Citrus Sinensis ID: 013265
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 446 | ||||||
| 255544812 | 464 | ubiquitin-protein ligase, putative [Rici | 0.939 | 0.903 | 0.441 | 3e-95 | |
| 357477131 | 447 | F-box family-6 [Medicago truncatula] gi| | 0.914 | 0.912 | 0.337 | 7e-56 | |
| 449440973 | 475 | PREDICTED: putative FBD-associated F-box | 0.919 | 0.863 | 0.361 | 2e-51 | |
| 356544606 | 444 | PREDICTED: putative F-box protein At3g58 | 0.883 | 0.887 | 0.324 | 1e-46 | |
| 255540581 | 457 | ubiquitin-protein ligase, putative [Rici | 0.917 | 0.894 | 0.303 | 3e-39 | |
| 302142991 | 402 | unnamed protein product [Vitis vinifera] | 0.748 | 0.830 | 0.339 | 7e-37 | |
| 357162424 | 482 | PREDICTED: putative FBD-associated F-box | 0.860 | 0.796 | 0.278 | 3e-27 | |
| 297736820 | 487 | unnamed protein product [Vitis vinifera] | 0.899 | 0.823 | 0.288 | 6e-26 | |
| 147865783 | 1789 | hypothetical protein VITISV_020815 [Viti | 0.908 | 0.226 | 0.287 | 4e-25 | |
| 357119372 | 497 | PREDICTED: uncharacterized protein LOC10 | 0.910 | 0.816 | 0.260 | 2e-23 |
| >gi|255544812|ref|XP_002513467.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223547375|gb|EEF48870.1| ubiquitin-protein ligase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 355 bits (911), Expect = 3e-95, Method: Compositional matrix adjust.
Identities = 194/439 (44%), Positives = 289/439 (65%), Gaps = 20/439 (4%)
Query: 6 DHINELPDDILVNILSRLTMKEAVRTSIISSRWRYLWRGFSGCLNFDDPFTMANSKWPHL 65
+HI++LP+D+L+NILSRLTMKEA RTSI+S+RWR+LW ++G ++FD TM + L
Sbjct: 33 EHISQLPEDVLLNILSRLTMKEAARTSILSTRWRHLWTYYTGIMDFDASLTMW---YLQL 89
Query: 66 NLKSGPINVERHKFVNWVNQVLSSLEGHCTEELRICFDVFSN--HDIDNWIKFALERRVR 123
L S +++ERH FV+WVNQVL S EG E LRICFD+ S+ ++ID+WI A+++RV+
Sbjct: 90 GLGSKSLDMERHSFVSWVNQVLRSHEGPTMEGLRICFDLDSDFMYEIDSWITIAMQKRVK 149
Query: 124 RLELDFSRVVYNLRFVGQYTFPSHLDFYSSFRHLTDLSLTTVGITGEVLEHLLCYCCPVL 183
RLE+D + + +++ G Y FPS L SSF L L L V +TGE L+HLL CP+L
Sbjct: 150 RLEIDLTNIEPSIKTTGSYAFPSGLLNDSSFSSLKTLQLNMVDVTGEALQHLLLSWCPLL 209
Query: 184 EVLNVAESSSLTSLKVSGPSLKLKHLKLNKLDNLKDLQLHAPNLLSFEYSGPILPFSFRN 243
EVL++ S+SL SLKVSG SLKLK+L++ +NLK L++ A +L+SF+Y GP++ F++
Sbjct: 210 EVLSIVNSTSLVSLKVSGSSLKLKYLEMVCCNNLKYLEITAASLVSFKYYGPLIGLPFKS 269
Query: 244 VPNLVDASFWGCFSAYIAKNLCQHSIFLVQLHTLKLDTCHLLIGDSEYRAGRYLHDIPEM 303
VPNLVDASF G F +NL Q S++++QL TL+ D S Y + + P +
Sbjct: 270 VPNLVDASFGGPFCQLTIENLYQFSLYILQLETLRFDV------GSAYLMREFPTNFPIL 323
Query: 304 CNLKHLEI-IGTPKVNDLIF-CIALLEAAPSLYKFSLKLVS-QYDYESYESVKTIKDQPY 360
N+KHLE+ V +F C++LL+ P L++F+LK++S + S K +D +
Sbjct: 324 SNVKHLEVTTAVSAVAHCLFPCLSLLKGCPLLHRFTLKVISCESTLVCRASQKVPEDHSH 383
Query: 361 LSFTELRSIRVVELLGFVGHTADFELVMYLIFSAKLLEKIIIDPCPTWRVGTPAELIWRE 420
++VVE+LGF G+ A+ ELV+Y + +A +L+ +II PC + +P++L ++E
Sbjct: 384 ------PCLKVVEVLGFQGNAAEVELVLYFLRNAAVLKNLIISPCAPCYLRSPSQLKFKE 437
Query: 421 TAEYQSARRRAFELAAKFP 439
T YQSA++ A EL A+ P
Sbjct: 438 TELYQSAKQHAVELGARVP 456
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|357477131|ref|XP_003608851.1| F-box family-6 [Medicago truncatula] gi|355509906|gb|AES91048.1| F-box family-6 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|449440973|ref|XP_004138258.1| PREDICTED: putative FBD-associated F-box protein At5g56700-like [Cucumis sativus] gi|449501454|ref|XP_004161371.1| PREDICTED: putative FBD-associated F-box protein At5g56700-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356544606|ref|XP_003540740.1| PREDICTED: putative F-box protein At3g58860-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|255540581|ref|XP_002511355.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223550470|gb|EEF51957.1| ubiquitin-protein ligase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|302142991|emb|CBI20286.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|357162424|ref|XP_003579406.1| PREDICTED: putative FBD-associated F-box protein At1g61330-like [Brachypodium distachyon] | Back alignment and taxonomy information |
|---|
| >gi|297736820|emb|CBI26021.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|147865783|emb|CAN81149.1| hypothetical protein VITISV_020815 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|357119372|ref|XP_003561416.1| PREDICTED: uncharacterized protein LOC100838353 [Brachypodium distachyon] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 446 | ||||||
| TAIR|locus:2010032 | 416 | AT1G13570 "AT1G13570" [Arabido | 0.423 | 0.454 | 0.293 | 1.2e-11 | |
| TAIR|locus:2157922 | 444 | AT5G53840 "AT5G53840" [Arabido | 0.408 | 0.409 | 0.279 | 8.8e-11 | |
| TAIR|locus:2010708 | 479 | AT1G56400 "AT1G56400" [Arabido | 0.260 | 0.242 | 0.322 | 8.5e-10 | |
| TAIR|locus:2162454 | 437 | AT5G22700 "AT5G22700" [Arabido | 0.401 | 0.409 | 0.288 | 1.9e-09 | |
| TAIR|locus:2175861 | 388 | AT5G60610 "AT5G60610" [Arabido | 0.820 | 0.943 | 0.257 | 4e-09 | |
| TAIR|locus:2099054 | 454 | AT3G58880 "AT3G58880" [Arabido | 0.517 | 0.508 | 0.301 | 4.3e-09 | |
| TAIR|locus:2129266 | 434 | AT4G13960 "AT4G13960" [Arabido | 0.255 | 0.262 | 0.362 | 4.3e-09 | |
| TAIR|locus:2151316 | 456 | AT5G02700 "AT5G02700" [Arabido | 0.082 | 0.081 | 0.540 | 2.1e-08 | |
| TAIR|locus:2116362 | 453 | AT4G27050 "AT4G27050" [Arabido | 0.302 | 0.298 | 0.344 | 2.5e-08 | |
| TAIR|locus:2099644 | 481 | AT3G03360 [Arabidopsis thalian | 0.405 | 0.376 | 0.3 | 3.8e-08 |
| TAIR|locus:2010032 AT1G13570 "AT1G13570" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 173 (66.0 bits), Expect = 1.2e-11, Sum P(2) = 1.2e-11
Identities = 63/215 (29%), Positives = 102/215 (47%)
Query: 1 MRSEGDHINELPDDILVNILSRLTMKEAVRTSIISSRWRYLWRGFSGCLNFDDPFTMANS 60
M D I++LP I+ NIL+RL++++A+RTS++SS+WRY W + L FD+
Sbjct: 1 MGESPDFISDLPQSIIENILTRLSIRDAIRTSVLSSKWRYKWSTLTD-LVFDEKCVS--- 56
Query: 61 KWPHLNLKSGPINVERHKFVNWVNQVLSSLEGHCTE-ELRICFDVFSNHDIDNWIKFALE 119
P S V V ++ VL +G + +L F DID W+ F
Sbjct: 57 --P-----SNDRCVVETNLVRFITGVLLLHQGPIHKFQLSTSFKQ-CRPDIDQWLLFLSR 108
Query: 120 RRVRRLELDFS----RV---VYN-LRFVGQYTFPSHLD---FYSSFRHLTDLSLTTVGIT 168
++ L L RV ++N L+ D ++ F +L L+L + +
Sbjct: 109 NGIKELVLKLGEGEFRVPACLFNCLKLTCLELCHCEFDPPQYFKGFSYLKSLNLHQILVA 168
Query: 169 GEVLEHLLCYCCPVLEVLNVAESSSLTSLKVSGPS 203
EV+E L+ C P+LE L+++ SL L +S P+
Sbjct: 169 PEVIESLISGC-PLLEFLSLSYFDSLV-LSISAPN 201
|
|
| TAIR|locus:2157922 AT5G53840 "AT5G53840" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2010708 AT1G56400 "AT1G56400" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2162454 AT5G22700 "AT5G22700" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2175861 AT5G60610 "AT5G60610" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2099054 AT3G58880 "AT3G58880" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2129266 AT4G13960 "AT4G13960" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2151316 AT5G02700 "AT5G02700" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2116362 AT4G27050 "AT4G27050" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2099644 AT3G03360 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| BRADI5G24490.1 | annotation not avaliable (482 aa) | |||||||
(Brachypodium distachyon) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 446 | |||
| pfam00646 | 48 | pfam00646, F-box, F-box domain | 5e-05 | |
| smart00256 | 41 | smart00256, FBOX, A Receptor for Ubiquitination Ta | 3e-04 | |
| pfam12937 | 47 | pfam12937, F-box-like, F-box-like | 8e-04 |
| >gnl|CDD|201368 pfam00646, F-box, F-box domain | Back alignment and domain information |
|---|
Score = 40.3 bits (95), Expect = 5e-05
Identities = 18/38 (47%), Positives = 26/38 (68%)
Query: 6 DHINELPDDILVNILSRLTMKEAVRTSIISSRWRYLWR 43
+ +LPDD+L+ ILSRL K+ +R S++S RWR L
Sbjct: 1 FSLLDLPDDLLLEILSRLDPKDLLRLSLVSKRWRSLVD 38
|
This domain is approximately 50 amino acids long, and is usually found in the N-terminal half of a variety of proteins. Two motifs that are commonly found associated with the F-box domain are the leucine rich repeats (LRRs; pfam00560 and pfam07723) and the WD repeat (pfam00400). The F-box domain has a role in mediating protein-protein interactions in a variety of contexts, such as polyubiquitination, transcription elongation, centromere binding and translational repression. Length = 48 |
| >gnl|CDD|197608 smart00256, FBOX, A Receptor for Ubiquitination Targets | Back alignment and domain information |
|---|
| >gnl|CDD|221867 pfam12937, F-box-like, F-box-like | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 446 | |||
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 99.59 | |
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 99.51 | |
| PF08387 | 51 | FBD: FBD; InterPro: IPR013596 This region is found | 99.06 | |
| smart00579 | 72 | FBD domain in FBox and BRCT domain containing plan | 98.81 | |
| PF12937 | 47 | F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B | 98.7 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 98.44 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 98.39 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 98.35 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 98.3 | |
| PF00646 | 48 | F-box: F-box domain; InterPro: IPR001810 The F-box | 98.28 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 98.24 | |
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 98.22 | |
| smart00256 | 41 | FBOX A Receptor for Ubiquitination Targets. | 98.13 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 98.07 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 98.05 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 97.97 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 97.84 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 97.56 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 97.34 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 97.33 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 97.31 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 97.29 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 97.24 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 97.03 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 96.82 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 96.8 | |
| PF07723 | 26 | LRR_2: Leucine Rich Repeat; InterPro: IPR013101 Le | 96.72 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 96.61 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 96.57 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 96.55 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 96.49 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 96.45 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 96.39 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 95.12 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 94.78 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 94.64 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 94.53 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 94.42 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 94.0 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 93.63 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 92.82 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 92.49 | |
| KOG3864 | 221 | consensus Uncharacterized conserved protein [Funct | 92.36 | |
| KOG2997 | 366 | consensus F-box protein FBX9 [General function pre | 92.35 | |
| PLN03215 | 373 | ascorbic acid mannose pathway regulator 1; Provisi | 92.23 | |
| KOG0281 | 499 | consensus Beta-TrCP (transducin repeats containing | 92.21 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 91.85 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 91.07 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 90.56 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 90.18 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 89.74 | |
| KOG3864 | 221 | consensus Uncharacterized conserved protein [Funct | 88.69 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 87.56 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 87.5 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 86.62 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 86.24 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 86.05 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 85.96 | |
| smart00367 | 26 | LRR_CC Leucine-rich repeat - CC (cysteine-containi | 85.91 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 85.61 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 83.46 | |
| PF13013 | 109 | F-box-like_2: F-box-like domain | 81.6 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 81.57 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 81.55 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 81.3 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 80.36 |
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=99.59 E-value=2.2e-16 Score=141.25 Aligned_cols=275 Identities=21% Similarity=0.245 Sum_probs=175.6
Q ss_pred CCCCChHHHHHHHhCCChhHHHHHhhccchhhhh------cccccceEEecCCCCCCCCCCccccCCCCCchhhHhHHHH
Q 013265 8 INELPDDILVNILSRLTMKEAVRTSIISSRWRYL------WRGFSGCLNFDDPFTMANSKWPHLNLKSGPINVERHKFVN 81 (446)
Q Consensus 8 is~LPd~iL~~ILs~Lp~kd~~rts~lSkrWr~l------w~~~~~~L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 81 (446)
+..|||||+..||+.|+.||..+.+.|||||.++ |. .+++....+.+ ....+
T Consensus 98 ~~slpDEill~IFs~L~kk~LL~~~~VC~Rfyr~~~de~lW~----~lDl~~r~i~p------------------~~l~~ 155 (419)
T KOG2120|consen 98 WDSLPDEILLGIFSCLCKKELLKVSGVCKRFYRLASDESLWQ----TLDLTGRNIHP------------------DVLGR 155 (419)
T ss_pred cccCCHHHHHHHHHhccHHHHHHHHHHHHHHhhcccccccee----eeccCCCccCh------------------hHHHH
Confidence 6789999999999999999999999999999865 65 56665554432 22222
Q ss_pred HHHHHHHhccCCCcceEEEEEecCCcchHHHHHHH--HHHcCCcEEEEeeeccccccccccccccccccCC-cccccccc
Q 013265 82 WVNQVLSSLEGHCTEELRICFDVFSNHDIDNWIKF--ALERRVRRLELDFSRVVYNLRFVGQYTFPSHLDF-YSSFRHLT 158 (446)
Q Consensus 82 ~v~~~L~~~~~~~l~~l~l~~~~~~~~~~~~wi~~--~~~~~l~~L~l~~~~~~~~~~~~~~~~lp~~~~~-~~~~~~L~ 158 (446)
.+ + +| |.-|++.-..... .+.... .++..++.+++..... ... .+.. ...|..||
T Consensus 156 l~-----~-rg--V~v~Rlar~~~~~---prlae~~~~frsRlq~lDLS~s~i----------t~s-tl~~iLs~C~kLk 213 (419)
T KOG2120|consen 156 LL-----S-RG--VIVFRLARSFMDQ---PRLAEHFSPFRSRLQHLDLSNSVI----------TVS-TLHGILSQCSKLK 213 (419)
T ss_pred HH-----h-CC--eEEEEcchhhhcC---chhhhhhhhhhhhhHHhhcchhhe----------eHH-HHHHHHHHHHhhh
Confidence 22 1 23 4445443111111 112222 2333577777644321 000 0000 23578999
Q ss_pred ceEEEEEEeChHHHHHHHhcCCCCcceeeEeccCCCCcee---EeCCcCccceEEeeccCCCCeEEE-----ECCceeEE
Q 013265 159 DLSLTTVGITGEVLEHLLCYCCPVLEVLNVAESSSLTSLK---VSGPSLKLKHLKLNKLDNLKDLQL-----HAPNLLSF 230 (446)
Q Consensus 159 ~L~L~~~~~~~~~l~~ll~~~cp~Le~L~L~~c~~~~~~~---i~~~~~~L~~L~i~~~~~l~~~~i-----~~p~L~~l 230 (446)
.|.|.+..++|. +..-++. -.+|++|+|..|.|++... +..+|++|.+|.++.|......+. ..++|+.|
T Consensus 214 ~lSlEg~~LdD~-I~~~iAk-N~~L~~lnlsm~sG~t~n~~~ll~~scs~L~~LNlsWc~l~~~~Vtv~V~hise~l~~L 291 (419)
T KOG2120|consen 214 NLSLEGLRLDDP-IVNTIAK-NSNLVRLNLSMCSGFTENALQLLLSSCSRLDELNLSWCFLFTEKVTVAVAHISETLTQL 291 (419)
T ss_pred hccccccccCcH-HHHHHhc-cccceeeccccccccchhHHHHHHHhhhhHhhcCchHhhccchhhhHHHhhhchhhhhh
Confidence 999999998876 3344667 7899999999999987653 334668999999999985544321 24889999
Q ss_pred EEcccccc-------cccCCCCCcceEEecccchhhhhhhhhhhhccCCCceEEEEeecccccccchhcccccccCCCCC
Q 013265 231 EYSGPILP-------FSFRNVPNLVDASFWGCFSAYIAKNLCQHSIFLVQLHTLKLDTCHLLIGDSEYRAGRYLHDIPEM 303 (446)
Q Consensus 231 ~~~~~~~~-------~~~~~~~~L~~l~l~~~~~~~~~~~l~~~l~~l~~l~~L~L~~~~~~~~~~~~~~~~~~~~~~~~ 303 (446)
++.|+.-. .-...+|+|.+++++++ .... .+....+..++.|++|.++.|+..... . .-.+...
T Consensus 292 NlsG~rrnl~~sh~~tL~~rcp~l~~LDLSD~-v~l~-~~~~~~~~kf~~L~~lSlsRCY~i~p~------~-~~~l~s~ 362 (419)
T KOG2120|consen 292 NLSGYRRNLQKSHLSTLVRRCPNLVHLDLSDS-VMLK-NDCFQEFFKFNYLQHLSLSRCYDIIPE------T-LLELNSK 362 (419)
T ss_pred hhhhhHhhhhhhHHHHHHHhCCceeeeccccc-cccC-chHHHHHHhcchheeeehhhhcCCChH------H-eeeeccC
Confidence 99888422 22346888888888776 2221 134466677888999998887543321 1 1124456
Q ss_pred CcccEEEEEecCCCCCHHHHHHHHhhCCCceEEEEEE
Q 013265 304 CNLKHLEIIGTPKVNDLIFCIALLEAAPSLYKFSLKL 340 (446)
Q Consensus 304 ~~L~~L~L~~~~~~~~~~~l~~ll~~~p~L~~L~l~~ 340 (446)
|.|++|++.++..+. .+.-+.+.||+|+.-.-++
T Consensus 363 psl~yLdv~g~vsdt---~mel~~e~~~~lkin~q~~ 396 (419)
T KOG2120|consen 363 PSLVYLDVFGCVSDT---TMELLKEMLSHLKINCQHF 396 (419)
T ss_pred cceEEEEeccccCch---HHHHHHHhCccccccceee
Confidence 788899888886443 3455677888887665544
|
|
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
| >PF08387 FBD: FBD; InterPro: IPR013596 This region is found in F-box (IPR001810 from INTERPRO) and other domain containing plant proteins; it is repeated in two family members | Back alignment and domain information |
|---|
| >smart00579 FBD domain in FBox and BRCT domain containing plant proteins | Back alignment and domain information |
|---|
| >PF12937 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 2OVQ_B 1FS1_A 1FS2_C 1FQV_I 1LDK_E 2AST_B 2ASS_B | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >PF00646 F-box: F-box domain; InterPro: IPR001810 The F-box domain was first described as a sequence motif found in cyclin-F that interacts with the protein SKP1 [, ] | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
| >smart00256 FBOX A Receptor for Ubiquitination Targets | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF07723 LRR_2: Leucine Rich Repeat; InterPro: IPR013101 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3864 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2997 consensus F-box protein FBX9 [General function prediction only] | Back alignment and domain information |
|---|
| >PLN03215 ascorbic acid mannose pathway regulator 1; Provisional | Back alignment and domain information |
|---|
| >KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG3864 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13013 F-box-like_2: F-box-like domain | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 446 | |||
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 3e-09 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 3e-07 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 4e-07 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 3e-06 | |
| 1fs1_A | 53 | SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L | 1e-05 | |
| 2e31_A | 297 | FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui | 3e-04 | |
| 3l2o_B | 312 | F-box only protein 4; small G protein fold, UBL co | 5e-04 |
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 | Back alignment and structure |
|---|
Score = 57.2 bits (138), Expect = 3e-09
Identities = 67/343 (19%), Positives = 113/343 (32%), Gaps = 58/343 (16%)
Query: 2 RSEGDHINELPDDILVNILSRLTMKEAVRTSIISSRWRYLWRGFSGCLNFDDPFTMANSK 61
G + LPD++L+ I S L + E ++ S + RW L S D +
Sbjct: 3 NFPGVSWDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESLWQTLDLTGKNLHPD 62
Query: 62 WPHLNLKSGPINVERHKFVNWVNQVLSSLEGHCTEELRICFDVFSNHDIDNWIKFALERR 121
L G I + + R+ SN I+ + +
Sbjct: 63 VTGRLLSQGVIAFRCPRS------FMDQPLAEHFSPFRVQHMDLSNSVIEVSTLHGILSQ 116
Query: 122 VRRLELDFSRVVYNLRFVGQYTFPSHLDFYSSFRHLTDLSLTTV-GITGEVLEHLLCYCC 180
+L+ NL G ++ + +L L+L+ G + L+ LL C
Sbjct: 117 CSKLQ--------NLSLEGLRLSDPIVNTLAKNSNLVRLNLSGCSGFSEFALQTLLS-SC 167
Query: 181 PVLEVLNVAESSSLTS----LKVSGPSLKLKHLKLNKL------DNLKDLQLHAPNLLSF 230
L+ LN++ T + V+ S + L L+ +L L PNL+
Sbjct: 168 SRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVH- 226
Query: 231 EYSGPILPFSFRNVPNLVDASFWGCFSAYIAKNLCQHSIFLVQLHTLKLDTCHLLIGDSE 290
+ L + F + L L L L C+ +I ++
Sbjct: 227 --------LDLSDSVMLKNDCF-----QEFFQ--------LNYLQHLSLSRCYDIIPET- 264
Query: 291 YRAGRYLHDIPEMCNLKHLEIIGTPKVNDLIFCIALLEAAPSL 333
L ++ E+ LK L++ G L L EA P L
Sbjct: 265 ------LLELGEIPTLKTLQVFGIVPDGTL---QLLKEALPHL 298
|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E Length = 53 | Back alignment and structure |
|---|
| >2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A Length = 297 | Back alignment and structure |
|---|
| >3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} Length = 312 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 446 | |||
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 99.84 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 99.82 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 99.78 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 99.05 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 98.99 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 98.97 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 98.77 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 98.76 | |
| 1fs1_A | 53 | SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L | 98.74 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 98.74 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 98.73 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 98.67 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 98.66 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 98.64 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 98.62 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 98.62 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 98.58 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 98.55 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 98.52 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 98.51 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 98.51 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 98.51 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 98.5 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 98.49 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 98.49 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 98.48 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 98.47 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 98.47 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 98.46 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 98.45 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 98.44 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 98.4 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 98.4 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 98.39 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 98.39 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 98.39 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 98.39 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 98.39 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 98.38 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 98.38 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 98.38 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 98.38 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 98.36 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 98.36 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 98.36 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 98.35 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 98.35 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 98.34 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 98.33 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 98.33 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 98.31 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 98.28 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 98.27 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 98.25 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 98.25 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 98.25 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 98.24 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 98.23 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 98.22 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 98.22 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 98.22 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 98.21 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 98.2 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 98.2 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 98.2 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 98.19 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 98.18 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 98.18 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 98.15 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 98.15 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 98.15 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 98.13 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 98.13 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 98.11 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 98.1 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 98.1 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 98.1 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 98.09 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 98.08 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 98.08 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 98.05 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 98.04 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 98.03 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 98.02 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 98.01 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 98.0 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 97.99 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 97.93 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 97.92 | |
| 2e31_A | 297 | FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui | 97.92 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 97.92 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 97.91 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 97.91 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 97.89 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 97.88 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 97.87 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 97.87 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 97.86 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 97.85 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 97.84 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 97.83 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 97.8 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 97.78 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 97.78 | |
| 3l2o_B | 312 | F-box only protein 4; small G protein fold, UBL co | 97.76 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 97.71 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 97.68 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 97.68 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 97.65 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 97.57 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 97.5 | |
| 3v7d_B | 464 | Cell division control protein 4; WD 40 domain, pho | 97.47 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 97.45 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 97.43 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 97.42 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 97.42 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 97.41 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 97.39 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 97.39 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 97.38 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 97.37 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 97.24 | |
| 2ovr_B | 445 | FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 | 97.24 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 97.24 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 97.19 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 97.15 | |
| 1p22_A | 435 | F-BOX/WD-repeat protein 1A; ubiquitination, degrad | 97.14 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 97.14 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 97.05 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 96.98 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 96.95 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 96.88 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 96.79 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 96.77 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 96.74 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 96.67 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 96.6 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 96.59 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 96.56 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 96.54 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 96.41 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 96.33 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 96.23 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 96.19 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 96.04 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 96.04 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 95.98 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 95.57 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 95.5 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 95.2 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 95.09 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 94.95 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 94.75 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 94.59 | |
| 4fs7_A | 394 | Uncharacterized protein; leucine-rich repeats, pro | 92.63 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 91.74 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 89.8 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 89.64 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 88.39 | |
| 4fs7_A | 394 | Uncharacterized protein; leucine-rich repeats, pro | 82.77 | |
| 4gt6_A | 394 | Cell surface protein; leucine rich repeats, putati | 81.04 |
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
Probab=99.84 E-value=1.9e-21 Score=201.45 Aligned_cols=212 Identities=17% Similarity=0.240 Sum_probs=129.1
Q ss_pred cCCcCCCCChHHHHHHHhCCC-hhHHHHHhhccchhhhhcccccceEEecCCCCCCCCCCccccCCCCCchhhHhHHHHH
Q 013265 4 EGDHINELPDDILVNILSRLT-MKEAVRTSIISSRWRYLWRGFSGCLNFDDPFTMANSKWPHLNLKSGPINVERHKFVNW 82 (446)
Q Consensus 4 ~~D~is~LPd~iL~~ILs~Lp-~kd~~rts~lSkrWr~lw~~~~~~L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 82 (446)
..|+++.||||||.+||++|| .+|+++++.|||||+++.......+++....... ..
T Consensus 2 ~~d~~~~LPdevL~~If~~L~~~~d~~~~s~vck~W~~~~~~~~~~l~~~~~~~~~-----------------~~----- 59 (594)
T 2p1m_B 2 QKRIALSFPEEVLEHVFSFIQLDKDRNSVSLVCKSWYEIERWCRRKVFIGNCYAVS-----------------PA----- 59 (594)
T ss_dssp --------CHHHHHHHHHTCCCHHHHHHHHTSCHHHHHHHHHHCCEEEESSTTSSC-----------------HH-----
T ss_pred cccchhhCCHHHHHHHHhhcCCchhHHHHHHHHHHHHHhhhhhceEEeeccccccC-----------------HH-----
Confidence 359999999999999999999 9999999999999998732123355554321110 11
Q ss_pred HHHHHHhccCCCcceEEEEEecCC----------cchHHHHHHHHHH--cCCcEEEEeeeccccccccccccccccccCC
Q 013265 83 VNQVLSSLEGHCTEELRICFDVFS----------NHDIDNWIKFALE--RRVRRLELDFSRVVYNLRFVGQYTFPSHLDF 150 (446)
Q Consensus 83 v~~~L~~~~~~~l~~l~l~~~~~~----------~~~~~~wi~~~~~--~~l~~L~l~~~~~~~~~~~~~~~~lp~~~~~ 150 (446)
..+.+. +.++++.+...... ...+..|+..... +++++|.+....... ..+..+
T Consensus 60 --~~~~~~--~~L~~L~L~~~~~~~~~~l~~~~~~~~~~~~l~~l~~~~~~L~~L~L~~~~~~~--------~~~~~l-- 125 (594)
T 2p1m_B 60 --TVIRRF--PKVRSVELKGKPHFADFNLVPDGWGGYVYPWIEAMSSSYTWLEEIRLKRMVVTD--------DCLELI-- 125 (594)
T ss_dssp --HHHHHC--TTCCEEEEECSCGGGGGTCSCTTSCCBCHHHHHHHHHHCTTCCEEEEESCBCCH--------HHHHHH--
T ss_pred --HHHhhC--CCceEEeccCCCchhhcccccccccchhhHHHHHHHHhCCCCCeEEeeCcEEcH--------HHHHHH--
Confidence 122222 34888888763211 0245678887654 389999886432110 001011
Q ss_pred ccccccccceEEEEE-EeChHHHHHHHhcCCCCcceeeEeccCCC----Cce-eEeCCcCccceEEeeccC-CC-----C
Q 013265 151 YSSFRHLTDLSLTTV-GITGEVLEHLLCYCCPVLEVLNVAESSSL----TSL-KVSGPSLKLKHLKLNKLD-NL-----K 218 (446)
Q Consensus 151 ~~~~~~L~~L~L~~~-~~~~~~l~~ll~~~cp~Le~L~L~~c~~~----~~~-~i~~~~~~L~~L~i~~~~-~l-----~ 218 (446)
..++++|++|+|.++ .+++..+..+..+ ||+|++|++.+|... ..+ .+...+++|++|.+.+|. .+ .
T Consensus 126 ~~~~~~L~~L~L~~~~~~~~~~l~~~~~~-~~~L~~L~L~~~~i~~~~~~~l~~~~~~~~~L~~L~l~~~~~~~~~~~l~ 204 (594)
T 2p1m_B 126 AKSFKNFKVLVLSSCEGFSTDGLAAIAAT-CRNLKELDLRESDVDDVSGHWLSHFPDTYTSLVSLNISCLASEVSFSALE 204 (594)
T ss_dssp HHHCTTCCEEEEESCEEEEHHHHHHHHHH-CTTCCEEECTTCEEECCCGGGGGGSCTTCCCCCEEECTTCCSCCCHHHHH
T ss_pred HHhCCCCcEEeCCCcCCCCHHHHHHHHHh-CCCCCEEeCcCCccCCcchHHHHHHhhcCCcCcEEEecccCCcCCHHHHH
Confidence 125789999999998 5787788888899 999999999988611 111 233355789999998875 11 1
Q ss_pred eEEEECCceeEEEEcccc----cccccCCCCCcceEEe
Q 013265 219 DLQLHAPNLLSFEYSGPI----LPFSFRNVPNLVDASF 252 (446)
Q Consensus 219 ~~~i~~p~L~~l~~~~~~----~~~~~~~~~~L~~l~l 252 (446)
.+...+|+|++|++.++. .+..+.++++|+++.+
T Consensus 205 ~l~~~~~~L~~L~L~~~~~~~~l~~~~~~~~~L~~L~l 242 (594)
T 2p1m_B 205 RLVTRCPNLKSLKLNRAVPLEKLATLLQRAPQLEELGT 242 (594)
T ss_dssp HHHHHCTTCCEEECCTTSCHHHHHHHHHHCTTCSEEEC
T ss_pred HHHHhCCCCcEEecCCCCcHHHHHHHHhcCCcceEccc
Confidence 222236888888887652 1122334555666554
|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 446 | ||||
| d1nexb1 | 100 | a.158.1.1 (B:270-369) Cdc4 F-box and linker domain | 2e-06 | |
| d2ovrb1 | 102 | a.158.1.1 (B:2263-2364) F-box/WD repeat-containing | 1e-05 | |
| d1fs1a1 | 41 | a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [ | 1e-04 | |
| d1p22a1 | 118 | a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (b | 3e-04 |
| >d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 100 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: F-box domain superfamily: F-box domain family: F-box domain domain: Cdc4 F-box and linker domains species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Score = 44.3 bits (104), Expect = 2e-06
Identities = 20/95 (21%), Positives = 36/95 (37%), Gaps = 16/95 (16%)
Query: 6 DHINELPDDILVNILSRLTMKEAVRTSIISSRWRY-------LWR------GFSGCLNFD 52
D I LP +I + I + L ++ + + +S W LW+ F F+
Sbjct: 4 DLITSLPFEISLKIFNYLQFEDIINSLGVSQNWNKIIRKSTSLWKKLLISENFVSPKGFN 63
Query: 53 DPFTMANSKWPHLNLKSG--PINVERHKFV-NWVN 84
+ K+P L+ + +E + NW N
Sbjct: 64 SLNLKLSQKYPKLSQQDRLRLSFLENIFILKNWYN 98
|
| >d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 41 | Back information, alignment and structure |
|---|
| >d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 118 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 446 | |||
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 99.13 | |
| d1fs1a1 | 41 | Skp2 {Human (Homo sapiens) [TaxId: 9606]} | 98.99 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 98.89 | |
| d2ovrb1 | 102 | F-box/WD repeat-containing protein 7, FBXW7 {Human | 98.66 | |
| d1nexb1 | 100 | Cdc4 F-box and linker domains {Baker's yeast (Sacc | 98.58 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 98.3 | |
| d1p22a1 | 118 | F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom | 98.19 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 98.15 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 98.11 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 98.08 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.07 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.06 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 98.01 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 97.91 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 97.88 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 97.86 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 97.73 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 97.67 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 97.63 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 97.56 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 97.54 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 97.49 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 97.4 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 97.29 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 97.0 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 96.87 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 96.85 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 96.65 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 96.64 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 96.56 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 96.56 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 96.51 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 96.44 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 96.35 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 96.06 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 95.95 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 95.94 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 95.88 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 95.87 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 94.41 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 93.7 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 91.05 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 89.89 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 88.35 |
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) superfamily: RNI-like family: Cyclin A/CDK2-associated p19, Skp2 domain: Cyclin A/CDK2-associated p19, Skp2 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.13 E-value=4.9e-12 Score=116.00 Aligned_cols=82 Identities=16% Similarity=0.156 Sum_probs=57.4
Q ss_pred ccccccceEEEEEEeChHHHHHHHhcCCCCcceeeEeccCCCC-ceeEeCCcCccceEEeeccCCCCeEE-----EECCc
Q 013265 153 SFRHLTDLSLTTVGITGEVLEHLLCYCCPVLEVLNVAESSSLT-SLKVSGPSLKLKHLKLNKLDNLKDLQ-----LHAPN 226 (446)
Q Consensus 153 ~~~~L~~L~L~~~~~~~~~l~~ll~~~cp~Le~L~L~~c~~~~-~~~i~~~~~~L~~L~i~~~~~l~~~~-----i~~p~ 226 (446)
...+|++|+|+++.++++.+..+++. ||+|++|.+.+|.... .+..-..+++|++|.+++|..+.+.. -.+|+
T Consensus 44 ~~~~L~~LdLs~~~i~~~~l~~l~~~-c~~L~~L~L~~~~l~~~~~~~l~~~~~L~~L~Ls~c~~itd~~l~~l~~~~~~ 122 (284)
T d2astb2 44 SPFRVQHMDLSNSVIEVSTLHGILSQ-CSKLQNLSLEGLRLSDPIVNTLAKNSNLVRLNLSGCSGFSEFALQTLLSSCSR 122 (284)
T ss_dssp CCBCCCEEECTTCEECHHHHHHHHTT-BCCCSEEECTTCBCCHHHHHHHTTCTTCSEEECTTCBSCCHHHHHHHHHHCTT
T ss_pred cCCCCCEEECCCCccCHHHHHHHHHh-CCCcccccccccCCCcHHHHHHhcCCCCcCccccccccccccccchhhHHHHh
Confidence 45689999999999998889999999 9999999999985321 12222344788888888887554321 13466
Q ss_pred eeEEEEccc
Q 013265 227 LLSFEYSGP 235 (446)
Q Consensus 227 L~~l~~~~~ 235 (446)
|++|++.++
T Consensus 123 L~~L~ls~c 131 (284)
T d2astb2 123 LDELNLSWC 131 (284)
T ss_dssp CCEEECCCC
T ss_pred ccccccccc
Confidence 666665554
|
| >d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|