Citrus Sinensis ID: 013265


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440------
MRSEGDHINELPDDILVNILSRLTMKEAVRTSIISSRWRYLWRGFSGCLNFDDPFTMANSKWPHLNLKSGPINVERHKFVNWVNQVLSSLEGHCTEELRICFDVFSNHDIDNWIKFALERRVRRLELDFSRVVYNLRFVGQYTFPSHLDFYSSFRHLTDLSLTTVGITGEVLEHLLCYCCPVLEVLNVAESSSLTSLKVSGPSLKLKHLKLNKLDNLKDLQLHAPNLLSFEYSGPILPFSFRNVPNLVDASFWGCFSAYIAKNLCQHSIFLVQLHTLKLDTCHLLIGDSEYRAGRYLHDIPEMCNLKHLEIIGTPKVNDLIFCIALLEAAPSLYKFSLKLVSQYDYESYESVKTIKDQPYLSFTELRSIRVVELLGFVGHTADFELVMYLIFSAKLLEKIIIDPCPTWRVGTPAELIWRETAEYQSARRRAFELAAKFPLWEFVIP
ccccccccccccHHHHHHHHccccHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHccccccccEEEEEEcccccccHHHHHHHHHHccccEEEEEEcccccccccccccccccccccccccccccEEEEEEEEEcHHHHHHHHHHccccccEEEEEEcccccEEEEEcccccEEEEEEEEEccccEEEEEccEEEEEEEEcccccEEEccccccEEEEEEccccHHHHHHHHcccccccccccccccccEEEEccEEEEcccccccccccccEEEEEEEEccccccHHHHHHHHHHcccccEEEEEEEEccccccccccccccccccccccccccEEEEEEEcEEccHHHHHHHHHHHHcccccccEEEEEccccccccHHHHcHHHHHHHHHHHHHHHHccccccccEEEcc
cccccccHccccHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccHcHHHHHHHHHHHHHHHHcccccEEEEEEEEcccccHHHHHHHHHHHHccccEEEEEEccccccccccccEEEccccccccccHcccEEEEEEEEEccHHHHHHHHHcccHHHEEEEEEcccEEEEEEEccccEEEEEEEEccccccEEEEEcccEEEEEEccccccEEEEcccccEEEEEEEEcccccHHHHHHHHHHHcccccHEEEEEEcccccccccccccccccccEEEEEEEEEEEccccHHHHHHHHHHHccccccEEEEEEccccccccccccccccccccccHHccccEEEEEEEcccccHHHHHHHHHHHHHHHHHHEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccEccc
mrsegdhinelpdDILVNILSRLTMKEAVRTSIISSRWRYLWrgfsgclnfddpftmanskwphlnlksgpinverhKFVNWVNQVLSSLEGHCTEELRICFDvfsnhdidNWIKFALERRVRRLELDFSRVVYNLRFvgqytfpshldfyssfrhltdlslttvGITGEVLEHLLCYCCPVLEVLNVaesssltslkvsgpslklkhlklnkldnlkdlqlhapnllsfeysgpilpfsfrnvpnlvdasfWGCFSAYIAKNLCQHSIFLVQLHTlkldtchlligdseyragrylhdipemcnlkhleiigtpkVNDLIFCIALLEAAPSLYKFSLKLVSQYdyesyesvktikdqpylsfteLRSIRVVELLGFVGHTADFELVMYLIFSAKLLEKiiidpcptwrvgtpaeLIWRETAEYQSARRRAFELAAkfplwefvip
mrsegdhinelpddiLVNILSRLTMKEAVRTSIISSRWRYLWRGFSGCLNFDDPFTMANSKWPHLNLKSGPINVERHKFVNWVNQVLSSLEGHCTEELRICFDVFSNHDIDNWIKFALERRVRRLELDFSRVVYNLRFVGQYTFPSHLDFYSSFRHLTDLSLTTVGITGEVLEHLLCYCCPVLEVLNVAESSSLTslkvsgpslklKHLKLNKLDNLKDLQLHAPNLLSFEYSGPILPFSFRNVPNLVDASFWGCFSAYIAKNLCQHSIFLVQLHTLKLDTCHLLIGDSEYRAGRYLHDIPEMCNLKHLEIIGTPKVNDLIFCIALLEAAPSLYKFSLKLVSQYDYESYEsvktikdqpylsFTELRSIRVVELLGFVGHTADFELVMYLIFSAKLLEKIIIDPCPTWRVGTPAELIWRETAEYQSARRRAFELaakfplwefvip
MRSEGDHINELPDDILVNILSRLTMKEAVRTSIISSRWRYLWRGFSGCLNFDDPFTMANSKWPHLNLKSGPINVERHKFVNWVNQVLSSLEGHCTEELRICFDVFSNHDIDNWIKFALERRVRRLELDFSRVVYNLRFVGQYTFPSHLDFYSSFRHLTDLSLTTVGITGEVLEHLLCYCCPVLEVLNVAESSSLTSLKVSGPSlklkhlklnkldnlkdlqlhAPNLLSFEYSGPILPFSFRNVPNLVDASFWGCFSAYIAKNLCQHSIFLVQLHTLKLDTCHLLIGDSEYRAGRYLHDIPEMCNLKHLEIIGTPKVNDLIFCIALLEAAPSLYKFSLKLVSQYDYESYESVKTIKDQPYLSFTELRSIRVVELLGFVGHTADFELVMYLIFSAKLLEKIIIDPCPTWRVGTPAELIWRETAEYQSARRRAFELAAKFPLWEFVIP
**********LPDDILVNILSRLTMKEAVRTSIISSRWRYLWRGFSGCLNFDDPFTMANSKWPHLNLKSGPINVERHKFVNWVNQVLSSLEGHCTEELRICFDVFSNHDIDNWIKFALERRVRRLELDFSRVVYNLRFVGQYTFPSHLDFYSSFRHLTDLSLTTVGITGEVLEHLLCYCCPVLEVLNVAESSSLTSLKVSGPSLKLKHLKLNKLDNLKDLQLHAPNLLSFEYSGPILPFSFRNVPNLVDASFWGCFSAYIAKNLCQHSIFLVQLHTLKLDTCHLLIGDSEYRAGRYLHDIPEMCNLKHLEIIGTPKVNDLIFCIALLEAAPSLYKFSLKLVSQYDYESYESVKTIKDQPYLSFTELRSIRVVELLGFVGHTADFELVMYLIFSAKLLEKIIIDPCPTWRVGTPAELIWRETAEYQSARRRAFELAAKFPLWEFVI*
*RSEGDHINELPDDILVNILSRLTMKEAVRTSIISSRWRYLWRGFSGCLNFDDPFTMANSKWPHLNLKSGPINVERHKFVNWVNQVLSSLEGHCTEELRICFDVFSNHDIDNWIKFALERRVRRLELDFSRVVYNLRFVGQYTFPSHLDFYSSFRHLTDLSLTTVGITGEVLEHLLCYCCPVLEVLNVAESSSLTSLKVSGPSLKLKHLKLNKLDNLKDLQLHAPNLLSFEYSGPILPFSFRNVPNLVDASFWGCFSAYIAKNLCQHSIFLVQLHTLKLDTCHLLIGDSEYRAGRYLHDIPEMCNLKHLEIIGTPKVNDLIFCIALLEAAPSLYKFSLKLVSQYDYESYESVKTIKDQPYLSFTELRSIRVVELLGFVGHTADFELVMYLIFSAKLLEKIIIDPCPTWRV*********************FELAAKFPLWEFVIP
********NELPDDILVNILSRLTMKEAVRTSIISSRWRYLWRGFSGCLNFDDPFTMANSKWPHLNLKSGPINVERHKFVNWVNQVLSSLEGHCTEELRICFDVFSNHDIDNWIKFALERRVRRLELDFSRVVYNLRFVGQYTFPSHLDFYSSFRHLTDLSLTTVGITGEVLEHLLCYCCPVLEVLNVAESSSLTSLKVSGPSLKLKHLKLNKLDNLKDLQLHAPNLLSFEYSGPILPFSFRNVPNLVDASFWGCFSAYIAKNLCQHSIFLVQLHTLKLDTCHLLIGDSEYRAGRYLHDIPEMCNLKHLEIIGTPKVNDLIFCIALLEAAPSLYKFSLKLVSQYDYESYESVKTIKDQPYLSFTELRSIRVVELLGFVGHTADFELVMYLIFSAKLLEKIIIDPCPTWRVGTPAELIWRETAEYQSARRRAFELAAKFPLWEFVIP
*****DHINELPDDILVNILSRLTMKEAVRTSIISSRWRYLWRGFSGCLNFDDPFTMANS******LKSGPINVERHKFVNWVNQVLSSLEGHCTEELRICFDVFSNHDIDNWIKFALERRVRRLELDFSRVVYNLRFVGQYTFPSHLDFYSSFRHLTDLSLTTVGITGEVLEHLLCYCCPVLEVLNVAESSSLTSLKVSGPSLKLKHLKLNKLDNLKDLQLHAPNLLSFEYSGPILPFSFRNVPNLVDASFWGCFSAYIAKNLCQHSIFLVQLHTLKLDTCHLLIGDSEYRAGRYLHDIPEMCNLKHLEIIGTPKVNDLIFCIALLEAAPSLYKFSLKLVSQYDYESYESVKTIKDQPYLSFTELRSIRVVELLGFVGHTADFELVMYLIFSAKLLEKIIIDPCPTWRVGTPAELIWRETAEYQSARRRAFELAAKFPLWEFVIP
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRSEGDHINELPDDILVNILSRLTMKEAVRTSIISSRWRYLWRGFSGCLNFDDPFTMANSKWPHLNLKSGPINVERHKFVNWVNQVLSSLEGHCTEELRICFDVFSNHDIDNWIKFALERRVRRLELDFSRVVYNLRFVGQYTFPSHLDFYSSFRHLTDLSLTTVGITGEVLEHLLCYCCPVLEVLNVAESSSLTSLKVSGPSLKLKHLKLNKLDNLKDLQLHAPNLLSFEYSGPILPFSFRNVPNLVDASFWGCFSAYIAKNLCQHSIFLVQLHTLKLDTCHLLIGDSEYRAGRYLHDIPEMCNLKHLEIIGTPKVNDLIFCIALLEAAPSLYKFSLKLVSQYDYESYESVKTIKDQPYLSFTELRSIRVVELLGFVGHTADFELVMYLIFSAKLLEKIIIDPCPTWRVGTPAELIWRETAEYQSARRRAFELAAKFPLWEFVIP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query446 2.2.26 [Sep-21-2011]
Q9LV26456 Putative F-box/LRR-repeat no no 0.558 0.546 0.269 4e-12
Q9LZ15456 Putative F-box/LRR-repeat yes no 0.484 0.473 0.273 2e-11
Q9LSJ3465 Putative F-box/LRR-repeat no no 0.484 0.464 0.269 3e-11
Q9FGQ3444 F-box/FBD/LRR-repeat prot no no 0.804 0.808 0.224 7e-11
Q9FZ70416 F-box/FBD/LRR-repeat prot no no 0.464 0.497 0.255 7e-11
Q9LXR4454 Putative F-box/LRR-repeat no no 0.495 0.486 0.3 8e-11
Q0WR05457 F-box/LRR-repeat protein no no 0.484 0.472 0.280 2e-10
Q84W80481 F-box/LRR-repeat protein no no 0.396 0.367 0.282 4e-10
Q9FM89422 F-box/FBD/LRR-repeat prot no no 0.809 0.855 0.243 2e-09
Q9LJ48463 Putative F-box protein At no no 0.517 0.498 0.283 4e-09
>sp|Q9LV26|FBL45_ARATH Putative F-box/LRR-repeat protein At3g18150 OS=Arabidopsis thaliana GN=At3g18150 PE=4 SV=2 Back     alignment and function desciption
 Score = 73.2 bits (178), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 81/301 (26%), Positives = 132/301 (43%), Gaps = 52/301 (17%)

Query: 1   MRSEGDHINELPDDILVNILSRLTMKEAVRTSIISSRWRYLWRGFSGCLNFDDPFTMANS 60
           ++   D I+ LPD IL +ILS +  K A+ TS++S RWR++W   +  L+F+D    A  
Sbjct: 26  IKEAVDSISSLPDVILQHILSFIPTKLAITTSLLSKRWRHVWCD-TPSLSFNDYRLEAPF 84

Query: 61  KWPHLNLKSGPINVERHKFVNWVNQVLSSLEGHCTEELRICFDVFSNHDIDNWIKFALER 120
               L   +    +  H   + +N V                       +++WIKFA+ R
Sbjct: 85  IDETLTRYTASKMMRFHLHTSLINNV---------------------PHLESWIKFAMSR 123

Query: 121 RVRRLELDFSRVVYNLRFVGQYTFPSHLDFYSSFRHLT---------------DLSLTTV 165
            V  L LD    V N     ++ FP      SS + LT                L L+T 
Sbjct: 124 NVDHLSLDLWNQVAN-----KFKFPDFFHINSSLKQLTVVLDFSDTMIAICLKKLYLSTC 178

Query: 166 GITGEVLEHLLCYCCPVLEVLNVAESSSLTSLKVSGPSLKLKHLKLNK---LDNLKDLQL 222
            ++ E + ++L + CP+LE L +     L  L +S  SL+L+ L++N    +  L  +Q+
Sbjct: 179 LLSDESMANIL-FGCPILESLTLDHCGGLRVLDLSK-SLRLRTLEINCNIWVPELTAMQI 236

Query: 223 HAPNLLSFEYSGPILPFSFRNVPNLVDASFWGC---FSAYIAKNLCQHSIF--LVQLHTL 277
            AP+          LP S  +V +L +A    C   FS  I  +  Q ++   L +LH +
Sbjct: 237 VAPHTHCLRLRNSKLPCSLVDVSSLKEAKLNICIDSFSKTIKADFLQVTLLKMLEKLHNV 296

Query: 278 K 278
           +
Sbjct: 297 E 297





Arabidopsis thaliana (taxid: 3702)
>sp|Q9LZ15|FBL78_ARATH Putative F-box/LRR-repeat protein At5g02700 OS=Arabidopsis thaliana GN=At5g02700 PE=4 SV=1 Back     alignment and function description
>sp|Q9LSJ3|FBL48_ARATH Putative F-box/LRR-repeat protein At3g28410 OS=Arabidopsis thaliana GN=At3g28410 PE=4 SV=2 Back     alignment and function description
>sp|Q9FGQ3|FDL37_ARATH F-box/FBD/LRR-repeat protein At5g53840 OS=Arabidopsis thaliana GN=At5g53840 PE=2 SV=1 Back     alignment and function description
>sp|Q9FZ70|FDL1_ARATH F-box/FBD/LRR-repeat protein At1g13570 OS=Arabidopsis thaliana GN=At1g13570 PE=2 SV=1 Back     alignment and function description
>sp|Q9LXR4|FBL56_ARATH Putative F-box/LRR-repeat protein At3g58880 OS=Arabidopsis thaliana GN=At3g58880 PE=4 SV=1 Back     alignment and function description
>sp|Q0WR05|FBL39_ARATH F-box/LRR-repeat protein At2g42730 OS=Arabidopsis thaliana GN=At2g42730 PE=2 SV=1 Back     alignment and function description
>sp|Q84W80|FBL42_ARATH F-box/LRR-repeat protein At3g03360 OS=Arabidopsis thaliana GN=At3g03360 PE=2 SV=2 Back     alignment and function description
>sp|Q9FM89|FDL38_ARATH F-box/FBD/LRR-repeat protein At5g56420 OS=Arabidopsis thaliana GN=At5g56420 PE=2 SV=1 Back     alignment and function description
>sp|Q9LJ48|FB191_ARATH Putative F-box protein At3g29830 OS=Arabidopsis thaliana GN=At3g29830 PE=4 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query446
255544812464 ubiquitin-protein ligase, putative [Rici 0.939 0.903 0.441 3e-95
357477131447 F-box family-6 [Medicago truncatula] gi| 0.914 0.912 0.337 7e-56
449440973475 PREDICTED: putative FBD-associated F-box 0.919 0.863 0.361 2e-51
356544606444 PREDICTED: putative F-box protein At3g58 0.883 0.887 0.324 1e-46
255540581457 ubiquitin-protein ligase, putative [Rici 0.917 0.894 0.303 3e-39
302142991402 unnamed protein product [Vitis vinifera] 0.748 0.830 0.339 7e-37
357162424482 PREDICTED: putative FBD-associated F-box 0.860 0.796 0.278 3e-27
297736820487 unnamed protein product [Vitis vinifera] 0.899 0.823 0.288 6e-26
147865783 1789 hypothetical protein VITISV_020815 [Viti 0.908 0.226 0.287 4e-25
357119372497 PREDICTED: uncharacterized protein LOC10 0.910 0.816 0.260 2e-23
>gi|255544812|ref|XP_002513467.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223547375|gb|EEF48870.1| ubiquitin-protein ligase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  355 bits (911), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 194/439 (44%), Positives = 289/439 (65%), Gaps = 20/439 (4%)

Query: 6   DHINELPDDILVNILSRLTMKEAVRTSIISSRWRYLWRGFSGCLNFDDPFTMANSKWPHL 65
           +HI++LP+D+L+NILSRLTMKEA RTSI+S+RWR+LW  ++G ++FD   TM    +  L
Sbjct: 33  EHISQLPEDVLLNILSRLTMKEAARTSILSTRWRHLWTYYTGIMDFDASLTMW---YLQL 89

Query: 66  NLKSGPINVERHKFVNWVNQVLSSLEGHCTEELRICFDVFSN--HDIDNWIKFALERRVR 123
            L S  +++ERH FV+WVNQVL S EG   E LRICFD+ S+  ++ID+WI  A+++RV+
Sbjct: 90  GLGSKSLDMERHSFVSWVNQVLRSHEGPTMEGLRICFDLDSDFMYEIDSWITIAMQKRVK 149

Query: 124 RLELDFSRVVYNLRFVGQYTFPSHLDFYSSFRHLTDLSLTTVGITGEVLEHLLCYCCPVL 183
           RLE+D + +  +++  G Y FPS L   SSF  L  L L  V +TGE L+HLL   CP+L
Sbjct: 150 RLEIDLTNIEPSIKTTGSYAFPSGLLNDSSFSSLKTLQLNMVDVTGEALQHLLLSWCPLL 209

Query: 184 EVLNVAESSSLTSLKVSGPSLKLKHLKLNKLDNLKDLQLHAPNLLSFEYSGPILPFSFRN 243
           EVL++  S+SL SLKVSG SLKLK+L++   +NLK L++ A +L+SF+Y GP++   F++
Sbjct: 210 EVLSIVNSTSLVSLKVSGSSLKLKYLEMVCCNNLKYLEITAASLVSFKYYGPLIGLPFKS 269

Query: 244 VPNLVDASFWGCFSAYIAKNLCQHSIFLVQLHTLKLDTCHLLIGDSEYRAGRYLHDIPEM 303
           VPNLVDASF G F     +NL Q S++++QL TL+ D        S Y    +  + P +
Sbjct: 270 VPNLVDASFGGPFCQLTIENLYQFSLYILQLETLRFDV------GSAYLMREFPTNFPIL 323

Query: 304 CNLKHLEI-IGTPKVNDLIF-CIALLEAAPSLYKFSLKLVS-QYDYESYESVKTIKDQPY 360
            N+KHLE+      V   +F C++LL+  P L++F+LK++S +       S K  +D  +
Sbjct: 324 SNVKHLEVTTAVSAVAHCLFPCLSLLKGCPLLHRFTLKVISCESTLVCRASQKVPEDHSH 383

Query: 361 LSFTELRSIRVVELLGFVGHTADFELVMYLIFSAKLLEKIIIDPCPTWRVGTPAELIWRE 420
                   ++VVE+LGF G+ A+ ELV+Y + +A +L+ +II PC    + +P++L ++E
Sbjct: 384 ------PCLKVVEVLGFQGNAAEVELVLYFLRNAAVLKNLIISPCAPCYLRSPSQLKFKE 437

Query: 421 TAEYQSARRRAFELAAKFP 439
           T  YQSA++ A EL A+ P
Sbjct: 438 TELYQSAKQHAVELGARVP 456




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|357477131|ref|XP_003608851.1| F-box family-6 [Medicago truncatula] gi|355509906|gb|AES91048.1| F-box family-6 [Medicago truncatula] Back     alignment and taxonomy information
>gi|449440973|ref|XP_004138258.1| PREDICTED: putative FBD-associated F-box protein At5g56700-like [Cucumis sativus] gi|449501454|ref|XP_004161371.1| PREDICTED: putative FBD-associated F-box protein At5g56700-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356544606|ref|XP_003540740.1| PREDICTED: putative F-box protein At3g58860-like [Glycine max] Back     alignment and taxonomy information
>gi|255540581|ref|XP_002511355.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223550470|gb|EEF51957.1| ubiquitin-protein ligase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|302142991|emb|CBI20286.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|357162424|ref|XP_003579406.1| PREDICTED: putative FBD-associated F-box protein At1g61330-like [Brachypodium distachyon] Back     alignment and taxonomy information
>gi|297736820|emb|CBI26021.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147865783|emb|CAN81149.1| hypothetical protein VITISV_020815 [Vitis vinifera] Back     alignment and taxonomy information
>gi|357119372|ref|XP_003561416.1| PREDICTED: uncharacterized protein LOC100838353 [Brachypodium distachyon] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query446
TAIR|locus:2010032416 AT1G13570 "AT1G13570" [Arabido 0.423 0.454 0.293 1.2e-11
TAIR|locus:2157922444 AT5G53840 "AT5G53840" [Arabido 0.408 0.409 0.279 8.8e-11
TAIR|locus:2010708479 AT1G56400 "AT1G56400" [Arabido 0.260 0.242 0.322 8.5e-10
TAIR|locus:2162454437 AT5G22700 "AT5G22700" [Arabido 0.401 0.409 0.288 1.9e-09
TAIR|locus:2175861388 AT5G60610 "AT5G60610" [Arabido 0.820 0.943 0.257 4e-09
TAIR|locus:2099054454 AT3G58880 "AT3G58880" [Arabido 0.517 0.508 0.301 4.3e-09
TAIR|locus:2129266434 AT4G13960 "AT4G13960" [Arabido 0.255 0.262 0.362 4.3e-09
TAIR|locus:2151316456 AT5G02700 "AT5G02700" [Arabido 0.082 0.081 0.540 2.1e-08
TAIR|locus:2116362453 AT4G27050 "AT4G27050" [Arabido 0.302 0.298 0.344 2.5e-08
TAIR|locus:2099644481 AT3G03360 [Arabidopsis thalian 0.405 0.376 0.3 3.8e-08
TAIR|locus:2010032 AT1G13570 "AT1G13570" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 173 (66.0 bits), Expect = 1.2e-11, Sum P(2) = 1.2e-11
 Identities = 63/215 (29%), Positives = 102/215 (47%)

Query:     1 MRSEGDHINELPDDILVNILSRLTMKEAVRTSIISSRWRYLWRGFSGCLNFDDPFTMANS 60
             M    D I++LP  I+ NIL+RL++++A+RTS++SS+WRY W   +  L FD+       
Sbjct:     1 MGESPDFISDLPQSIIENILTRLSIRDAIRTSVLSSKWRYKWSTLTD-LVFDEKCVS--- 56

Query:    61 KWPHLNLKSGPINVERHKFVNWVNQVLSSLEGHCTE-ELRICFDVFSNHDIDNWIKFALE 119
               P     S    V     V ++  VL   +G   + +L   F      DID W+ F   
Sbjct:    57 --P-----SNDRCVVETNLVRFITGVLLLHQGPIHKFQLSTSFKQ-CRPDIDQWLLFLSR 108

Query:   120 RRVRRLELDFS----RV---VYN-LRFVGQYTFPSHLD---FYSSFRHLTDLSLTTVGIT 168
               ++ L L       RV   ++N L+           D   ++  F +L  L+L  + + 
Sbjct:   109 NGIKELVLKLGEGEFRVPACLFNCLKLTCLELCHCEFDPPQYFKGFSYLKSLNLHQILVA 168

Query:   169 GEVLEHLLCYCCPVLEVLNVAESSSLTSLKVSGPS 203
              EV+E L+  C P+LE L+++   SL  L +S P+
Sbjct:   169 PEVIESLISGC-PLLEFLSLSYFDSLV-LSISAPN 201


GO:0003674 "molecular_function" evidence=ND
GO:0005634 "nucleus" evidence=ISM
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2157922 AT5G53840 "AT5G53840" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2010708 AT1G56400 "AT1G56400" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2162454 AT5G22700 "AT5G22700" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2175861 AT5G60610 "AT5G60610" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2099054 AT3G58880 "AT3G58880" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2129266 AT4G13960 "AT4G13960" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2151316 AT5G02700 "AT5G02700" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2116362 AT4G27050 "AT4G27050" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2099644 AT3G03360 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
BRADI5G24490.1
annotation not avaliable (482 aa)
(Brachypodium distachyon)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query446
pfam0064648 pfam00646, F-box, F-box domain 5e-05
smart0025641 smart00256, FBOX, A Receptor for Ubiquitination Ta 3e-04
pfam1293747 pfam12937, F-box-like, F-box-like 8e-04
>gnl|CDD|201368 pfam00646, F-box, F-box domain Back     alignment and domain information
 Score = 40.3 bits (95), Expect = 5e-05
 Identities = 18/38 (47%), Positives = 26/38 (68%)

Query: 6  DHINELPDDILVNILSRLTMKEAVRTSIISSRWRYLWR 43
            + +LPDD+L+ ILSRL  K+ +R S++S RWR L  
Sbjct: 1  FSLLDLPDDLLLEILSRLDPKDLLRLSLVSKRWRSLVD 38


This domain is approximately 50 amino acids long, and is usually found in the N-terminal half of a variety of proteins. Two motifs that are commonly found associated with the F-box domain are the leucine rich repeats (LRRs; pfam00560 and pfam07723) and the WD repeat (pfam00400). The F-box domain has a role in mediating protein-protein interactions in a variety of contexts, such as polyubiquitination, transcription elongation, centromere binding and translational repression. Length = 48

>gnl|CDD|197608 smart00256, FBOX, A Receptor for Ubiquitination Targets Back     alignment and domain information
>gnl|CDD|221867 pfam12937, F-box-like, F-box-like Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 446
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 99.59
KOG4341483 consensus F-box protein containing LRR [General fu 99.51
PF0838751 FBD: FBD; InterPro: IPR013596 This region is found 99.06
smart0057972 FBD domain in FBox and BRCT domain containing plan 98.81
PF1293747 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 98.7
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 98.44
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.39
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.35
PLN03210 1153 Resistant to P. syringae 6; Provisional 98.3
PF0064648 F-box: F-box domain; InterPro: IPR001810 The F-box 98.28
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 98.24
KOG4341483 consensus F-box protein containing LRR [General fu 98.22
smart0025641 FBOX A Receptor for Ubiquitination Targets. 98.13
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.07
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.05
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 97.97
PLN03210 1153 Resistant to P. syringae 6; Provisional 97.84
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 97.56
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 97.34
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 97.33
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 97.31
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.29
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.24
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 97.03
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 96.82
KOG2982418 consensus Uncharacterized conserved protein [Funct 96.8
PF0772326 LRR_2: Leucine Rich Repeat; InterPro: IPR013101 Le 96.72
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 96.61
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 96.57
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 96.55
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 96.49
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 96.45
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 96.39
PRK15386426 type III secretion protein GogB; Provisional 95.12
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 94.78
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 94.64
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 94.53
KOG1259490 consensus Nischarin, modulator of integrin alpha5 94.42
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 94.0
PRK15386 426 type III secretion protein GogB; Provisional 93.63
KOG2982418 consensus Uncharacterized conserved protein [Funct 92.82
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 92.49
KOG3864221 consensus Uncharacterized conserved protein [Funct 92.36
KOG2997366 consensus F-box protein FBX9 [General function pre 92.35
PLN03215373 ascorbic acid mannose pathway regulator 1; Provisi 92.23
KOG0281499 consensus Beta-TrCP (transducin repeats containing 92.21
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 91.85
KOG0617264 consensus Ras suppressor protein (contains leucine 91.07
KOG2123 388 consensus Uncharacterized conserved protein [Funct 90.56
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 90.18
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 89.74
KOG3864221 consensus Uncharacterized conserved protein [Funct 88.69
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 87.56
KOG2123388 consensus Uncharacterized conserved protein [Funct 87.5
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 86.62
KOG4237498 consensus Extracellular matrix protein slit, conta 86.24
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 86.05
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 85.96
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 85.91
KOG0617264 consensus Ras suppressor protein (contains leucine 85.61
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 83.46
PF13013109 F-box-like_2: F-box-like domain 81.6
KOG1259490 consensus Nischarin, modulator of integrin alpha5 81.57
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 81.55
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 81.3
KOG0472565 consensus Leucine-rich repeat protein [Function un 80.36
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
Probab=99.59  E-value=2.2e-16  Score=141.25  Aligned_cols=275  Identities=21%  Similarity=0.245  Sum_probs=175.6

Q ss_pred             CCCCChHHHHHHHhCCChhHHHHHhhccchhhhh------cccccceEEecCCCCCCCCCCccccCCCCCchhhHhHHHH
Q 013265            8 INELPDDILVNILSRLTMKEAVRTSIISSRWRYL------WRGFSGCLNFDDPFTMANSKWPHLNLKSGPINVERHKFVN   81 (446)
Q Consensus         8 is~LPd~iL~~ILs~Lp~kd~~rts~lSkrWr~l------w~~~~~~L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   81 (446)
                      +..|||||+..||+.|+.||..+.+.|||||.++      |.    .+++....+.+                  ....+
T Consensus        98 ~~slpDEill~IFs~L~kk~LL~~~~VC~Rfyr~~~de~lW~----~lDl~~r~i~p------------------~~l~~  155 (419)
T KOG2120|consen   98 WDSLPDEILLGIFSCLCKKELLKVSGVCKRFYRLASDESLWQ----TLDLTGRNIHP------------------DVLGR  155 (419)
T ss_pred             cccCCHHHHHHHHHhccHHHHHHHHHHHHHHhhcccccccee----eeccCCCccCh------------------hHHHH
Confidence            6789999999999999999999999999999865      65    56665554432                  22222


Q ss_pred             HHHHHHHhccCCCcceEEEEEecCCcchHHHHHHH--HHHcCCcEEEEeeeccccccccccccccccccCC-cccccccc
Q 013265           82 WVNQVLSSLEGHCTEELRICFDVFSNHDIDNWIKF--ALERRVRRLELDFSRVVYNLRFVGQYTFPSHLDF-YSSFRHLT  158 (446)
Q Consensus        82 ~v~~~L~~~~~~~l~~l~l~~~~~~~~~~~~wi~~--~~~~~l~~L~l~~~~~~~~~~~~~~~~lp~~~~~-~~~~~~L~  158 (446)
                      .+     + +|  |.-|++.-.....   .+....  .++..++.+++.....          ... .+.. ...|..||
T Consensus       156 l~-----~-rg--V~v~Rlar~~~~~---prlae~~~~frsRlq~lDLS~s~i----------t~s-tl~~iLs~C~kLk  213 (419)
T KOG2120|consen  156 LL-----S-RG--VIVFRLARSFMDQ---PRLAEHFSPFRSRLQHLDLSNSVI----------TVS-TLHGILSQCSKLK  213 (419)
T ss_pred             HH-----h-CC--eEEEEcchhhhcC---chhhhhhhhhhhhhHHhhcchhhe----------eHH-HHHHHHHHHHhhh
Confidence            22     1 23  4445443111111   112222  2333577777644321          000 0000 23578999


Q ss_pred             ceEEEEEEeChHHHHHHHhcCCCCcceeeEeccCCCCcee---EeCCcCccceEEeeccCCCCeEEE-----ECCceeEE
Q 013265          159 DLSLTTVGITGEVLEHLLCYCCPVLEVLNVAESSSLTSLK---VSGPSLKLKHLKLNKLDNLKDLQL-----HAPNLLSF  230 (446)
Q Consensus       159 ~L~L~~~~~~~~~l~~ll~~~cp~Le~L~L~~c~~~~~~~---i~~~~~~L~~L~i~~~~~l~~~~i-----~~p~L~~l  230 (446)
                      .|.|.+..++|. +..-++. -.+|++|+|..|.|++...   +..+|++|.+|.++.|......+.     ..++|+.|
T Consensus       214 ~lSlEg~~LdD~-I~~~iAk-N~~L~~lnlsm~sG~t~n~~~ll~~scs~L~~LNlsWc~l~~~~Vtv~V~hise~l~~L  291 (419)
T KOG2120|consen  214 NLSLEGLRLDDP-IVNTIAK-NSNLVRLNLSMCSGFTENALQLLLSSCSRLDELNLSWCFLFTEKVTVAVAHISETLTQL  291 (419)
T ss_pred             hccccccccCcH-HHHHHhc-cccceeeccccccccchhHHHHHHHhhhhHhhcCchHhhccchhhhHHHhhhchhhhhh
Confidence            999999998876 3344667 7899999999999987653   334668999999999985544321     24889999


Q ss_pred             EEcccccc-------cccCCCCCcceEEecccchhhhhhhhhhhhccCCCceEEEEeecccccccchhcccccccCCCCC
Q 013265          231 EYSGPILP-------FSFRNVPNLVDASFWGCFSAYIAKNLCQHSIFLVQLHTLKLDTCHLLIGDSEYRAGRYLHDIPEM  303 (446)
Q Consensus       231 ~~~~~~~~-------~~~~~~~~L~~l~l~~~~~~~~~~~l~~~l~~l~~l~~L~L~~~~~~~~~~~~~~~~~~~~~~~~  303 (446)
                      ++.|+.-.       .-...+|+|.+++++++ .... .+....+..++.|++|.++.|+.....      . .-.+...
T Consensus       292 NlsG~rrnl~~sh~~tL~~rcp~l~~LDLSD~-v~l~-~~~~~~~~kf~~L~~lSlsRCY~i~p~------~-~~~l~s~  362 (419)
T KOG2120|consen  292 NLSGYRRNLQKSHLSTLVRRCPNLVHLDLSDS-VMLK-NDCFQEFFKFNYLQHLSLSRCYDIIPE------T-LLELNSK  362 (419)
T ss_pred             hhhhhHhhhhhhHHHHHHHhCCceeeeccccc-cccC-chHHHHHHhcchheeeehhhhcCCChH------H-eeeeccC
Confidence            99888422       22346888888888776 2221 134466677888999998887543321      1 1124456


Q ss_pred             CcccEEEEEecCCCCCHHHHHHHHhhCCCceEEEEEE
Q 013265          304 CNLKHLEIIGTPKVNDLIFCIALLEAAPSLYKFSLKL  340 (446)
Q Consensus       304 ~~L~~L~L~~~~~~~~~~~l~~ll~~~p~L~~L~l~~  340 (446)
                      |.|++|++.++..+.   .+.-+.+.||+|+.-.-++
T Consensus       363 psl~yLdv~g~vsdt---~mel~~e~~~~lkin~q~~  396 (419)
T KOG2120|consen  363 PSLVYLDVFGCVSDT---TMELLKEMLSHLKINCQHF  396 (419)
T ss_pred             cceEEEEeccccCch---HHHHHHHhCccccccceee
Confidence            788899888886443   3455677888887665544



>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF08387 FBD: FBD; InterPro: IPR013596 This region is found in F-box (IPR001810 from INTERPRO) and other domain containing plant proteins; it is repeated in two family members Back     alignment and domain information
>smart00579 FBD domain in FBox and BRCT domain containing plant proteins Back     alignment and domain information
>PF12937 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 2OVQ_B 1FS1_A 1FS2_C 1FQV_I 1LDK_E 2AST_B 2ASS_B Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PF00646 F-box: F-box domain; InterPro: IPR001810 The F-box domain was first described as a sequence motif found in cyclin-F that interacts with the protein SKP1 [, ] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>smart00256 FBOX A Receptor for Ubiquitination Targets Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF07723 LRR_2: Leucine Rich Repeat; InterPro: IPR013101 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2997 consensus F-box protein FBX9 [General function prediction only] Back     alignment and domain information
>PLN03215 ascorbic acid mannose pathway regulator 1; Provisional Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PF13013 F-box-like_2: F-box-like domain Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query446
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 3e-09
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 3e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-07
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 3e-06
1fs1_A53 SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L 1e-05
2e31_A297 FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui 3e-04
3l2o_B312 F-box only protein 4; small G protein fold, UBL co 5e-04
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
 Score = 57.2 bits (138), Expect = 3e-09
 Identities = 67/343 (19%), Positives = 113/343 (32%), Gaps = 58/343 (16%)

Query: 2   RSEGDHINELPDDILVNILSRLTMKEAVRTSIISSRWRYLWRGFSGCLNFDDPFTMANSK 61
              G   + LPD++L+ I S L + E ++ S +  RW  L    S     D      +  
Sbjct: 3   NFPGVSWDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESLWQTLDLTGKNLHPD 62

Query: 62  WPHLNLKSGPINVERHKFVNWVNQVLSSLEGHCTEELRICFDVFSNHDIDNWIKFALERR 121
                L  G I     +        +           R+     SN  I+      +  +
Sbjct: 63  VTGRLLSQGVIAFRCPRS------FMDQPLAEHFSPFRVQHMDLSNSVIEVSTLHGILSQ 116

Query: 122 VRRLELDFSRVVYNLRFVGQYTFPSHLDFYSSFRHLTDLSLTTV-GITGEVLEHLLCYCC 180
             +L+        NL   G       ++  +   +L  L+L+   G +   L+ LL   C
Sbjct: 117 CSKLQ--------NLSLEGLRLSDPIVNTLAKNSNLVRLNLSGCSGFSEFALQTLLS-SC 167

Query: 181 PVLEVLNVAESSSLTS----LKVSGPSLKLKHLKLNKL------DNLKDLQLHAPNLLSF 230
             L+ LN++     T     + V+  S  +  L L+         +L  L    PNL+  
Sbjct: 168 SRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVH- 226

Query: 231 EYSGPILPFSFRNVPNLVDASFWGCFSAYIAKNLCQHSIFLVQLHTLKLDTCHLLIGDSE 290
                       +   L +  F         +        L  L  L L  C+ +I ++ 
Sbjct: 227 --------LDLSDSVMLKNDCF-----QEFFQ--------LNYLQHLSLSRCYDIIPET- 264

Query: 291 YRAGRYLHDIPEMCNLKHLEIIGTPKVNDLIFCIALLEAAPSL 333
                 L ++ E+  LK L++ G      L     L EA P L
Sbjct: 265 ------LLELGEIPTLKTLQVFGIVPDGTL---QLLKEALPHL 298


>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E Length = 53 Back     alignment and structure
>2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A Length = 297 Back     alignment and structure
>3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} Length = 312 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query446
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.84
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 99.82
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.78
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.05
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 98.99
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 98.97
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 98.77
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 98.76
1fs1_A53 SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L 98.74
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 98.74
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 98.73
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 98.67
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 98.66
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 98.64
4fmz_A347 Internalin; leucine rich repeat, structural genomi 98.62
4fmz_A347 Internalin; leucine rich repeat, structural genomi 98.62
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 98.58
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 98.55
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 98.52
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 98.51
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 98.51
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 98.51
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 98.5
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 98.49
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 98.49
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 98.48
1o6v_A 466 Internalin A; bacterial infection, extracellular r 98.47
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 98.47
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 98.46
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 98.45
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 98.44
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 98.4
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 98.4
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 98.39
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 98.39
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 98.39
1o6v_A466 Internalin A; bacterial infection, extracellular r 98.39
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 98.39
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 98.38
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 98.38
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 98.38
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 98.38
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 98.36
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 98.36
4ezg_A197 Putative uncharacterized protein; internalin-A, le 98.36
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 98.35
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 98.35
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 98.34
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 98.33
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 98.33
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 98.31
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 98.28
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 98.27
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 98.25
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 98.25
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 98.25
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 98.24
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 98.23
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 98.22
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 98.22
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 98.22
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 98.21
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 98.2
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 98.2
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 98.2
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 98.19
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 98.18
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 98.18
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 98.15
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.15
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 98.15
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 98.13
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 98.13
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 98.11
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 98.1
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 98.1
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 98.1
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 98.09
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 98.08
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 98.08
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 98.05
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 98.04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 98.03
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 98.02
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 98.01
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 98.0
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 97.99
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 97.93
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 97.92
2e31_A297 FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui 97.92
3m19_A251 Variable lymphocyte receptor A diversity region; a 97.92
3m19_A251 Variable lymphocyte receptor A diversity region; a 97.91
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 97.91
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 97.89
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 97.88
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 97.87
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 97.87
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 97.86
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 97.85
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 97.84
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 97.83
4ezg_A197 Putative uncharacterized protein; internalin-A, le 97.8
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 97.78
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.78
3l2o_B312 F-box only protein 4; small G protein fold, UBL co 97.76
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.71
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 97.68
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 97.68
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 97.65
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 97.57
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 97.5
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 97.47
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 97.45
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 97.43
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 97.42
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 97.42
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 97.41
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 97.39
3e6j_A229 Variable lymphocyte receptor diversity region; var 97.39
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 97.38
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 97.37
3e6j_A229 Variable lymphocyte receptor diversity region; var 97.24
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 97.24
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 97.24
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 97.19
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.15
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 97.14
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 97.14
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 97.05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 96.98
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 96.95
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 96.88
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 96.79
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 96.77
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 96.74
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 96.67
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 96.6
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 96.59
1w8a_A192 SLIT protein; signaling protein, secreted protein, 96.56
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 96.54
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 96.41
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 96.33
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 96.23
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 96.19
1w8a_A192 SLIT protein; signaling protein, secreted protein, 96.04
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 96.04
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 95.98
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 95.57
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 95.5
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 95.2
4fdw_A401 Leucine rich hypothetical protein; putative cell s 95.09
4fdw_A401 Leucine rich hypothetical protein; putative cell s 94.95
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 94.75
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 94.59
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 92.63
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 91.74
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 89.8
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 89.64
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 88.39
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 82.77
4gt6_A394 Cell surface protein; leucine rich repeats, putati 81.04
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
Probab=99.84  E-value=1.9e-21  Score=201.45  Aligned_cols=212  Identities=17%  Similarity=0.240  Sum_probs=129.1

Q ss_pred             cCCcCCCCChHHHHHHHhCCC-hhHHHHHhhccchhhhhcccccceEEecCCCCCCCCCCccccCCCCCchhhHhHHHHH
Q 013265            4 EGDHINELPDDILVNILSRLT-MKEAVRTSIISSRWRYLWRGFSGCLNFDDPFTMANSKWPHLNLKSGPINVERHKFVNW   82 (446)
Q Consensus         4 ~~D~is~LPd~iL~~ILs~Lp-~kd~~rts~lSkrWr~lw~~~~~~L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   82 (446)
                      ..|+++.||||||.+||++|| .+|+++++.|||||+++.......+++.......                 ..     
T Consensus         2 ~~d~~~~LPdevL~~If~~L~~~~d~~~~s~vck~W~~~~~~~~~~l~~~~~~~~~-----------------~~-----   59 (594)
T 2p1m_B            2 QKRIALSFPEEVLEHVFSFIQLDKDRNSVSLVCKSWYEIERWCRRKVFIGNCYAVS-----------------PA-----   59 (594)
T ss_dssp             --------CHHHHHHHHHTCCCHHHHHHHHTSCHHHHHHHHHHCCEEEESSTTSSC-----------------HH-----
T ss_pred             cccchhhCCHHHHHHHHhhcCCchhHHHHHHHHHHHHHhhhhhceEEeeccccccC-----------------HH-----
Confidence            359999999999999999999 9999999999999998732123355554321110                 11     


Q ss_pred             HHHHHHhccCCCcceEEEEEecCC----------cchHHHHHHHHHH--cCCcEEEEeeeccccccccccccccccccCC
Q 013265           83 VNQVLSSLEGHCTEELRICFDVFS----------NHDIDNWIKFALE--RRVRRLELDFSRVVYNLRFVGQYTFPSHLDF  150 (446)
Q Consensus        83 v~~~L~~~~~~~l~~l~l~~~~~~----------~~~~~~wi~~~~~--~~l~~L~l~~~~~~~~~~~~~~~~lp~~~~~  150 (446)
                        ..+.+.  +.++++.+......          ...+..|+.....  +++++|.+.......        ..+..+  
T Consensus        60 --~~~~~~--~~L~~L~L~~~~~~~~~~l~~~~~~~~~~~~l~~l~~~~~~L~~L~L~~~~~~~--------~~~~~l--  125 (594)
T 2p1m_B           60 --TVIRRF--PKVRSVELKGKPHFADFNLVPDGWGGYVYPWIEAMSSSYTWLEEIRLKRMVVTD--------DCLELI--  125 (594)
T ss_dssp             --HHHHHC--TTCCEEEEECSCGGGGGTCSCTTSCCBCHHHHHHHHHHCTTCCEEEEESCBCCH--------HHHHHH--
T ss_pred             --HHHhhC--CCceEEeccCCCchhhcccccccccchhhHHHHHHHHhCCCCCeEEeeCcEEcH--------HHHHHH--
Confidence              122222  34888888763211          0245678887654  389999886432110        001011  


Q ss_pred             ccccccccceEEEEE-EeChHHHHHHHhcCCCCcceeeEeccCCC----Cce-eEeCCcCccceEEeeccC-CC-----C
Q 013265          151 YSSFRHLTDLSLTTV-GITGEVLEHLLCYCCPVLEVLNVAESSSL----TSL-KVSGPSLKLKHLKLNKLD-NL-----K  218 (446)
Q Consensus       151 ~~~~~~L~~L~L~~~-~~~~~~l~~ll~~~cp~Le~L~L~~c~~~----~~~-~i~~~~~~L~~L~i~~~~-~l-----~  218 (446)
                      ..++++|++|+|.++ .+++..+..+..+ ||+|++|++.+|...    ..+ .+...+++|++|.+.+|. .+     .
T Consensus       126 ~~~~~~L~~L~L~~~~~~~~~~l~~~~~~-~~~L~~L~L~~~~i~~~~~~~l~~~~~~~~~L~~L~l~~~~~~~~~~~l~  204 (594)
T 2p1m_B          126 AKSFKNFKVLVLSSCEGFSTDGLAAIAAT-CRNLKELDLRESDVDDVSGHWLSHFPDTYTSLVSLNISCLASEVSFSALE  204 (594)
T ss_dssp             HHHCTTCCEEEEESCEEEEHHHHHHHHHH-CTTCCEEECTTCEEECCCGGGGGGSCTTCCCCCEEECTTCCSCCCHHHHH
T ss_pred             HHhCCCCcEEeCCCcCCCCHHHHHHHHHh-CCCCCEEeCcCCccCCcchHHHHHHhhcCCcCcEEEecccCCcCCHHHHH
Confidence            125789999999998 5787788888899 999999999988611    111 233355789999998875 11     1


Q ss_pred             eEEEECCceeEEEEcccc----cccccCCCCCcceEEe
Q 013265          219 DLQLHAPNLLSFEYSGPI----LPFSFRNVPNLVDASF  252 (446)
Q Consensus       219 ~~~i~~p~L~~l~~~~~~----~~~~~~~~~~L~~l~l  252 (446)
                      .+...+|+|++|++.++.    .+..+.++++|+++.+
T Consensus       205 ~l~~~~~~L~~L~L~~~~~~~~l~~~~~~~~~L~~L~l  242 (594)
T 2p1m_B          205 RLVTRCPNLKSLKLNRAVPLEKLATLLQRAPQLEELGT  242 (594)
T ss_dssp             HHHHHCTTCCEEECCTTSCHHHHHHHHHHCTTCSEEEC
T ss_pred             HHHHhCCCCcEEecCCCCcHHHHHHHHhcCCcceEccc
Confidence            222236888888887652    1122334555666554



>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 446
d1nexb1100 a.158.1.1 (B:270-369) Cdc4 F-box and linker domain 2e-06
d2ovrb1102 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing 1e-05
d1fs1a141 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [ 1e-04
d1p22a1118 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (b 3e-04
>d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 100 Back     information, alignment and structure

class: All alpha proteins
fold: F-box domain
superfamily: F-box domain
family: F-box domain
domain: Cdc4 F-box and linker domains
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
 Score = 44.3 bits (104), Expect = 2e-06
 Identities = 20/95 (21%), Positives = 36/95 (37%), Gaps = 16/95 (16%)

Query: 6  DHINELPDDILVNILSRLTMKEAVRTSIISSRWRY-------LWR------GFSGCLNFD 52
          D I  LP +I + I + L  ++ + +  +S  W         LW+       F     F+
Sbjct: 4  DLITSLPFEISLKIFNYLQFEDIINSLGVSQNWNKIIRKSTSLWKKLLISENFVSPKGFN 63

Query: 53 DPFTMANSKWPHLNLKSG--PINVERHKFV-NWVN 84
                + K+P L+ +       +E    + NW N
Sbjct: 64 SLNLKLSQKYPKLSQQDRLRLSFLENIFILKNWYN 98


>d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query446
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.13
d1fs1a141 Skp2 {Human (Homo sapiens) [TaxId: 9606]} 98.99
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 98.89
d2ovrb1102 F-box/WD repeat-containing protein 7, FBXW7 {Human 98.66
d1nexb1100 Cdc4 F-box and linker domains {Baker's yeast (Sacc 98.58
d1p9ag_266 von Willebrand factor binding domain of glycoprote 98.3
d1p22a1118 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 98.19
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.15
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 98.11
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 98.08
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.07
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.06
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 98.01
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 97.91
d1p9ag_266 von Willebrand factor binding domain of glycoprote 97.88
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 97.86
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 97.73
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 97.67
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 97.63
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 97.56
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 97.54
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 97.49
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 97.4
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 97.29
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 97.0
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 96.87
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.85
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 96.65
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 96.64
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.56
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 96.56
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 96.51
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 96.44
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 96.35
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 96.06
d2ifga3156 High affinity nerve growth factor receptor, N-term 95.95
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 95.94
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 95.88
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 95.87
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 94.41
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 93.7
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 91.05
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 89.89
d2ifga3156 High affinity nerve growth factor receptor, N-term 88.35
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: RNI-like
family: Cyclin A/CDK2-associated p19, Skp2
domain: Cyclin A/CDK2-associated p19, Skp2
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.13  E-value=4.9e-12  Score=116.00  Aligned_cols=82  Identities=16%  Similarity=0.156  Sum_probs=57.4

Q ss_pred             ccccccceEEEEEEeChHHHHHHHhcCCCCcceeeEeccCCCC-ceeEeCCcCccceEEeeccCCCCeEE-----EECCc
Q 013265          153 SFRHLTDLSLTTVGITGEVLEHLLCYCCPVLEVLNVAESSSLT-SLKVSGPSLKLKHLKLNKLDNLKDLQ-----LHAPN  226 (446)
Q Consensus       153 ~~~~L~~L~L~~~~~~~~~l~~ll~~~cp~Le~L~L~~c~~~~-~~~i~~~~~~L~~L~i~~~~~l~~~~-----i~~p~  226 (446)
                      ...+|++|+|+++.++++.+..+++. ||+|++|.+.+|.... .+..-..+++|++|.+++|..+.+..     -.+|+
T Consensus        44 ~~~~L~~LdLs~~~i~~~~l~~l~~~-c~~L~~L~L~~~~l~~~~~~~l~~~~~L~~L~Ls~c~~itd~~l~~l~~~~~~  122 (284)
T d2astb2          44 SPFRVQHMDLSNSVIEVSTLHGILSQ-CSKLQNLSLEGLRLSDPIVNTLAKNSNLVRLNLSGCSGFSEFALQTLLSSCSR  122 (284)
T ss_dssp             CCBCCCEEECTTCEECHHHHHHHHTT-BCCCSEEECTTCBCCHHHHHHHTTCTTCSEEECTTCBSCCHHHHHHHHHHCTT
T ss_pred             cCCCCCEEECCCCccCHHHHHHHHHh-CCCcccccccccCCCcHHHHHHhcCCCCcCccccccccccccccchhhHHHHh
Confidence            45689999999999998889999999 9999999999985321 12222344788888888887554321     13466


Q ss_pred             eeEEEEccc
Q 013265          227 LLSFEYSGP  235 (446)
Q Consensus       227 L~~l~~~~~  235 (446)
                      |++|++.++
T Consensus       123 L~~L~ls~c  131 (284)
T d2astb2         123 LDELNLSWC  131 (284)
T ss_dssp             CCEEECCCC
T ss_pred             ccccccccc
Confidence            666665554



>d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure