|+|+|++++||++||++|.++.....++|
T Consensus       424 lAtL~fnt~ddaVrnLFh~~~-~ef~~~tL~iFfv~yf~L~~~TfGi~vpsGlFiP~iL~GAa~GRlvg~~l~~~~~id~  502 (762)
T KOG0474|consen  424 LATLFFNTNDDAVRNLFHSPT-NEFGILTLAIFFVLYFFLACWTFGIAVPSGLFIPVILTGAAYGRLVGMLLGSYTNIDP  502 (762)
T ss_pred             HHHHHcCCcHHHHHHHhcCCC-CccchhHHHHHHHHHHHHHHHHhcccccccchhHHHHhhHHHHHHHHHHHHHhhccCc
Confidence            999999999999999999987 9999999999999999999999999999999999999999999999999999889999


Q ss_pred             HHHHHHHHHHHHHhhhchhHHHHHHHHHhhcCCchHHHHHHHHHHHHHHHhhcCCchHHHHHHhhCCCCCCCCCCccccc
Q 013262          173 GLYAVLGAASLMAGSMRMTVSLCVIFLELTNNLLLLPITMIVLLIAKTVGDSFNPSIYEIILELKGLPFLDAHPEPWMRT  252 (447)
Q Consensus       173 ~~~a~~G~aa~~~g~~~~p~s~~vi~~E~t~~~~~~~p~~ia~~va~~v~~~l~~sIYd~~l~~kg~p~l~~~~~~~l~~  252 (447)
                      |.||++||||+|||++||++|.+||++|+| +..+++|+|++.++|+||+|.|+++|||.+++.||+|+++|++++.+++
T Consensus       503 G~yAllGAAa~LGG~mRMTvSL~VIl~E~T-n~~~~lPiMlvLliaK~VGD~FNegiYd~~i~LkgvP~Le~~pe~~mr~  581 (762)
T KOG0474|consen  503 GLYALLGAAAFLGGVMRMTVSLCVILLELT-NNLLLLPIMLVLLIAKTVGDSFNEGIYDIIIQLKGVPFLEWEPEPYMRN  581 (762)
T ss_pred             hHHHHHhHHHHhCCeEEEEeeeehHHHHhh-hhhhhhHHHHHHHHHHHHHhhhhhhhHHHhhhccCCccccCCCchHhhh
Confidence            999999999999999999999999999999 7888999999999999999999999999999999999999999999999


Q ss_pred             ccccccccCCCCeeEecCCCCHHHHHHHHhcCCCCeEEEecCCCCCCCCCCCCCceEEEEEeHHHHHHHHHhhhhhhhcc
Q 013262          253 LTVGELIDAKPPVITLSGIEKVSQIVDVLRNTTHNGFPVLDEGVVPPSGLANVATELHGLILRAHLVLALKKKWFLQEKR  332 (447)
Q Consensus       253 l~v~diM~~~~~vv~l~~~~tv~~~~~~L~~~~~~~fPVVd~~~~~~~~~~~~~~~lvGiIt~~dL~~~L~~~~~~~~~~  332 (447)
                      ++|+|+|++  ++++++..++++.+.++|+++.||+|||||+...      ++.+++.|+|.|++|..+|++++|.++..
T Consensus       582 L~a~ev~~~--pvi~l~~~ekV~~Iv~vLk~t~HngFPVvd~~~~------~~~~~l~GlILRshl~vlL~~~~f~~~~~  653 (762)
T KOG0474|consen  582 LTAGEVMSK--PVICLNRVEKVAVIVDVLKSTNHNGFPVVDEPPS------NEAGRLHGLILRSHLLVLLKKRVFVEESR  653 (762)
T ss_pred             hhHhhhccC--CeEEEechhhHHHHHHHHHhcCcCCCccccCCCC------ccchhhhHHHHHHHHHHHHHhhhhhccCc
Confidence            999999999  9999999999999999999999999999998621      12268999999999999999999886654


Q ss_pred             cchhhhhhhcchHHHHhhhcccccccccchhhhhhccCccccccCCCceecCCCCHHHHHHHHHHcCCCEEEEEeCcccC
Q 013262          333 RTEEWEVREKFSWVELAEREGKIEEVAVTSEEMEMYIDLHPLTNTTPYTVIESMSVAKAMVLFRQVGLRHLLVVPKYEAA  412 (447)
Q Consensus       333 ~~~~~~~~~~~~~~d~~~~~~~~~~~~l~~~~~~~~idl~~im~~~p~tV~~~~sL~~a~~lf~~~gl~~LpVVd~~~~~  412 (447)
                      ....+...+..+.+|+.+...+++|+.+++++.+.++|+.++|+++|++|.+++++.+++.+|++.|+||+.||++    
T Consensus       654 ~~~~~~~~~~~~~~d~a~r~~~i~dv~lt~~e~~~yvDl~p~~n~sPytV~~~mSl~k~~~lFR~lGLRhLlVv~~----  729 (762)
T KOG0474|consen  654 STFDLPVRRKFTFRDFAKREPSIEDVHLTSEEMEMYVDLHPFMNPSPYTVPETMSLAKAFILFRQLGLRHLLVVPK----  729 (762)
T ss_pred             cccCcchhhcCCHHHhhhcCCchhhhhcchHhHhhccccccccCCCCcccCcccchHHHHHHHHHhcceeEEEecC----
Confidence            4444444567888999998889999999999999999999999999999999999999999999999999999998    


Q ss_pred             CCCcEEEEEeHHHHHHHHHhhhcCccccccccC
Q 013262          413 GVSPVVGILTRQDLRAFNILTAFPHLERSKSGQ  445 (447)
Q Consensus       413 g~~~lvGIITr~DLl~~~~~~~~~~~~~~~~~~  445 (447)
                       .++++|++||+|+.++...+..++..+.+.++
T Consensus       730 -~~~~~gilTR~D~~~~~~l~~~~~v~~~~~~~  761 (762)
T KOG0474|consen  730 -TNRVVGILTRKDLARYRILGLEPHVDELKMGK  761 (762)
T ss_pred             -CCceeEEEehhhhhhHHHhccccccccccccc
Confidence             66789999999999999888888887776654



>KOG0475 consensus Cl- channel CLC-3 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK01862 putative voltage-gated ClC-type chloride channel ClcB; Provisional Back     alignment and domain information
>KOG0476 consensus Cl- channel CLC-2 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03684 ClC_3_like ClC-3-like chloride channel proteins Back     alignment and domain information
>cd03685 ClC_6_like ClC-6-like chloride channel proteins Back     alignment and domain information
>cd03683 ClC_1_like ClC-1-like chloride channel proteins Back     alignment and domain information
>PRK01610 putative voltage-gated ClC-type chloride channel ClcB; Provisional Back     alignment and domain information
>cd01031 EriC ClC chloride channel EriC Back     alignment and domain information
>cd01036 ClC_euk Chloride channel, ClC Back     alignment and domain information
>PF00654 Voltage_CLC: Voltage gated chloride channel Mutation in several of these channels lead to human disease Back     alignment and domain information
>PRK05277 chloride channel protein; Provisional Back     alignment and domain information
>COG0038 EriC Chloride channel protein EriC [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd01034 EriC_like ClC chloride channel family Back     alignment and domain information
>cd01033 ClC_like Putative ClC chloride channel Back     alignment and domain information
>cd00400 Voltage_gated_ClC CLC voltage-gated chloride channel Back     alignment and domain information
>cd03682 ClC_sycA_like ClC sycA-like chloride channel proteins Back     alignment and domain information
>PRK03655 putative ion channel protein; Provisional Back     alignment and domain information
>COG2524 Predicted transcriptional regulator, contains C-terminal CBS domains [Transcription] Back     alignment and domain information
>PRK11543 gutQ D-arabinose 5-phosphate isomerase; Provisional Back     alignment and domain information
>COG3448 CBS-domain-containing membrane protein [Signal transduction mechanisms] Back     alignment and domain information
>PRK10892 D-arabinose 5-phosphate isomerase; Provisional Back     alignment and domain information
>COG4109 Predicted transcriptional regulator containing CBS domains [Transcription] Back     alignment and domain information
>cd04641 CBS_pair_28 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04603 CBS_pair_KefB_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the KefB (Kef-type K+ transport systems) domain which is involved in inorganic ion transport and metabolism Back     alignment and domain information
>cd04619 CBS_pair_6 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>COG3620 Predicted transcriptional regulator with C-terminal CBS domains [Transcription] Back     alignment and domain information
>PRK07807 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>cd04618 CBS_pair_5 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PRK15094 magnesium/cobalt efflux protein CorC; Provisional Back     alignment and domain information
>TIGR03520 GldE gliding motility-associated protein GldE Back     alignment and domain information
>cd04600 CBS_pair_HPP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain Back     alignment and domain information
>cd04639 CBS_pair_26 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04593 CBS_pair_EriC_assoc_bac_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in bacteria and archaea Back     alignment and domain information
>cd04617 CBS_pair_4 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04596 CBS_pair_DRTGG_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream Back     alignment and domain information
>cd04605 CBS_pair_MET2_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain Back     alignment and domain information
>cd04608 CBS_pair_PALP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream Back     alignment and domain information
>PRK07107 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>cd04623 CBS_pair_10 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04614 CBS_pair_1 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04801 CBS_pair_M50_like This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the metalloprotease peptidase M50 Back     alignment and domain information
>cd04630 CBS_pair_17 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04583 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA Back     alignment and domain information
>cd04803 CBS_pair_15 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>TIGR01137 cysta_beta cystathionine beta-synthase Back     alignment and domain information
>cd04586 CBS_pair_BON_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the BON (bacterial OsmY and nodulation domain) domain Back     alignment and domain information
>cd04582 CBS_pair_ABC_OpuCA_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA Back     alignment and domain information
>cd04607 CBS_pair_NTP_transferase_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain associated with the NTP (Nucleotidyl transferase) domain downstream Back     alignment and domain information
>cd04632 CBS_pair_19 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04629 CBS_pair_16 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04613 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC Back     alignment and domain information
>cd04615 CBS_pair_2 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04624 CBS_pair_11 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04627 CBS_pair_14 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04588 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the archaeal CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain Back     alignment and domain information
>cd04604 CBS_pair_KpsF_GutQ_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein Back     alignment and domain information
>cd04636 CBS_pair_23 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04595 CBS_pair_DHH_polyA_Pol_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with an upstream DHH domain which performs a phosphoesterase function and a downstream polyA polymerase domain Back     alignment and domain information
>cd04631 CBS_pair_18 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04642 CBS_pair_29 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04635 CBS_pair_22 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04643 CBS_pair_30 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04626 CBS_pair_13 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04591 CBS_pair_EriC_assoc_euk_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes and bacteria Back     alignment and domain information
>cd04620 CBS_pair_7 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>TIGR00400 mgtE Mg2+ transporter (mgtE) Back     alignment and domain information
>cd04602 CBS_pair_IMPDH_2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein Back     alignment and domain information
>cd04621 CBS_pair_8 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04585 CBS_pair_ACT_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria Back     alignment and domain information
>PLN02274 inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>cd04622 CBS_pair_9 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PRK11573 hypothetical protein; Provisional Back     alignment and domain information
>cd04612 CBS_pair_SpoIVFB_EriC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC Back     alignment and domain information
>cd04611 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with a PAS domain, a GGDEF (DiGuanylate-Cyclase (DGC) domain, and a DUF1 domain downstream Back     alignment and domain information
>TIGR00393 kpsF KpsF/GutQ family protein Back     alignment and domain information
>TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein Back     alignment and domain information
>cd04637 CBS_pair_24 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04640 CBS_pair_27 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04590 CBS_pair_CorC_HlyC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain Back     alignment and domain information
>cd04800 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain Back     alignment and domain information
>cd04625 CBS_pair_12 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04587 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain Back     alignment and domain information
>cd04601 CBS_pair_IMPDH This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein Back     alignment and domain information
>cd04589 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the bacterial CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain Back     alignment and domain information
>PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed Back     alignment and domain information
>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>cd00400 Voltage_gated_ClC CLC voltage-gated chloride channel Back     alignment and domain information
>cd04802 CBS_pair_3 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04599 CBS_pair_GGDEF_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain Back     alignment and domain information
>cd02205 CBS_pair The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04606 CBS_pair_Mg_transporter This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain in the magnesium transporter, MgtE Back     alignment and domain information
>PRK14869 putative manganese-dependent inorganic pyrophosphatase; Provisional Back     alignment and domain information
>cd04609 CBS_pair_PALP_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream Back     alignment and domain information
>cd04594 CBS_pair_EriC_assoc_archaea This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the EriC CIC-type chloride channels in archaea Back     alignment and domain information
>COG0517 FOG: CBS domain [General function prediction only] Back     alignment and domain information
>cd01031 EriC ClC chloride channel EriC Back     alignment and domain information
>cd04633 CBS_pair_20 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04610 CBS_pair_ParBc_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a ParBc (ParB-like nuclease) domain downstream Back     alignment and domain information
>cd04584 CBS_pair_ACT_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria Back     alignment and domain information
>cd04598 CBS_pair_GGDEF_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain Back     alignment and domain information
>cd04634 CBS_pair_21 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04638 CBS_pair_25 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>COG2905 Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] Back     alignment and domain information
>COG1253 TlyC Hemolysins and related proteins containing CBS domains [General function prediction only] Back     alignment and domain information
>PRK05277 chloride channel protein; Provisional Back     alignment and domain information
>COG2239 MgtE Mg/Co/Ni transporter MgtE (contains CBS domain) [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4536 CorB Putative Mg2+ and Co2+ transporter CorB [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd04592 CBS_pair_EriC_assoc_euk This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes Back     alignment and domain information
>cd03682 ClC_sycA_like ClC sycA-like chloride channel proteins Back     alignment and domain information
>PF00571 CBS: CBS domain CBS domain web page Back     alignment and domain information
>COG4535 CorC Putative Mg2+ and Co2+ transporter CorC [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK01862 putative voltage-gated ClC-type chloride channel ClcB; Provisional Back     alignment and domain information
>PF00654 Voltage_CLC: Voltage gated chloride channel Mutation in several of these channels lead to human disease Back     alignment and domain information
>PF00571 CBS: CBS domain CBS domain web page Back     alignment and domain information
>COG0038 EriC Chloride channel protein EriC [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK01610 putative voltage-gated ClC-type chloride channel ClcB; Provisional Back     alignment and domain information
>KOG1764 consensus 5'-AMP-activated protein kinase, gamma subunit [Energy production and conversion] Back     alignment and domain information
>cd01036 ClC_euk Chloride channel, ClC Back     alignment and domain information
>cd03685 ClC_6_like ClC-6-like chloride channel proteins Back     alignment and domain information
>cd01034 EriC_like ClC chloride channel family Back     alignment and domain information
>cd01033 ClC_like Putative ClC chloride channel Back     alignment and domain information
>KOG2550 consensus IMP dehydrogenase/GMP reductase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>cd03684 ClC_3_like ClC-3-like chloride channel proteins Back     alignment and domain information
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG3448 CBS-domain-containing membrane protein [Signal transduction mechanisms] Back     alignment and domain information
>PRK03655 putative ion channel protein; Provisional Back     alignment and domain information
>cd03683 ClC_1_like ClC-1-like chloride channel proteins Back     alignment and domain information
>cd04597 CBS_pair_DRTGG_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream Back     alignment and domain information
>TIGR00400 mgtE Mg2+ transporter (mgtE) Back     alignment and domain information
>PRK14869 putative manganese-dependent inorganic pyrophosphatase; Provisional Back     alignment and domain information
>cd04597 CBS_pair_DRTGG_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream Back     alignment and domain information
>cd04603 CBS_pair_KefB_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the KefB (Kef-type K+ transport systems) domain which is involved in inorganic ion transport and metabolism Back     alignment and domain information
>COG3620 Predicted transcriptional regulator with C-terminal CBS domains [Transcription] Back     alignment and domain information
>COG2524 Predicted transcriptional regulator, contains C-terminal CBS domains [Transcription] Back     alignment and domain information
>cd04619 CBS_pair_6 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04641 CBS_pair_28 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04618 CBS_pair_5 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04607 CBS_pair_NTP_transferase_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain associated with the NTP (Nucleotidyl transferase) domain downstream Back     alignment and domain information
>smart00116 CBS Domain in cystathionine beta-synthase and other proteins Back     alignment and domain information
>cd04600 CBS_pair_HPP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain Back     alignment and domain information
>cd04592 CBS_pair_EriC_assoc_euk This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes Back     alignment and domain information
>cd04620 CBS_pair_7 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04606 CBS_pair_Mg_transporter This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain in the magnesium transporter, MgtE Back     alignment and domain information
>cd04614 CBS_pair_1 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04585 CBS_pair_ACT_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria Back     alignment and domain information
>cd04627 CBS_pair_14 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed Back     alignment and domain information
>cd04596 CBS_pair_DRTGG_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream Back     alignment and domain information
>cd04615 CBS_pair_2 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04608 CBS_pair_PALP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream Back     alignment and domain information
>cd04625 CBS_pair_12 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04604 CBS_pair_KpsF_GutQ_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein Back     alignment and domain information
>cd04630 CBS_pair_17 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04610 CBS_pair_ParBc_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a ParBc (ParB-like nuclease) domain downstream Back     alignment and domain information
>cd04587 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain Back     alignment and domain information
>cd04635 CBS_pair_22 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04611 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with a PAS domain, a GGDEF (DiGuanylate-Cyclase (DGC) domain, and a DUF1 domain downstream Back     alignment and domain information
>cd04803 CBS_pair_15 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04583 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA Back     alignment and domain information
>cd04639 CBS_pair_26 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PRK07107 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>cd04582 CBS_pair_ABC_OpuCA_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA Back     alignment and domain information
>cd04602 CBS_pair_IMPDH_2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein Back     alignment and domain information
>cd04621 CBS_pair_8 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>smart00116 CBS Domain in cystathionine beta-synthase and other proteins Back     alignment and domain information
>cd04605 CBS_pair_MET2_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain Back     alignment and domain information
>cd04624 CBS_pair_11 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04613 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC Back     alignment and domain information
>cd04622 CBS_pair_9 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PRK11543 gutQ D-arabinose 5-phosphate isomerase; Provisional Back     alignment and domain information
>cd04631 CBS_pair_18 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04801 CBS_pair_M50_like This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the metalloprotease peptidase M50 Back     alignment and domain information
>cd04802 CBS_pair_3 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04595 CBS_pair_DHH_polyA_Pol_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with an upstream DHH domain which performs a phosphoesterase function and a downstream polyA polymerase domain Back     alignment and domain information
>cd04623 CBS_pair_10 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PRK10892 D-arabinose 5-phosphate isomerase; Provisional Back     alignment and domain information
>cd04643 CBS_pair_30 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04586 CBS_pair_BON_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the BON (bacterial OsmY and nodulation domain) domain Back     alignment and domain information
>cd04588 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the archaeal CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain Back     alignment and domain information
>cd04617 CBS_pair_4 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04601 CBS_pair_IMPDH This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein Back     alignment and domain information
>cd04593 CBS_pair_EriC_assoc_bac_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in bacteria and archaea Back     alignment and domain information
>cd04632 CBS_pair_19 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PRK07807 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>cd04589 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the bacterial CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain Back     alignment and domain information
>cd04629 CBS_pair_16 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04800 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain Back     alignment and domain information
>PLN02274 inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>cd04642 CBS_pair_29 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04612 CBS_pair_SpoIVFB_EriC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC Back     alignment and domain information
>COG0517 FOG: CBS domain [General function prediction only] Back     alignment and domain information
>cd04594 CBS_pair_EriC_assoc_archaea This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the EriC CIC-type chloride channels in archaea Back     alignment and domain information
>cd04633 CBS_pair_20 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein Back     alignment and domain information
>cd04599 CBS_pair_GGDEF_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain Back     alignment and domain information
>TIGR01137 cysta_beta cystathionine beta-synthase Back     alignment and domain information
>cd04636 CBS_pair_23 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04591 CBS_pair_EriC_assoc_euk_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes and bacteria Back     alignment and domain information
>cd04626 CBS_pair_13 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04640 CBS_pair_27 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04637 CBS_pair_24 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04590 CBS_pair_CorC_HlyC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain Back     alignment and domain information
>cd04584 CBS_pair_ACT_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria Back     alignment and domain information
>cd02205 CBS_pair The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>TIGR00393 kpsF KpsF/GutQ family protein Back     alignment and domain information
>KOG1764 consensus 5'-AMP-activated protein kinase, gamma subunit [Energy production and conversion] Back     alignment and domain information
>COG4109 Predicted transcriptional regulator containing CBS domains [Transcription] Back     alignment and domain information
>COG2905 Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] Back     alignment and domain information
>cd04609 CBS_pair_PALP_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream Back     alignment and domain information
>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>cd04598 CBS_pair_GGDEF_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain Back     alignment and domain information
>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR03520 GldE gliding motility-associated protein GldE Back     alignment and domain information
>cd04638 CBS_pair_25 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd04634 CBS_pair_21 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PRK15094 magnesium/cobalt efflux protein CorC; Provisional Back     alignment and domain information
>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein Back     alignment and domain information
>COG2239 MgtE Mg/Co/Ni transporter MgtE (contains CBS domain) [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>KOG0474 consensus Cl- channel CLC-7 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11573 hypothetical protein; Provisional Back     alignment and domain information
>KOG2550 consensus IMP dehydrogenase/GMP reductase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG1253 TlyC Hemolysins and related proteins containing CBS domains [General function prediction only] Back     alignment and domain information
>KOG0476 consensus Cl- channel CLC-2 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0475 consensus Cl- channel CLC-3 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein Back     alignment and domain information
>KOG2118 consensus Predicted membrane protein, contains two CBS domains [Function unknown] Back     alignment and domain information
>COG4535 CorC Putative Mg2+ and Co2+ transporter CorC [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query447
3org_A632 Crystal Structure Of A Eukaryotic Clc Transporter L 4e-10
>pdb|3ORG|A Chain A, Crystal Structure Of A Eukaryotic Clc Transporter Length = 632 Back     alignment and structure

Iteration: 1

Score = 62.4 bits (150), Expect = 4e-10, Method: Compositional matrix adjust. Identities = 54/185 (29%), Positives = 89/185 (48%), Gaps = 12/185 (6%) Query: 116 EFQPSSILIFFILYCILGLITFGIAVPSGLFLPIILMGSAYGRLLGMAMGSY--TNIDQG 173 F + +++ I+ IL ++ G+ +P+G+F+P L+G+ +GRL G M I G Sbjct: 315 HFGWTELILMPIIKFILVALSIGLPLPAGVFVPSFLIGAGFGRLYGELMRVVFGNAIVPG 374 Query: 174 LYAVLGAASLMAGSMRMTVSLCVIFXXXXXXXXXXXXXXXXXXXAKTVGDSFNPSIYEII 233 YAV+GAA+ AG R +S VI A VG++FN S+YE + Sbjct: 375 SYAVVGAAAFTAGVTR-ALSCAVIIFEVTGQIRHLVPVLISVLLAVIVGNAFNRSLYETL 433 Query: 234 LELKGLPFL-----DAHPEPWMRTLTVGELIDAKPPVITLSGIEKVSQIVDVLRNTTHNG 288 + +K LP++ D PE M + I+ +P + S + + I++ N Sbjct: 434 VLMKHLPYMPILRRDRSPE--MTAREIMHPIEGEPHLFPDSEPQHIKGILEKFPNRLV-- 489 Query: 289 FPVLD 293 FPV+D Sbjct: 490 FPVID 494

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query447
3org_A632 CMCLC; transporter, transport protein; 3.50A {Cyan 6e-80
2j9l_A185 Chloride channel protein 5; ION channel, ION trans 6e-26
3nd0_A466 SLL0855 protein; CLC family CL-/H+ antiporter, CLC 2e-14
1ots_A465 Voltage-gated CLC-type chloride channel ERIC; CLC 4e-14
2pfi_A164 Chloride channel protein CLC-Ka; cystathionine bet 3e-09
3sl7_A180 CBS domain-containing protein CBSX2; CBS-PAIR prot 3e-09
1o50_A157 CBS domain-containing predicted protein TM0935; CB 4e-08
2d4z_A250 Chloride channel protein; CLC chloride channel cyt 6e-07
2emq_A157 Hypothetical conserved protein; CBS domains, NPPSF 7e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
3lqn_A150 CBS domain protein; csgid, structural genomics, un 3e-05
2v8q_E330 5'-AMP-activated protein kinase subunit gamma-1; p 3e-05
3kh5_A 280 Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a 4e-05
3kh5_A280 Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a 6e-05
2ef7_A133 Hypothetical protein ST2348; CBS-domain, structura 5e-05
2rih_A141 Conserved protein with 2 CBS domains; bateman doma 1e-04
3ddj_A 296 CBS domain-containing protein; structural genomics 2e-04
1yav_A159 Hypothetical protein BSU14130; cystathionine beta 3e-04
2nyc_A144 Nuclear protein SNF4; bateman2 domain, AMP kinase, 4e-04
>3org_A CMCLC; transporter, transport protein; 3.50A {Cyanidioschyzon merolae} Length = 632 Back     alignment and structure
 Score =  258 bits (662), Expect = 6e-80
 Identities = 90/426 (21%), Positives = 152/426 (35%), Gaps = 69/426 (16%)

Query: 17  NHSSTCIFTLFHCRKGKMHKLLLALSVSVFTSVCQYCLPFLADCKACDPSFPETCPTNGR 76
                 I+ L        ++  L   V++F S  QY                        
Sbjct: 253 IRCVRSIYELRMRHYPGTNRYFLVGVVALFASALQYPFRLF------------------- 293

Query: 77  SGNFKQFNCPNGHYNDLATLLLTTNDDAVRNIFSSNTPTEFQPSSILIFFILYCILGLIT 136
                    P    NDL   +     D             F  + +++  I+  IL  ++
Sbjct: 294 ------ALDPRATINDLFKAVPLYQTD------------HFGWTELILMPIIKFILVALS 335

Query: 137 FGIAVPSGLFLPIILMGSAYGRLLGMAMGSY--TNIDQGLYAVLGAASLMAGSMRMTVSL 194
            G+ +P+G+F+P  L+G+ +GRL G  M       I  G YAV+GAA+  AG  R  +S 
Sbjct: 336 IGLPLPAGVFVPSFLIGAGFGRLYGELMRVVFGNAIVPGSYAVVGAAAFTAGVTR-ALSC 394

Query: 195 CVIFLELTNNL-LLLPITMIVLLIAKTVGDSFNPSIYEIILELKGLPFLDAHPEPWMRTL 253
            VI  E+T  +  L+P+ +I +L+A  VG++FN S+YE ++ +K LP++          +
Sbjct: 395 AVIIFEVTGQIRHLVPV-LISVLLAVIVGNAFNRSLYETLVLMKHLPYMPILRRDRSPEM 453

Query: 254 TVGELIDAKPPVITLSGIEKVSQIVDVLRNTT-HNGFPVLDEGVVPPSGLANVATELHGL 312
           T  E++        L    +   I  +L        FPV+D               L G 
Sbjct: 454 TAREIMHPIEGEPHLFPDSEPQHIKGILEKFPNRLVFPVIDA-----------NGYLLGA 502

Query: 313 ILRAHLVLALKKKWFLQEKRRTEE---------WEVREKFSWVELAEREGKIEEVAVTSE 363
           I R  +V  L+       +                       V+         +   T+ 
Sbjct: 503 ISRKEIVDRLQHVLEDVPEPIAGHRTLVLLDAADLSENIEGLVDETPSGEHSSKGKRTAT 562

Query: 364 EMEMYIDLHPLTNTTPYTVIESMSVAKAMVLFRQVGLRHLLVVPKYEAAGVSPVVGILTR 423
            +E    L    + +P  V     V +   LF  +    + V  +        +VGI+ R
Sbjct: 563 VLEPTSSLVVPCDVSPIVVTSYSLVRQLHFLFVMLMPSMIYVTER------GKLVGIVER 616

Query: 424 QDLRAF 429
           +D+   
Sbjct: 617 EDVAYG 622


>2j9l_A Chloride channel protein 5; ION channel, ION transport, voltage-gated; HET: ATP; 2.30A {Homo sapiens} SCOP: d.37.1.1 PDB: 2ja3_A* Length = 185 Back     alignment and structure
>3nd0_A SLL0855 protein; CLC family CL-/H+ antiporter, CLC_EC1 homolog, transport protein; 3.20A {Synechocystis} PDB: 3q17_A Length = 466 Back     alignment and structure
>1ots_A Voltage-gated CLC-type chloride channel ERIC; CLC chloride channel, FAB complex, membrane protein; 2.51A {Escherichia coli} SCOP: f.20.1.1 PDB: 2fee_A 2h2p_A 2exw_A 1kpk_A 2exy_A 2htl_A 3ejy_A 2ht2_A 2fed_A 2fec_A 1otu_A 3ejz_A 2ht4_A 2htk_A 2ht3_A 1ott_A 2h2s_A 3det_A 2ez0_A 3nmo_A ... Length = 465 Back     alignment and structure
>2pfi_A Chloride channel protein CLC-Ka; cystathionine beta synthetase (CBS) domains containing protein, transport protein; 1.60A {Homo sapiens} Length = 164 Back     alignment and structure
>3sl7_A CBS domain-containing protein CBSX2; CBS-PAIR protein, redox regulator, plant CBS domain, thiored chloroplast, membrane protein; 1.91A {Arabidopsis thaliana} Length = 180 Back     alignment and structure
>1o50_A CBS domain-containing predicted protein TM0935; CBS-domain PAIR fold, structural genomics, joint center for structural genomics, JCSG; 1.87A {Thermotoga maritima} SCOP: d.37.1.1 Length = 157 Back     alignment and structure
>2d4z_A Chloride channel protein; CLC chloride channel cytoplasmic domain, CBS domains, ION CH regulatory subunit, transport protein; 3.10A {Torpedo marmorata} SCOP: d.37.1.1 Length = 250 Back     alignment and structure
>2emq_A Hypothetical conserved protein; CBS domains, NPPSFA, national project on protein structural functional analyses; 2.50A {Geobacillus kaustophilus} Length = 157 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3lqn_A CBS domain protein; csgid, structural genomics, unknown function, center for structural genomics of infectious diseases; 1.80A {Bacillus anthracis} Length = 150 Back     alignment and structure
>2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* Length = 330 Back     alignment and structure
>3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* Length = 280 Back     alignment and structure
>3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* Length = 280 Back     alignment and structure
>2ef7_A Hypothetical protein ST2348; CBS-domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.10A {Sulfolobus tokodaii} SCOP: d.37.1.1 Length = 133 Back     alignment and structure
>2rih_A Conserved protein with 2 CBS domains; bateman domain, AMP binding protein, ligand-BIND protein; 2.10A {Pyrobaculum aerophilum} SCOP: d.37.1.1 PDB: 2rif_A Length = 141 Back     alignment and structure
>3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 Length = 296 Back     alignment and structure
>1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 Length = 159 Back     alignment and structure
>2nyc_A Nuclear protein SNF4; bateman2 domain, AMP kinase, protein binding; 1.90A {Saccharomyces cerevisiae} SCOP: d.37.1.1 PDB: 2nye_A Length = 144 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query447
3org_A632 CMCLC; transporter, transport protein; 3.50A {Cyan 100.0
1ots_A465 Voltage-gated CLC-type chloride channel ERIC; CLC 99.96
4ene_A446 CLC-EC1, H(+)/CL(-) exchange transporter CLCA; mem 99.95
3nd0_A466 SLL0855 protein; CLC family CL-/H+ antiporter, CLC 99.95
2d4z_A250 Chloride channel protein; CLC chloride channel cyt 99.87
4esy_A170 CBS domain containing membrane protein; structural 99.81
3k6e_A156 CBS domain protein; streptococcus pneumoniae TIGR4 99.78
3i8n_A130 Uncharacterized protein VP2912; APC64273.1, vibrio 99.77
3lv9_A148 Putative transporter; CBS domain, PSI, MCSG, struc 99.76
3hf7_A130 Uncharacterized CBS-domain protein; CSB-domain PAI 99.76
3kpb_A122 Uncharacterized protein MJ0100; CBS domain, S-aden 99.76
2ef7_A133 Hypothetical protein ST2348; CBS-domain, structura 99.75
3lhh_A172 CBS domain protein; structural genomics, PSI-2, pr 99.75
3oco_A153 Hemolysin-like protein containing CBS domains; str 99.74
3jtf_A129 Magnesium and cobalt efflux protein; CBS domain, C 99.74
3lfr_A136 Putative metal ION transporter; CBS, AMP, PSI, MCS 99.74
2yzi_A138 Hypothetical protein PH0107; sheet/helix/sheet/she 99.74
3gby_A128 Uncharacterized protein CT1051; CBS domain, struct 99.74
3nqr_A127 Magnesium and cobalt efflux protein CORC; structur 99.74
3fhm_A165 Uncharacterized protein ATU1752; CBS domain, proka 99.73
3fv6_A159 YQZB protein; CBS domain dimer, metabolism regulat 99.73
2rih_A141 Conserved protein with 2 CBS domains; bateman doma 99.73
2p9m_A138 Hypothetical protein MJ0922; structural genomics, 99.73
3ocm_A173 Putative membrane protein; structural genomics, PS 99.73
3lqn_A150 CBS domain protein; csgid, structural genomics, un 99.72
1pbj_A125 Hypothetical protein; structural genomics, domain, 99.71
1o50_A157 CBS domain-containing predicted protein TM0935; CB 99.71
3k2v_A149 Putative D-arabinose 5-phosphate isomerase; KPSF-l 99.71
4gqw_A152 CBS domain-containing protein CBSX1, chloroplasti; 99.71
2emq_A157 Hypothetical conserved protein; CBS domains, NPPSF 99.71
3sl7_A180 CBS domain-containing protein CBSX2; CBS-PAIR prot 99.7
3kxr_A205 Magnesium transporter, putative; cystathionine bet 99.7
2o16_A160 Acetoin utilization protein ACUB, putative; struct 99.7
2j9l_A185 Chloride channel protein 5; ION channel, ION trans 99.7
3ctu_A156 CBS domain protein; structural genomics, PSI-2, pr 99.7
2rc3_A135 CBS domain; in SITU proteolysis, BR, structural ge 99.7
2nyc_A144 Nuclear protein SNF4; bateman2 domain, AMP kinase, 99.69
2pfi_A164 Chloride channel protein CLC-Ka; cystathionine bet 99.69
3oi8_A156 Uncharacterized protein; structural genomics, PSI- 99.69
2uv4_A152 5'-AMP-activated protein kinase subunit gamma-1; t 99.68
1y5h_A133 Hypothetical protein RV2626C; CBS domain, unknown 99.68
1pvm_A184 Conserved hypothetical protein TA0289; structural 99.67
4fry_A157 Putative signal-transduction protein with CBS DOM; 99.66
1yav_A159 Hypothetical protein BSU14130; cystathionine beta 99.66
3pc3_A527 CG1753, isoform A; CBS, synthase, PLP, heme, amino 99.64
3l2b_A245 Probable manganase-dependent inorganic pyrophospha 99.63
2oux_A286 Magnesium transporter; 10001B, structural genomics 99.62
1vr9_A213 CBS domain protein/ACT domain protein; structural 99.61
3ddj_A296 CBS domain-containing protein; structural genomics 99.61
2yvy_A278 MGTE, Mg2+ transporter MGTE; membrane protein, tra 99.61
3t4n_C323 Nuclear protein SNF4; CBS domain, nucleotide bindi 99.59
2yzq_A282 Putative uncharacterized protein PH1780; sheet/hel 99.56
3kh5_A280 Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a 99.56
3ddj_A296 CBS domain-containing protein; structural genomics 99.53
3kh5_A280 Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a 99.53
2zy9_A 473 Mg2+ transporter MGTE; membrane protien, metal tra 99.52
2qrd_G334 Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, 99.52
2yzq_A 282 Putative uncharacterized protein PH1780; sheet/hel 99.47
2v8q_E 330 5'-AMP-activated protein kinase subunit gamma-1; p 99.46
3usb_A 511 Inosine-5'-monophosphate dehydrogenase; structural 99.41
2v8q_E330 5'-AMP-activated protein kinase subunit gamma-1; p 99.4
3t4n_C323 Nuclear protein SNF4; CBS domain, nucleotide bindi 99.4
2qrd_G 334 Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, 99.4
1zfj_A 491 Inosine monophosphate dehydrogenase; IMPDH, CBS do 99.37
4fxs_A 496 Inosine-5'-monophosphate dehydrogenase; structural 99.35
4avf_A 490 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 99.29
1vrd_A 494 Inosine-5'-monophosphate dehydrogenase; TM1347, st 99.29
4af0_A 556 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 99.26
1me8_A 503 Inosine-5'-monophosphate dehydrogenase; alpha beta 99.24
1jcn_A 514 Inosine monophosphate dehydrogenase I; IMPD, IMPDH 99.18
2cu0_A 486 Inosine-5'-monophosphate dehydrogenase; structural 99.08
1ots_A465 Voltage-gated CLC-type chloride channel ERIC; CLC 98.86
4ene_A446 CLC-EC1, H(+)/CL(-) exchange transporter CLCA; mem 98.76
3nd0_A466 SLL0855 protein; CLC family CL-/H+ antiporter, CLC 98.75
3ghd_A70 A cystathionine beta-synthase domain protein FUSE 98.69
1vr9_A213 CBS domain protein/ACT domain protein; structural 98.65
3org_A 632 CMCLC; transporter, transport protein; 3.50A {Cyan 98.57
4esy_A170 CBS domain containing membrane protein; structural 98.54
3ghd_A70 A cystathionine beta-synthase domain protein FUSE 98.5
2d4z_A 250 Chloride channel protein; CLC chloride channel cyt 98.42
3fio_A70 A cystathionine beta-synthase domain protein fused 98.41
3l2b_A 245 Probable manganase-dependent inorganic pyrophospha 98.35
3lv9_A148 Putative transporter; CBS domain, PSI, MCSG, struc 98.34
3lhh_A172 CBS domain protein; structural genomics, PSI-2, pr 98.33
3fio_A70 A cystathionine beta-synthase domain protein fused 98.32
3k2v_A149 Putative D-arabinose 5-phosphate isomerase; KPSF-l 98.29
2rih_A141 Conserved protein with 2 CBS domains; bateman doma 98.28
3kpb_A122 Uncharacterized protein MJ0100; CBS domain, S-aden 98.28
2yzi_A138 Hypothetical protein PH0107; sheet/helix/sheet/she 98.26
2o16_A160 Acetoin utilization protein ACUB, putative; struct 98.25
2p9m_A138 Hypothetical protein MJ0922; structural genomics, 98.19
1pbj_A125 Hypothetical protein; structural genomics, domain, 98.18
3fv6_A159 YQZB protein; CBS domain dimer, metabolism regulat 98.18
3gby_A128 Uncharacterized protein CT1051; CBS domain, struct 98.15
3i8n_A130 Uncharacterized protein VP2912; APC64273.1, vibrio 98.15
3nqr_A127 Magnesium and cobalt efflux protein CORC; structur 98.13
3lqn_A150 CBS domain protein; csgid, structural genomics, un 98.13
3hf7_A130 Uncharacterized CBS-domain protein; CSB-domain PAI 98.13
3k6e_A156 CBS domain protein; streptococcus pneumoniae TIGR4 98.12
3jtf_A129 Magnesium and cobalt efflux protein; CBS domain, C 98.12
3ctu_A156 CBS domain protein; structural genomics, PSI-2, pr 98.11
2pfi_A164 Chloride channel protein CLC-Ka; cystathionine bet 98.11
1pvm_A 184 Conserved hypothetical protein TA0289; structural 98.11
1yav_A159 Hypothetical protein BSU14130; cystathionine beta 98.1
2ef7_A133 Hypothetical protein ST2348; CBS-domain, structura 98.1
2emq_A157 Hypothetical conserved protein; CBS domains, NPPSF 98.1
3kxr_A205 Magnesium transporter, putative; cystathionine bet 98.09
2rc3_A135 CBS domain; in SITU proteolysis, BR, structural ge 98.09
3fhm_A165 Uncharacterized protein ATU1752; CBS domain, proka 98.08
4gqw_A152 CBS domain-containing protein CBSX1, chloroplasti; 98.08
2nyc_A144 Nuclear protein SNF4; bateman2 domain, AMP kinase, 98.08
3sl7_A180 CBS domain-containing protein CBSX2; CBS-PAIR prot 98.08
3lfr_A136 Putative metal ION transporter; CBS, AMP, PSI, MCS 98.08
3oco_A153 Hemolysin-like protein containing CBS domains; str 98.06
1y5h_A133 Hypothetical protein RV2626C; CBS domain, unknown 98.05
3ocm_A173 Putative membrane protein; structural genomics, PS 98.04
1o50_A157 CBS domain-containing predicted protein TM0935; CB 98.03
3oi8_A156 Uncharacterized protein; structural genomics, PSI- 98.01
2j9l_A185 Chloride channel protein 5; ION channel, ION trans 98.01
2uv4_A152 5'-AMP-activated protein kinase subunit gamma-1; t 97.97
4fry_A157 Putative signal-transduction protein with CBS DOM; 97.97
3pc3_A527 CG1753, isoform A; CBS, synthase, PLP, heme, amino 97.84
2yvy_A278 MGTE, Mg2+ transporter MGTE; membrane protein, tra 97.73
2oux_A286 Magnesium transporter; 10001B, structural genomics 97.72
2zy9_A473 Mg2+ transporter MGTE; membrane protien, metal tra 97.59
1me8_A 503 Inosine-5'-monophosphate dehydrogenase; alpha beta 97.53
3usb_A 511 Inosine-5'-monophosphate dehydrogenase; structural 97.41
4fxs_A 496 Inosine-5'-monophosphate dehydrogenase; structural 97.14
1zfj_A 491 Inosine monophosphate dehydrogenase; IMPDH, CBS do 96.87
4af0_A 556 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 96.85
2cu0_A 486 Inosine-5'-monophosphate dehydrogenase; structural 96.74
1vrd_A 494 Inosine-5'-monophosphate dehydrogenase; TM1347, st 96.73
4avf_A 490 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 96.69
1jcn_A 514 Inosine monophosphate dehydrogenase I; IMPD, IMPDH 96.09
>3org_A CMCLC; transporter, transport protein; 3.50A {Cyanidioschyzon merolae} Back     alignment and structure
Probab=100.00  E-value=2.3e-49  Score=425.92  Aligned_cols=313  Identities=24%  Similarity=0.337  Sum_probs=235.4

Q ss_pred             hHHHHHHHhcCCCC---CCcchHHHHHHHHHHHHHHHHHhhccCCccchhhHHHHHHHHHHHHHHHhhccC--CcchHHH
Q 013262          101 NDDAVRNIFSSNTP---TEFQPSSILIFFILYCILGLITFGIAVPSGLFLPIILMGSAYGRLLGMAMGSYT--NIDQGLY  175 (447)
Q Consensus       101 ~~~~i~~l~~~~~~---~~~~~~~l~~~~~~k~~~~~~t~g~g~~gG~f~P~l~iGa~~G~~~g~~~~~~~--~~~~~~~  175 (447)
                      +++.++.+|++.+.   +.+.+..|++++++|+++|++|+|+|+|||+|+|+|++||++|+++|.+++...  .++|+.|
T Consensus       297 ~~~~i~~l~~~~~~~~~~~~~~~~l~~~~~~k~~~t~~s~g~g~pGGif~P~l~iGA~~G~~~g~~~~~~~p~~~~p~~~  376 (632)
T 3org_A          297 PRATINDLFKAVPLYQTDHFGWTELILMPIIKFILVALSIGLPLPAGVFVPSFLIGAGFGRLYGELMRVVFGNAIVPGSY  376 (632)
T ss_dssp             CHHHHHHHHSCC----------CCSSHHHHHHHHHHHHHTTSSSBCBCHHHHHHHHHHHHHHHHHHHHHHHCTTSCHHHH
T ss_pred             HHHHHHHHHcCCccccccchhHHHHHHHHHHHHHHHHHHHhCCCcchhhHHHHHHHHHHHHHHHHHHHHhCCcccchHHH
Confidence            56778888875432   234566788889999999999999999999999999999999999999987632  2689999


Q ss_pred             HHHHHHHHHHhhhchhHHHHHHHHHhhcCCchHHHHHHHHHHHHHHHhhcCCchHHHHHHhhCCCCCCCCCCcccccccc
Q 013262          176 AVLGAASLMAGSMRMTVSLCVIFLELTNNLLLLPITMIVLLIAKTVGDSFNPSIYEIILELKGLPFLDAHPEPWMRTLTV  255 (447)
Q Consensus       176 a~~G~aa~~~g~~~~p~s~~vi~~E~t~~~~~~~p~~ia~~va~~v~~~l~~sIYd~~l~~kg~p~l~~~~~~~l~~l~v  255 (447)
                      |++||||++||++|+|++++ |++||||++++++|+|+++++|+++++.++++|||.+++.|++|++++......++++|
T Consensus       377 a~vGmaa~~~~v~~ap~t~v-i~~E~tg~~~~~lpl~ia~~~a~~v~~~~~~~iY~~~~~~k~lp~l~~~~~~~~~~~~V  455 (632)
T 3org_A          377 AVVGAAAFTAGVTRALSCAV-IIFEVTGQIRHLVPVLISVLLAVIVGNAFNRSLYETLVLMKHLPYMPILRRDRSPEMTA  455 (632)
T ss_dssp             HHHHHHHHHHHHSCCTTHHH-HHHHHTCCCSCSHHHHHHHHHHHHHHHHHCCCHHHHHHHHTTCCEEEEECTTCCTTSBH
T ss_pred             HHHHHHHHHHHHHHHHHHHH-HHHHHhCChhHHHHHHHHHHHHHHHHHHhCCCHHHHHHHhcCCCccccccccccccCcH
Confidence            99999999999999999875 89999999999999999999999999999889999999999999987555445578999


Q ss_pred             cccccCCCCeeEecCCCCHHHHHHHHh-cCCCCeEEEecCCCCCCCCCCCCCceEEEEEeHHHHHHHHHhhhhhhhcccc
Q 013262          256 GELIDAKPPVITLSGIEKVSQIVDVLR-NTTHNGFPVLDEGVVPPSGLANVATELHGLILRAHLVLALKKKWFLQEKRRT  334 (447)
Q Consensus       256 ~diM~~~~~vv~l~~~~tv~~~~~~L~-~~~~~~fPVVd~~~~~~~~~~~~~~~lvGiIt~~dL~~~L~~~~~~~~~~~~  334 (447)
                      +|+|+++.++++++++++++|+.+.|+ +++++++||||++           ++++|+|+++|+.+.+.++.... ..+.
T Consensus       456 ~diM~p~~~v~~v~~~~t~~e~~~~~~~~~~~~~~PVvd~~-----------~~lvGiVt~~DL~~~l~~~~~~~-~~~~  523 (632)
T 3org_A          456 REIMHPIEGEPHLFPDSEPQHIKGILEKFPNRLVFPVIDAN-----------GYLLGAISRKEIVDRLQHVLEDV-PEPI  523 (632)
T ss_dssp             HHHCBCTTTSCCBCSSSCHHHHHHHHHHSTTCCEECBBCTT-----------CBBCCEESHHHHTTTTTTC---------
T ss_pred             HHHhhcCCCceEecCCCcHHHHHHHHHhcCCcceEEEEecC-----------CeEEEEEEHHHHHHHHHHHhhhc-cccc
Confidence            999993338999999999999999999 8999999999987           89999999999987654421000 0000


Q ss_pred             hhhhhhhcchHHHHhhhcccc-ccc------ccchhh---hhhccCccccccCCCceecCCCCHHHHHHHHHHcCCCEEE
Q 013262          335 EEWEVREKFSWVELAEREGKI-EEV------AVTSEE---MEMYIDLHPLTNTTPYTVIESMSVAKAMVLFRQVGLRHLL  404 (447)
Q Consensus       335 ~~~~~~~~~~~~d~~~~~~~~-~~~------~l~~~~---~~~~idl~~im~~~p~tV~~~~sL~~a~~lf~~~gl~~Lp  404 (447)
                      ...+........++.+..... ++.      ...+.+   .+...+++++|+++|++|++|+++.++.++|.+++.+++|
T Consensus       524 ~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~e~~~~~~~~~~~v~~iMt~~pitV~~~~~l~ea~~~M~~~~i~~lp  603 (632)
T 3org_A          524 AGHRTLVLLDAADLSENIEGLVDETPSGEHSSKGKRTATVLEPTSSLVVPCDVSPIVVTSYSLVRQLHFLFVMLMPSMIY  603 (632)
T ss_dssp             -----------------------------------------------CCSCCCCCCEEETTCBHHHHHHHHHHTCCSEEE
T ss_pred             ccccceeccCHHHHHhhcccCCCCCcccchhhhcccceEeeccccccchhhcCCCceecCCCcHHHHHHHHHhcCCCEEE
Confidence            000000001111111100000 000      000000   0111137899999999999999999999999999999999


Q ss_pred             EEeCcccCCCCcEEEEEeHHHHHHHHHh
Q 013262          405 VVPKYEAAGVSPVVGILTRQDLRAFNIL  432 (447)
Q Consensus       405 VVd~~~~~g~~~lvGIITr~DLl~~~~~  432 (447)
                      |+ +     +|+++||||++|+++++.+
T Consensus       604 Vv-e-----~G~lvGIVT~~Dll~~~~~  625 (632)
T 3org_A          604 VT-E-----RGKLVGIVEREDVAYGYSN  625 (632)
T ss_dssp             EE-E-----TTEEEEEEEGGGTEECCCC
T ss_pred             EE-E-----CCEEEEEEehhhHHHHHhh
Confidence            99 4     4689999999999876554



>1ots_A Voltage-gated CLC-type chloride channel ERIC; CLC chloride channel, FAB complex, membrane protein; 2.51A {Escherichia coli} SCOP: f.20.1.1 PDB: 2fee_A 2h2p_A 2exw_A 1kpk_A 2exy_A 2htl_A 3ejy_A 2ht2_A 2fed_A 2fec_A 1otu_A 3ejz_A 2ht4_A 2htk_A 2ht3_A 1ott_A 2h2s_A 3det_A 2ez0_A 3nmo_A ... Back     alignment and structure
>4ene_A CLC-EC1, H(+)/CL(-) exchange transporter CLCA; membrane protein, coupled ION transporter, cell membrane, TR protein; HET: DMU MAL; 2.40A {Escherichia coli k-12} PDB: 1ots_A 2fee_A 2h2p_A 2exw_A 1kpk_A 2exy_A 2fed_A 2fec_A 1otu_A 2htl_A 2ht2_A 3ejy_A 1ott_A 2h2s_A 4fg6_A 2ht4_A 4ftp_A 3ejz_A 2ht3_A 2htk_A ... Back     alignment and structure
>3nd0_A SLL0855 protein; CLC family CL-/H+ antiporter, CLC_EC1 homolog, transport protein; 3.20A {Synechocystis} PDB: 3q17_A Back     alignment and structure
>2d4z_A Chloride channel protein; CLC chloride channel cytoplasmic domain, CBS domains, ION CH regulatory subunit, transport protein; 3.10A {Torpedo marmorata} SCOP: d.37.1.1 Back     alignment and structure
>4esy_A CBS domain containing membrane protein; structural genomics, PSI-biology; 2.01A {Sphaerobacter thermophilus} Back     alignment and structure
>3k6e_A CBS domain protein; streptococcus pneumoniae TIGR4, structural genomics, PSI-2, protein structure initiative; 2.81A {Streptococcus pneumoniae} Back     alignment and structure
>3i8n_A Uncharacterized protein VP2912; APC64273.1, vibrio parahaemolyticus RIMD 2210633, structural genomics, PSI-2; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>3lv9_A Putative transporter; CBS domain, PSI, MCSG, structural genomics, protein structur initiative, midwest center for structural genomics; 2.40A {Clostridium difficile 630} Back     alignment and structure
>3hf7_A Uncharacterized CBS-domain protein; CSB-domain PAIR, AMP, PSI, MCSG, STR genomics, midwest center for structural genomics; HET: AMP; 2.75A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3kpb_A Uncharacterized protein MJ0100; CBS domain, S-adenosylmethionine, conformational change, unknown function; HET: SAM; 1.60A {Methanocaldococcus jannaschii} SCOP: d.37.1.0 PDB: 3kpd_A* 3kpc_A* Back     alignment and structure
>2ef7_A Hypothetical protein ST2348; CBS-domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.10A {Sulfolobus tokodaii} SCOP: d.37.1.1 Back     alignment and structure
>3lhh_A CBS domain protein; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG, cell membrane; HET: MSE AMP; 2.10A {Shewanella oneidensis} Back     alignment and structure
>3oco_A Hemolysin-like protein containing CBS domains; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.20A {Oenococcus oeni} Back     alignment and structure
>3jtf_A Magnesium and cobalt efflux protein; CBS domain, CORC, AMP, structural genomics, PSI-2, protein S initiative; HET: MSE AMP; 2.00A {Bordetella parapertussis} Back     alignment and structure
>3lfr_A Putative metal ION transporter; CBS, AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 1.53A {Pseudomonas syringae} Back     alignment and structure
>2yzi_A Hypothetical protein PH0107; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; 2.25A {Pyrococcus horikoshii} SCOP: d.37.1.1 Back     alignment and structure
>3gby_A Uncharacterized protein CT1051; CBS domain, structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Chlorobium tepidum tls} Back     alignment and structure
>3nqr_A Magnesium and cobalt efflux protein CORC; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: AMP; 2.00A {Salmonella typhimurium} Back     alignment and structure
>3fhm_A Uncharacterized protein ATU1752; CBS domain, prokaryotic, bound nucleotide, AMP, NADH, struct genomics, PSI-2; HET: AMP NAI; 2.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>3fv6_A YQZB protein; CBS domain dimer, metabolism regulator, central glycolytic G regulator, transcription; 1.95A {Bacillus subtilis} PDB: 3fwr_A* 3fws_A* Back     alignment and structure
>2rih_A Conserved protein with 2 CBS domains; bateman domain, AMP binding protein, ligand-BIND protein; 2.10A {Pyrobaculum aerophilum} SCOP: d.37.1.1 PDB: 2rif_A Back     alignment and structure
>2p9m_A Hypothetical protein MJ0922; structural genomics, collaboratory for structural genomics, secsg; 2.59A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} Back     alignment and structure
>3ocm_A Putative membrane protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADP; 1.80A {Bordetella parapertussis} Back     alignment and structure
>3lqn_A CBS domain protein; csgid, structural genomics, unknown function, center for structural genomics of infectious diseases; 1.80A {Bacillus anthracis} SCOP: d.37.1.0 Back     alignment and structure
>1pbj_A Hypothetical protein; structural genomics, domain, PSI, protein structure initiative; 1.40A {Methanothermobacter thermautotrophicusdelta H} SCOP: d.37.1.1 Back     alignment and structure
>1o50_A CBS domain-containing predicted protein TM0935; CBS-domain PAIR fold, structural genomics, joint center for structural genomics, JCSG; 1.87A {Thermotoga maritima} SCOP: d.37.1.1 Back     alignment and structure
>3k2v_A Putative D-arabinose 5-phosphate isomerase; KPSF-like protein, CBS domain, structural genomics, PSI-2, P structure initiative; HET: MSE CMK; 1.95A {Klebsiella pneumoniae subsp} PDB: 3fna_A* Back     alignment and structure
>4gqw_A CBS domain-containing protein CBSX1, chloroplasti; thioredoxin, plant, protein binding; 2.20A {Arabidopsis thaliana} Back     alignment and structure
>2emq_A Hypothetical conserved protein; CBS domains, NPPSFA, national project on protein structural functional analyses; 2.50A {Geobacillus kaustophilus} Back     alignment and structure
>3sl7_A CBS domain-containing protein CBSX2; CBS-PAIR protein, redox regulator, plant CBS domain, thiored chloroplast, membrane protein; 1.91A {Arabidopsis thaliana} Back     alignment and structure
>3kxr_A Magnesium transporter, putative; cystathionine beta-synthase, Mg2+ transporter, structural GE PSI-2, protein structure initiative; 2.41A {Shewanella oneidensis mr-1} Back     alignment and structure
>2o16_A Acetoin utilization protein ACUB, putative; structural genomics, unknown function, PSI-2, protein struct initiative; 1.90A {Vibrio cholerae} SCOP: d.37.1.1 Back     alignment and structure
>2j9l_A Chloride channel protein 5; ION channel, ION transport, voltage-gated; HET: ATP; 2.30A {Homo sapiens} SCOP: d.37.1.1 PDB: 2ja3_A* Back     alignment and structure
>2rc3_A CBS domain; in SITU proteolysis, BR, structural genomics, PSI-2, protein structure initiative; HET: NAD; 1.60A {Nitrosomonas europaea atcc 19718} SCOP: d.37.1.1 Back     alignment and structure
>2nyc_A Nuclear protein SNF4; bateman2 domain, AMP kinase, protein binding; 1.90A {Saccharomyces cerevisiae} SCOP: d.37.1.1 PDB: 2nye_A Back     alignment and structure
>2pfi_A Chloride channel protein CLC-Ka; cystathionine beta synthetase (CBS) domains containing protein, transport protein; 1.60A {Homo sapiens} Back     alignment and structure
>3oi8_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADN; 1.99A {Neisseria meningitidis serogroup B} Back     alignment and structure
>1y5h_A Hypothetical protein RV2626C; CBS domain, unknown function; 1.50A {Mycobacterium tuberculosis} SCOP: d.37.1.1 PDB: 1xkf_A Back     alignment and structure
>1pvm_A Conserved hypothetical protein TA0289; structural genomics, CBS domain, PSI, protein structure initiative; 1.50A {Thermoplasma acidophilum dsm 1728} SCOP: d.37.1.1 g.41.13.1 PDB: 2qh1_A Back     alignment and structure
>4fry_A Putative signal-transduction protein with CBS DOM; CBS domain,ssgcid, structural genomics, niaid; HET: NAD AMP; 2.10A {Burkholderia ambifaria} Back     alignment and structure
>1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 Back     alignment and structure
>3pc3_A CG1753, isoform A; CBS, synthase, PLP, heme, aminoacrylate, lyase; HET: HEM P1T; 1.55A {Drosophila melanogaster} PDB: 3pc2_A* 3pc4_A* Back     alignment and structure
>3l2b_A Probable manganase-dependent inorganic pyrophosphatase; family II, CBS domain, bateman domain, AP4A, diadenosine polyphosphate, DRTGG; HET: B4P; 2.27A {Clostridium perfringens} PDB: 3l31_A* Back     alignment and structure
>2oux_A Magnesium transporter; 10001B, structural genomics, PSI-2, P structure initiative, nysgxrc; 2.16A {Enterococcus faecalis} SCOP: a.118.26.1 d.37.1.1 Back     alignment and structure
>1vr9_A CBS domain protein/ACT domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.70A {Thermotoga maritima} SCOP: d.37.1.1 Back     alignment and structure
>3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 Back     alignment and structure
>2yvy_A MGTE, Mg2+ transporter MGTE; membrane protein, transport protein; 2.30A {Thermus thermophilus} PDB: 2yvz_A Back     alignment and structure
>3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C Back     alignment and structure
>2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 Back     alignment and structure
>3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* Back     alignment and structure
>3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 Back     alignment and structure
>3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* Back     alignment and structure
>2zy9_A Mg2+ transporter MGTE; membrane protien, metal transport; 2.94A {Thermus thermophilus} PDB: 2yvx_A Back     alignment and structure
>2qrd_G Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} PDB: 2qrc_G* 2qr1_G* 2qre_G* 2oox_G* 2ooy_G* Back     alignment and structure
>2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 Back     alignment and structure
>2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* Back     alignment and structure
>3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* Back     alignment and structure
>2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* Back     alignment and structure
>3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C Back     alignment and structure
>2qrd_G Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} PDB: 2qrc_G* 2qr1_G* 2qre_G* 2oox_G* 2ooy_G* Back     alignment and structure
>1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 Back     alignment and structure
>4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} Back     alignment and structure
>1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 Back     alignment and structure
>4af0_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase, GTP biosynthesis, drug resistance; HET: MOA IMP; 2.20A {Cryptococcus neoformans} PDB: 4af0_B* Back     alignment and structure
>1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* Back     alignment and structure
>1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* Back     alignment and structure
>2cu0_A Inosine-5'-monophosphate dehydrogenase; structural genomics, pyrococcus horikoshii OT3, riken structural genomics/PROT initiative, RSGI; HET: XMP; 2.10A {Pyrococcus horikoshii} SCOP: c.1.5.1 Back     alignment and structure
>1ots_A Voltage-gated CLC-type chloride channel ERIC; CLC chloride channel, FAB complex, membrane protein; 2.51A {Escherichia coli} SCOP: f.20.1.1 PDB: 2fee_A 2h2p_A 2exw_A 1kpk_A 2exy_A 2htl_A 3ejy_A 2ht2_A 2fed_A 2fec_A 1otu_A 3ejz_A 2ht4_A 2htk_A 2ht3_A 1ott_A 2h2s_A 3det_A 2ez0_A 3nmo_A ... Back     alignment and structure
>4ene_A CLC-EC1, H(+)/CL(-) exchange transporter CLCA; membrane protein, coupled ION transporter, cell membrane, TR protein; HET: DMU MAL; 2.40A {Escherichia coli k-12} PDB: 1ots_A 2fee_A 2h2p_A 2exw_A 1kpk_A 2exy_A 2fed_A 2fec_A 1otu_A 2htl_A 2ht2_A 3ejy_A 1ott_A 2h2s_A 4fg6_A 2ht4_A 4ftp_A 3ejz_A 2ht3_A 2htk_A ... Back     alignment and structure
>3nd0_A SLL0855 protein; CLC family CL-/H+ antiporter, CLC_EC1 homolog, transport protein; 3.20A {Synechocystis} PDB: 3q17_A Back     alignment and structure
>3ghd_A A cystathionine beta-synthase domain protein FUSE ribbon-like domain; PF1953,APC40009,cystathionine beta-synthase domain protein; 1.81A {Pyrococcus furiosus} Back     alignment and structure
>1vr9_A CBS domain protein/ACT domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.70A {Thermotoga maritima} SCOP: d.37.1.1 Back     alignment and structure
>3org_A CMCLC; transporter, transport protein; 3.50A {Cyanidioschyzon merolae} Back     alignment and structure
>4esy_A CBS domain containing membrane protein; structural genomics, PSI-biology; 2.01A {Sphaerobacter thermophilus} Back     alignment and structure
>3ghd_A A cystathionine beta-synthase domain protein FUSE ribbon-like domain; PF1953,APC40009,cystathionine beta-synthase domain protein; 1.81A {Pyrococcus furiosus} Back     alignment and structure
>2d4z_A Chloride channel protein; CLC chloride channel cytoplasmic domain, CBS domains, ION CH regulatory subunit, transport protein; 3.10A {Torpedo marmorata} SCOP: d.37.1.1 Back     alignment and structure
>3l2b_A Probable manganase-dependent inorganic pyrophosphatase; family II, CBS domain, bateman domain, AP4A, diadenosine polyphosphate, DRTGG; HET: B4P; 2.27A {Clostridium perfringens} PDB: 3l31_A* Back     alignment and structure
>3lv9_A Putative transporter; CBS domain, PSI, MCSG, structural genomics, protein structur initiative, midwest center for structural genomics; 2.40A {Clostridium difficile 630} Back     alignment and structure
>3lhh_A CBS domain protein; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG, cell membrane; HET: MSE AMP; 2.10A {Shewanella oneidensis} Back     alignment and structure
>3k2v_A Putative D-arabinose 5-phosphate isomerase; KPSF-like protein, CBS domain, structural genomics, PSI-2, P structure initiative; HET: MSE CMK; 1.95A {Klebsiella pneumoniae subsp} PDB: 3fna_A* Back     alignment and structure
>2rih_A Conserved protein with 2 CBS domains; bateman domain, AMP binding protein, ligand-BIND protein; 2.10A {Pyrobaculum aerophilum} SCOP: d.37.1.1 PDB: 2rif_A Back     alignment and structure
>3kpb_A Uncharacterized protein MJ0100; CBS domain, S-adenosylmethionine, conformational change, unknown function; HET: SAM; 1.60A {Methanocaldococcus jannaschii} SCOP: d.37.1.0 PDB: 3kpd_A* 3kpc_A* Back     alignment and structure
>2yzi_A Hypothetical protein PH0107; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; 2.25A {Pyrococcus horikoshii} SCOP: d.37.1.1 Back     alignment and structure
>2o16_A Acetoin utilization protein ACUB, putative; structural genomics, unknown function, PSI-2, protein struct initiative; 1.90A {Vibrio cholerae} SCOP: d.37.1.1 Back     alignment and structure
>2p9m_A Hypothetical protein MJ0922; structural genomics, collaboratory for structural genomics, secsg; 2.59A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} Back     alignment and structure
>1pbj_A Hypothetical protein; structural genomics, domain, PSI, protein structure initiative; 1.40A {Methanothermobacter thermautotrophicusdelta H} SCOP: d.37.1.1 Back     alignment and structure
>3fv6_A YQZB protein; CBS domain dimer, metabolism regulator, central glycolytic G regulator, transcription; 1.95A {Bacillus subtilis} PDB: 3fwr_A* 3fws_A* Back     alignment and structure
>3gby_A Uncharacterized protein CT1051; CBS domain, structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Chlorobium tepidum tls} Back     alignment and structure
>3i8n_A Uncharacterized protein VP2912; APC64273.1, vibrio parahaemolyticus RIMD 2210633, structural genomics, PSI-2; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>3nqr_A Magnesium and cobalt efflux protein CORC; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: AMP; 2.00A {Salmonella typhimurium} Back     alignment and structure
>3lqn_A CBS domain protein; csgid, structural genomics, unknown function, center for structural genomics of infectious diseases; 1.80A {Bacillus anthracis} SCOP: d.37.1.0 Back     alignment and structure
>3hf7_A Uncharacterized CBS-domain protein; CSB-domain PAIR, AMP, PSI, MCSG, STR genomics, midwest center for structural genomics; HET: AMP; 2.75A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3k6e_A CBS domain protein; streptococcus pneumoniae TIGR4, structural genomics, PSI-2, protein structure initiative; 2.81A {Streptococcus pneumoniae} Back     alignment and structure
>3jtf_A Magnesium and cobalt efflux protein; CBS domain, CORC, AMP, structural genomics, PSI-2, protein S initiative; HET: MSE AMP; 2.00A {Bordetella parapertussis} Back     alignment and structure
>2pfi_A Chloride channel protein CLC-Ka; cystathionine beta synthetase (CBS) domains containing protein, transport protein; 1.60A {Homo sapiens} Back     alignment and structure
>1pvm_A Conserved hypothetical protein TA0289; structural genomics, CBS domain, PSI, protein structure initiative; 1.50A {Thermoplasma acidophilum dsm 1728} SCOP: d.37.1.1 g.41.13.1 PDB: 2qh1_A Back     alignment and structure
>1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 Back     alignment and structure
>2ef7_A Hypothetical protein ST2348; CBS-domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.10A {Sulfolobus tokodaii} SCOP: d.37.1.1 Back     alignment and structure
>2emq_A Hypothetical conserved protein; CBS domains, NPPSFA, national project on protein structural functional analyses; 2.50A {Geobacillus kaustophilus} Back     alignment and structure
>3kxr_A Magnesium transporter, putative; cystathionine beta-synthase, Mg2+ transporter, structural GE PSI-2, protein structure initiative; 2.41A {Shewanella oneidensis mr-1} Back     alignment and structure
>2rc3_A CBS domain; in SITU proteolysis, BR, structural genomics, PSI-2, protein structure initiative; HET: NAD; 1.60A {Nitrosomonas europaea atcc 19718} SCOP: d.37.1.1 Back     alignment and structure
>3fhm_A Uncharacterized protein ATU1752; CBS domain, prokaryotic, bound nucleotide, AMP, NADH, struct genomics, PSI-2; HET: AMP NAI; 2.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>4gqw_A CBS domain-containing protein CBSX1, chloroplasti; thioredoxin, plant, protein binding; 2.20A {Arabidopsis thaliana} Back     alignment and structure
>2nyc_A Nuclear protein SNF4; bateman2 domain, AMP kinase, protein binding; 1.90A {Saccharomyces cerevisiae} SCOP: d.37.1.1 PDB: 2nye_A Back     alignment and structure
>3sl7_A CBS domain-containing protein CBSX2; CBS-PAIR protein, redox regulator, plant CBS domain, thiored chloroplast, membrane protein; 1.91A {Arabidopsis thaliana} Back     alignment and structure
>3lfr_A Putative metal ION transporter; CBS, AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 1.53A {Pseudomonas syringae} Back     alignment and structure
>3oco_A Hemolysin-like protein containing CBS domains; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.20A {Oenococcus oeni} Back     alignment and structure
>1y5h_A Hypothetical protein RV2626C; CBS domain, unknown function; 1.50A {Mycobacterium tuberculosis} SCOP: d.37.1.1 PDB: 1xkf_A Back     alignment and structure
>3ocm_A Putative membrane protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADP; 1.80A {Bordetella parapertussis} Back     alignment and structure
>1o50_A CBS domain-containing predicted protein TM0935; CBS-domain PAIR fold, structural genomics, joint center for structural genomics, JCSG; 1.87A {Thermotoga maritima} SCOP: d.37.1.1 Back     alignment and structure
>3oi8_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADN; 1.99A {Neisseria meningitidis serogroup B} Back     alignment and structure
>2j9l_A Chloride channel protein 5; ION channel, ION transport, voltage-gated; HET: ATP; 2.30A {Homo sapiens} SCOP: d.37.1.1 PDB: 2ja3_A* Back     alignment and structure
>4fry_A Putative signal-transduction protein with CBS DOM; CBS domain,ssgcid, structural genomics, niaid; HET: NAD AMP; 2.10A {Burkholderia ambifaria} Back     alignment and structure
>3pc3_A CG1753, isoform A; CBS, synthase, PLP, heme, aminoacrylate, lyase; HET: HEM P1T; 1.55A {Drosophila melanogaster} PDB: 3pc2_A* 3pc4_A* Back     alignment and structure
>2yvy_A MGTE, Mg2+ transporter MGTE; membrane protein, transport protein; 2.30A {Thermus thermophilus} PDB: 2yvz_A Back     alignment and structure
>2oux_A Magnesium transporter; 10001B, structural genomics, PSI-2, P structure initiative, nysgxrc; 2.16A {Enterococcus faecalis} SCOP: a.118.26.1 d.37.1.1 Back     alignment and structure
>2zy9_A Mg2+ transporter MGTE; membrane protien, metal transport; 2.94A {Thermus thermophilus} PDB: 2yvx_A Back     alignment and structure
>1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* Back     alignment and structure
>3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* Back     alignment and structure
>4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 Back     alignment and structure
>4af0_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase, GTP biosynthesis, drug resistance; HET: MOA IMP; 2.20A {Cryptococcus neoformans} PDB: 4af0_B* Back     alignment and structure
>2cu0_A Inosine-5'-monophosphate dehydrogenase; structural genomics, pyrococcus horikoshii OT3, riken structural genomics/PROT initiative, RSGI; HET: XMP; 2.10A {Pyrococcus horikoshii} SCOP: c.1.5.1 Back     alignment and structure
>1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 Back     alignment and structure
>4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} Back     alignment and structure
>1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 447
d1otsa_444 f.20.1.1 (A:) Clc chloride channel {Escherichia co 2e-21
d2j9la1169 d.37.1.1 (A:578-746) Chloride channel protein 5, C 5e-07
d2d4za3160 d.37.1.1 (A:527-606,A:691-770) Chloride channel pr 1e-05
d2ooxe1179 d.37.1.1 (E:3-181) Uncharacterized protein C1556.0 2e-05
d2yzqa1156 d.37.1.1 (A:123-278) Uncharacterized protein PH178 0.001
>d1otsa_ f.20.1.1 (A:) Clc chloride channel {Escherichia coli [TaxId: 562]} Length = 444 Back     information, alignment and structure

class: Membrane and cell surface proteins and peptides
fold: Clc chloride channel
superfamily: Clc chloride channel
family: Clc chloride channel
domain: Clc chloride channel
species: Escherichia coli [TaxId: 562]
 Score = 93.7 bits (232), Expect = 2e-21
 Identities = 33/133 (24%), Positives = 61/133 (45%), Gaps = 4/133 (3%)

Query: 107 NIFSSNTPTEFQPSSILIFFILYCILGLITFGIAVPSGLFLPIILMGSAYGRLLGMAMGS 166
           N+    T   F    ++  F+   I  L+ F    P G+F P++ +G+  G   GM    
Sbjct: 302 NLIPIATAGNFSMGMLVFIFVARVITTLLCFSSGAPGGIFAPMLALGTVLGTAFGMVAVE 361

Query: 167 Y---TNIDQGLYAVLGAASLMAGSMRMTVSLCVIFLELTNNLLLLPITMIVLLIAKTVGD 223
                +++ G +A+ G  +L+A S+R  ++  ++ LE+T+N  L+   +I  L A  +  
Sbjct: 362 LFPQYHLEAGTFAIAGMGALLAASIRAPLTGIILVLEMTDNYQLILPMIITGLGATLLAQ 421

Query: 224 SFNP-SIYEIILE 235
                 +Y  IL 
Sbjct: 422 FTGGKPLYSAILA 434


>d2j9la1 d.37.1.1 (A:578-746) Chloride channel protein 5, ClC-5 {Human (Homo sapiens) [TaxId: 9606]} Length = 169 Back     information, alignment and structure
>d2d4za3 d.37.1.1 (A:527-606,A:691-770) Chloride channel protein, CBS tandem {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} Length = 160 Back     information, alignment and structure
>d2ooxe1 d.37.1.1 (E:3-181) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Length = 179 Back     information, alignment and structure
>d2yzqa1 d.37.1.1 (A:123-278) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Length = 156 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query447
d1otsa_444 Clc chloride channel {Escherichia coli [TaxId: 562 99.93
d2d4za3160 Chloride channel protein, CBS tandem {Marbled elec 99.83
d2ef7a1127 Uncharacterized protein ST2348 {Sulfolobus tokodai 99.8
d2o16a3139 Hypothetical protein VC0737 {Vibrio cholerae [TaxI 99.8
d1pvma4142 Hypothetical protein Ta0289 {Archaeon Thermoplasma 99.79
d1y5ha3123 Hypothetical protein Rv2626c {Mycobacterium tuberc 99.78
d2yzqa2122 Uncharacterized protein PH1780 {Pyrococcus horikos 99.78
d2yzia1132 Uncharacterized protein PH0107 {Pyrococcus horikos 99.78
d3ddja1141 Uncharacterized protein SSO3205 {Sulfolobus solfat 99.78
d2ouxa2127 Magnesium transporter MgtE {Enterococcus faecalis 99.77
d2yzqa1156 Uncharacterized protein PH1780 {Pyrococcus horikos 99.77
d2yvxa2144 Magnesium transporter MgtE {Thermus thermophilus [ 99.76
d1yava3132 Hypothetical protein YkuL {Bacillus subtilis [TaxI 99.76
d2j9la1169 Chloride channel protein 5, ClC-5 {Human (Homo sap 99.76
d1pbja3120 Hypothetical protein MTH1622 {Archaeon Methanobact 99.76
d1vr9a3121 Hypothetical protein TM0892, CBS tandem {Thermotog 99.76
d2rc3a1127 Uncharacterized protein NE2398 {Nitrosomonas europ 99.75
d2riha1131 Uncharacterized protein PAE2072 {Pyrobaculum aerop 99.73
d1zfja4126 Type II inosine monophosphate dehydrogenase CBS do 99.73
d3ddja2135 Uncharacterized protein SSO3205 {Sulfolobus solfat 99.71
d2v8qe2159 5'-AMP-activated protein kinase subunit gamma-1, A 99.7
d2ooxe2153 Uncharacterized protein C1556.08c {Schizosaccharom 99.7
d2ooxe1179 Uncharacterized protein C1556.08c {Schizosaccharom 99.7
d1o50a3145 Hypothetical protein TM0935 {Thermotoga maritima [ 99.69
d2nyca1140 Nuclear protein SNF4 {Baker's yeast (Saccharomyces 99.67
d2v8qe1145 5'-AMP-activated protein kinase subunit gamma-1, A 99.66
d1jr1a4120 Type II inosine monophosphate dehydrogenase CBS do 99.63
d2ouxa2127 Magnesium transporter MgtE {Enterococcus faecalis 98.58
d2o16a3139 Hypothetical protein VC0737 {Vibrio cholerae [TaxI 98.56
d1otsa_444 Clc chloride channel {Escherichia coli [TaxId: 562 98.56
d2yzia1132 Uncharacterized protein PH0107 {Pyrococcus horikos 98.55
d2yzqa1156 Uncharacterized protein PH1780 {Pyrococcus horikos 98.54
d1o50a3145 Hypothetical protein TM0935 {Thermotoga maritima [ 98.47
d1y5ha3123 Hypothetical protein Rv2626c {Mycobacterium tuberc 98.43
d1zfja4126 Type II inosine monophosphate dehydrogenase CBS do 98.42
d1vr9a3121 Hypothetical protein TM0892, CBS tandem {Thermotog 98.4
d1pvma4142 Hypothetical protein Ta0289 {Archaeon Thermoplasma 98.39
d2yvxa2144 Magnesium transporter MgtE {Thermus thermophilus [ 98.39
d2d4za3160 Chloride channel protein, CBS tandem {Marbled elec 98.36
d2yzqa2122 Uncharacterized protein PH1780 {Pyrococcus horikos 98.35
d1pbja3120 Hypothetical protein MTH1622 {Archaeon Methanobact 98.34
d3ddja1141 Uncharacterized protein SSO3205 {Sulfolobus solfat 98.32
d1yava3132 Hypothetical protein YkuL {Bacillus subtilis [TaxI 98.29
d3ddja2135 Uncharacterized protein SSO3205 {Sulfolobus solfat 98.29
d2ef7a1127 Uncharacterized protein ST2348 {Sulfolobus tokodai 98.29
d2riha1131 Uncharacterized protein PAE2072 {Pyrobaculum aerop 98.29
d2nyca1140 Nuclear protein SNF4 {Baker's yeast (Saccharomyces 98.23
d2rc3a1127 Uncharacterized protein NE2398 {Nitrosomonas europ 98.15
d2ooxe2153 Uncharacterized protein C1556.08c {Schizosaccharom 98.1
d2j9la1169 Chloride channel protein 5, ClC-5 {Human (Homo sap 98.05
d1jr1a4120 Type II inosine monophosphate dehydrogenase CBS do 98.05
d2v8qe1145 5'-AMP-activated protein kinase subunit gamma-1, A 97.9
d2v8qe2159 5'-AMP-activated protein kinase subunit gamma-1, A 97.63
d2ooxe1179 Uncharacterized protein C1556.08c {Schizosaccharom 97.58
>d1otsa_ f.20.1.1 (A:) Clc chloride channel {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: Clc chloride channel
superfamily: Clc chloride channel
family: Clc chloride channel
domain: Clc chloride channel
species: Escherichia coli [TaxId: 562]
Probab=99.93  E-value=2.7e-26  Score=234.41  Aligned_cols=134  Identities=23%  Similarity=0.424  Sum_probs=122.0

Q ss_pred             CChHHHHHHHhcCCCCCCcchHHHHHHHHHHHHHHHHHhhccCCccchhhHHHHHHHHHHHHHHHhhcc---CCcchHHH
Q 013262           99 TTNDDAVRNIFSSNTPTEFQPSSILIFFILYCILGLITFGIAVPSGLFLPIILMGSAYGRLLGMAMGSY---TNIDQGLY  175 (447)
Q Consensus        99 ~~~~~~i~~l~~~~~~~~~~~~~l~~~~~~k~~~~~~t~g~g~~gG~f~P~l~iGa~~G~~~g~~~~~~---~~~~~~~~  175 (447)
                      +++++.++.+++.    ++++..+++++++|+++|++|+|+|.|||+|+|++++||++|+++|.+++..   ..++|+.|
T Consensus       298 g~G~~~~~~~~~~----~~~~~~l~~~~~~K~~~t~~t~~~G~~GG~f~P~l~iGa~~G~~~~~~~~~~~~~~~~~~~~~  373 (444)
T d1otsa_         298 GGGFNLIPIATAG----NFSMGMLVFIFVARVITTLLCFSSGAPGGIFAPMLALGTVLGTAFGMVAVELFPQYHLEAGTF  373 (444)
T ss_dssp             SCSTTHHHHHHHT----CSCHHHHHHHHHHHHHHHHHHHHTTCSSBSHHHHHHHHHHHHHHHHHHHHHHCGGGTCCHHHH
T ss_pred             CCchHHHHHHhcC----CcchHHHHHHHHHHHHHHHHHhhcCCCCCeehHHHHHHHHHHHHHHHHHHHhCCcccCCHHHH
Confidence            3455667777764    3667888999999999999999999999999999999999999999998753   35789999


Q ss_pred             HHHHHHHHHHhhhchhHHHHHHHHHhhcCCchHHHHHHHHHHHHHHHhhc-CCchHHHHHHh
Q 013262          176 AVLGAASLMAGSMRMTVSLCVIFLELTNNLLLLPITMIVLLIAKTVGDSF-NPSIYEIILEL  236 (447)
Q Consensus       176 a~~G~aa~~~g~~~~p~s~~vi~~E~t~~~~~~~p~~ia~~va~~v~~~l-~~sIYd~~l~~  236 (447)
                      +++||+|+++|++|+|+|+++|++|+||++++++|+|+++++|+++++.+ ++|+||.++++
T Consensus       374 alvGmaa~~a~~~~~Plta~vl~~Eltg~~~~~~p~~ia~~~a~~v~~~~~~~siY~~~l~~  435 (444)
T d1otsa_         374 AIAGMGALLAASIRAPLTGIILVLEMTDNYQLILPMIITGLGATLLAQFTGGKPLYSAILAR  435 (444)
T ss_dssp             HHHHHTHHHHHTSCCHHHHHHHHHHHHCCGGGHHHHHHHHHHHHHHHHTTTCCCHHHHHHHH
T ss_pred             HHHHHHHHHHHHHhhHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHhCCCChHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999 78999999885



>d2d4za3 d.37.1.1 (A:527-606,A:691-770) Chloride channel protein, CBS tandem {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} Back     information, alignment and structure
>d2ef7a1 d.37.1.1 (A:1-127) Uncharacterized protein ST2348 {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d2o16a3 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1pvma4 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1y5ha3 d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2yzqa2 d.37.1.1 (A:1-122) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2yzia1 d.37.1.1 (A:4-135) Uncharacterized protein PH0107 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d3ddja1 d.37.1.1 (A:136-276) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2ouxa2 d.37.1.1 (A:136-262) Magnesium transporter MgtE {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2yzqa1 d.37.1.1 (A:123-278) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2yvxa2 d.37.1.1 (A:132-275) Magnesium transporter MgtE {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1yava3 d.37.1.1 (A:13-144) Hypothetical protein YkuL {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2j9la1 d.37.1.1 (A:578-746) Chloride channel protein 5, ClC-5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pbja3 d.37.1.1 (A:2-121) Hypothetical protein MTH1622 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1vr9a3 d.37.1.1 (A:1-121) Hypothetical protein TM0892, CBS tandem {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2rc3a1 d.37.1.1 (A:23-149) Uncharacterized protein NE2398 {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d2riha1 d.37.1.1 (A:2-132) Uncharacterized protein PAE2072 {Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1zfja4 d.37.1.1 (A:95-220) Type II inosine monophosphate dehydrogenase CBS domains {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d3ddja2 d.37.1.1 (A:1-135) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2v8qe2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ooxe2 d.37.1.1 (E:182-334) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d2ooxe1 d.37.1.1 (E:3-181) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1o50a3 d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2nyca1 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2v8qe1 d.37.1.1 (E:182-326) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jr1a4 d.37.1.1 (A:113-232) Type II inosine monophosphate dehydrogenase CBS domains {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2ouxa2 d.37.1.1 (A:136-262) Magnesium transporter MgtE {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2o16a3 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1otsa_ f.20.1.1 (A:) Clc chloride channel {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2yzia1 d.37.1.1 (A:4-135) Uncharacterized protein PH0107 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2yzqa1 d.37.1.1 (A:123-278) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1o50a3 d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1y5ha3 d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zfja4 d.37.1.1 (A:95-220) Type II inosine monophosphate dehydrogenase CBS domains {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1vr9a3 d.37.1.1 (A:1-121) Hypothetical protein TM0892, CBS tandem {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pvma4 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2yvxa2 d.37.1.1 (A:132-275) Magnesium transporter MgtE {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2d4za3 d.37.1.1 (A:527-606,A:691-770) Chloride channel protein, CBS tandem {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} Back     information, alignment and structure
>d2yzqa2 d.37.1.1 (A:1-122) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1pbja3 d.37.1.1 (A:2-121) Hypothetical protein MTH1622 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d3ddja1 d.37.1.1 (A:136-276) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1yava3 d.37.1.1 (A:13-144) Hypothetical protein YkuL {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d3ddja2 d.37.1.1 (A:1-135) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2ef7a1 d.37.1.1 (A:1-127) Uncharacterized protein ST2348 {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d2riha1 d.37.1.1 (A:2-132) Uncharacterized protein PAE2072 {Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d2nyca1 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2rc3a1 d.37.1.1 (A:23-149) Uncharacterized protein NE2398 {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d2ooxe2 d.37.1.1 (E:182-334) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d2j9la1 d.37.1.1 (A:578-746) Chloride channel protein 5, ClC-5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jr1a4 d.37.1.1 (A:113-232) Type II inosine monophosphate dehydrogenase CBS domains {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2v8qe1 d.37.1.1 (E:182-326) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2v8qe2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ooxe1 d.37.1.1 (E:3-181) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure