Citrus Sinensis ID: 013369

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440----
MFEEALRKDDHVDEVKLLLSKIPKLSDDVIRASSSSENNPLLTACEYGNHQVAKEIASRWPKLAMIKNQHGQTAVHTVAERGDVEMVQFLGKQNPESCLVEDNLSMIPLHRAAMNGQSVDVIRALVSICPESLEKLTSNQDTALHLAVKNSHLEAFQVLVKVSKIHNKEHVFNWKNEDGNTVLHLATFNKSIEIVKALALESSNSSSIMIRVNTLNKQGQTALEVCKANSEDSVFKEIGLILQEASARSPVQQSPQIAVGTTNIVSWNNLTRWPIETRNVLLMIVGTIAAVFFTVTCNLPAPFLKEYYLAGKTLHVKDVATGGLPTIFYLMLFNSAGFMTTMAAIVVLGWPLHFRTILLFLVTCVCIVYVIIVDELMPKLVVRLGKSSISSIALMWSLVLALIFFGISVLSLRKFTPSLCRFIQWLWAKRTIYQSNTGHQDLNA
cHHHHHHccccHHHHHHHHHccccccHHHHHccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHccccHHHHHHHHHccccccccccccccHHHHHHHHcccHHHHHHHHHccccccccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccccccccHHHHHHHcccHHHHHHHHHHHHHccccccccccccccccccccccccccccccHHcccHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccEEEHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccccccccccc
ccHHHHHHcccHHHHHHHHHcccccccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHccccccEccccccccHHHHHHHccccHHHHHHHHHccccHHcccccccccHHHHHHHcccHHHHHHHHHccccccccccEcccccccccHHHHHHHcccHHHHHHHHHccccHccccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHccccEEEEccccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHcccHHHEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccc
mfeealrkddhVDEVKLLLSkipklsddvirassssennplltaceyGNHQVAKEIASRWPKLAMIKNQHGQTAVHTVAERGDVEMVQFLgkqnpesclvednlsmiplhraamngQSVDVIRALVSICPESLEKLTSNQDTALHLAVKNSHLEAFQVLVKVSkihnkehvfnwknedgntvlhLATFNKSIEIVKALALESSNSSSIMIRVNTLNKQGQTALEVCKANSEDSVFKEIGLILQEasarspvqqspqiavgtTNIVSwnnltrwpieTRNVLLMIVGTIAAVFFTVTcnlpapflkeYYLAGKTLHvkdvatgglPTIFYLMLFNSAGFMTTMAAIVVLGWPLHFRTILLFLVTCVCIVYVIIVDELMPKLVVRLGKSSISSIALMWSLVLALIFFGISVLSLRKFTPSLCRFIQWLWAKRTiyqsntghqdlna
mfeealrkddhvdeVKLLLskipklsddvirassssennplltACEYGNHQVAKEIASRWPKLAMIKNQHGQTAVHTVAERGDVEMVQFLGKQNPESCLVEDNLSMIPLHRAAMNGQSVDVIRALVSICPESLEKLTSNQDTALHLAVKNSHLEAFQVLVKVSKIHNKEHVfnwknedgntVLHLATFNKSIEIVKALALESSNSSSIMIRVNTLNKQGQTALEVCKANSEDSVFKEIGLILQEAsarspvqqspqiavGTTNIVSWNNLTRWPIETRNVLLMIVGTIAAVFFTVTCNLPAPFLKEYYLAGKTLHVKDVATGGLPTIFYLMLFNSAGFMTTMAAIVVLGWPLHFRTILLFLVTCVCIVYVIIVDELMPKLVVRLGKSSISSIALMWSLVLALIFFGISVLSLRKFTPSLCRFIQWLWAKRTIyqsntghqdlna
MFEEALRKDDHVDEVKLLLSKIPKLSDDVIRASSSSENNPLLTACEYGNHQVAKEIASRWPKLAMIKNQHGQTAVHTVAERGDVEMVQFLGKQNPESCLVEDNLSMIPLHRAAMNGQSVDVIRALVSICPESLEKLTSNQDTALHLAVKNSHLEAFQVLVKVSKIHNKEHVFNWKNEDGNTVLHLATFNKSIEIVKALALESSNSSSIMIRVNTLNKQGQTALEVCKANSEDSVFKEIGLILQEASARSPVQQSPQIAVGTTNIVSWNNLTRWPIETRNVLLMIVGTIAAVFFTVTCNLPAPFLKEYYLAGKTLHVKDVATGGLPTIFYLMLFNSAGFMTTMAAIVVLGWPLHFRTILLFLvtcvcivyviivDELMPKLVVRLGKSSISSIALMWSLVLALIFFGISVLSLRKFTPSLCRFIQWLWAKRTIYQSNTGHQDLNA
****************LLL*********************LLTACEYGNHQVAKEIASRWPKLAMIKNQHGQTAVHTVAERGDVEMVQFLGKQNPESCLVEDNLSMIPLHRAAMNGQSVDVIRALVSICPESLEKLTSNQDTALHLAVKNSHLEAFQVLVKVSKIHNKEHVFNWKNEDGNTVLHLATFNKSIEIVKALALES***SSIMIRVNTLNKQGQTALEVCKANSEDSVFKEIGLILQ************QIAVGTTNIVSWNNLTRWPIETRNVLLMIVGTIAAVFFTVTCNLPAPFLKEYYLAGKTLHVKDVATGGLPTIFYLMLFNSAGFMTTMAAIVVLGWPLHFRTILLFLVTCVCIVYVIIVDELMPKLVVRLGKSSISSIALMWSLVLALIFFGISVLSLRKFTPSLCRFIQWLWAKRTIYQ**********
MFEEALRKDDHVDEVKLLLSKIPKLSDDVIRASSSSENNPLLTACEYGNHQVAKEIASRWPKLAMIKNQHGQTAVHTVAERGDVEMVQFLGKQNPESCLVEDNLSMIPLHRAAMNGQSVDVIRALVSICPESLEKLTSNQDTALHLAVKNSHLEAFQVLVKVSKIHNKEHVFNWKNEDGNTVLHLATFNKSIEIVKALALESSNSSSIMIRVNTLNKQGQTALEVCKANSEDSVFKEIGLILQEA******************************ETRNVLLMIVGTIAAVFFTVTCNLPAPFLKEYYLAGKTLHVKDVATGGLPTIFYLMLFNSAGFMTTMAAIVVLGWPLHFRTILLFLVTCVCIVYVIIVDELMPKLVVRLGKSSISSIALMWSLVLALIFFGISVLSLRKFTPSLCRFIQWL******************
*********DHVDEVKLLLSKIPKLSDDVIRASSSSENNPLLTACEYGNHQVAKEIASRWPKLAMIK********HTVAERGDVEMVQFLGKQNPESCLVEDNLSMIPLHRAAMNGQSVDVIRALVSICPESLEKLTSNQDTALHLAVKNSHLEAFQVLVKVSKIHNKEHVFNWKNEDGNTVLHLATFNKSIEIVKALALESSNSSSIMIRVNTLNKQGQTALEVCKANSEDSVFKEIGLILQEA**********QIAVGTTNIVSWNNLTRWPIETRNVLLMIVGTIAAVFFTVTCNLPAPFLKEYYLAGKTLHVKDVATGGLPTIFYLMLFNSAGFMTTMAAIVVLGWPLHFRTILLFLVTCVCIVYVIIVDELMPKLVVRLGKSSISSIALMWSLVLALIFFGISVLSLRKFTPSLCRFIQWLWAKRTIYQSN********
MFEEALRKDDHVDEVKLLLSKIPKLSDDVIRASSSSENNPLLTACEYGNHQVAKEIASRWPKLAMIKNQHGQTAVHTVAERGDVEMVQFLGKQNPESCLVEDNLSMIPLHRAAMNGQSVDVIRALVSICPESLEKLTSNQDTALHLAVKNSHLEAFQVLVKVSKIHNKEHVFNWKNEDGNTVLHLATFNKSIEIVKALALESSNSSSIMIRVNTLNKQGQTALEVCKANSEDSVFKEIGLILQEASARSPVQQSPQIAVGTTNIVSWNNLTRWPIETRNVLLMIVGTIAAVFFTVTCNLPAPFLKEYYLAGKTLHVKDVATGGLPTIFYLMLFNSAGFMTTMAAIVVLGWPLHFRTILLFLVTCVCIVYVIIVDELMPKLVVRLGKSSISSIALMWSLVLALIFFGISVLSLRKFTPSLCRFIQWLWAKRTI************
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFEEALRKDDHVDEVKLLLSKIPKLSDDVIRASSSSENNPLLTACEYGNHQVAKEIASRWPKLAMIKNQHGQTAVHTVAERGDVEMVQFLGKQNPESCLVEDNLSMIPLHRAAMNGQSVDVIRALVSICPESLEKLTSNQDTALHLAVKNSHLEAFQVLVKVSKIHNKEHVFNWKNEDGNTVLHLATFNKSIEIVKALALESSNSSSIMIRVNTLNKQGQTALEVCKANSEDSVFKEIGLILQEASARSPVQQSPQIAVGTTNIVSWNNLTRWPIETRNVLLMIVGTIAAVFFTVTCNLPAPFLKEYYLAGKTLHVKDVATGGLPTIFYLMLFNSAGFMTTMAAIVVLGWPLHFRTILLFLVTCVCIVYVIIVDELMPKLVVRLGKSSISSIALMWSLVLALIFFGISVLSLRKFTPSLCRFIQWLWAKRTIYQSNTGHQDLNA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query444 2.2.26 [Sep-21-2011]
Q6AWW5524 Ankyrin repeat-containing no no 0.479 0.406 0.288 8e-12
Q9ZU96532 Ankyrin repeat-containing no no 0.680 0.567 0.215 1e-09
Q9C7A2590 Ankyrin repeat-containing no no 0.475 0.357 0.285 2e-08
Q6P9K8 1431 Caskin-1 OS=Mus musculus yes no 0.389 0.120 0.275 8e-08
Q8WXD9 1431 Caskin-1 OS=Homo sapiens no no 0.389 0.120 0.275 9e-08
Q8VHK2 1430 Caskin-1 OS=Rattus norveg yes no 0.389 0.120 0.275 1e-07
Q6P6B7361 Ankyrin repeat domain-con no no 0.418 0.515 0.266 1e-07
O75762 1119 Transient receptor potent no no 0.351 0.139 0.261 2e-07
Q810B61169 Ankyrin repeat and FYVE d no no 0.385 0.146 0.271 4e-07
B2RXR6993 Serine/threonine-protein no no 0.448 0.200 0.257 5e-07
>sp|Q6AWW5|Y5262_ARATH Ankyrin repeat-containing protein At5g02620 OS=Arabidopsis thaliana GN=At5g02620 PE=1 SV=1 Back     alignment and function desciption
 Score = 72.0 bits (175), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 68/236 (28%), Positives = 115/236 (48%), Gaps = 23/236 (9%)

Query: 11  HVDEVKLLLSKIPKLSDDVIRASSSSEN--NPLLTACEYGNHQVAKEIASRWPKLAMIKN 68
           + D VK+L+    K SD V+ A + ++N  +    A + GN QV   +    P+L+   +
Sbjct: 68  YTDMVKILM----KHSDSVL-AGTKAKNGFDAFHIAAKNGNLQVLDVLIEANPELSFTFD 122

Query: 69  QHGQTAVHTVAERGDVEMVQFLGKQNPESCLVEDNLSMIPLHRAAMNGQSVDVIRALVSI 128
               TA+HT A +G  E+V FL  +  +   +  +     LH AA NG +V +++ L+  
Sbjct: 123 SSKTTALHTAASQGHGEIVCFLLDKGVDLAAIARSNGKTALHSAARNGHTV-IVKKLIEK 181

Query: 129 CPESLEKLTSNQDTALHLAVKNSHLEAFQVLVKVSKIHNKEHVFNWKNEDGNTVLHLATF 188
               + ++     TALH+AVK  + E   VL++         + N  +  GNT LH+A  
Sbjct: 182 KAGMVTRVDKKGQTALHMAVKGQNTEIVDVLMEADG-----SLINSADNKGNTPLHIAVR 236

Query: 189 NKSIEIVKALALESSNSSSIMIRVNTLNKQGQTALEVCKANSEDSVFKEIGLILQE 244
               EIV+ + L+    S + +     NK G+TAL++    +E +   EI  +LQ+
Sbjct: 237 KNRAEIVQTV-LKYCEVSRVAV-----NKSGETALDI----AEKTGLHEIVPLLQK 282

Arabidopsis thaliana (taxid: 3702)
>sp|Q9ZU96|Y2168_ARATH Ankyrin repeat-containing protein At2g01680 OS=Arabidopsis thaliana GN=At2g01680 PE=1 SV=1 Back     alignment and function description
>sp|Q9C7A2|Y3236_ARATH Ankyrin repeat-containing protein At3g12360 OS=Arabidopsis thaliana GN=At3g12360 PE=2 SV=1 Back     alignment and function description
>sp|Q6P9K8|CSKI1_MOUSE Caskin-1 OS=Mus musculus GN=Caskin1 PE=1 SV=2 Back     alignment and function description
>sp|Q8WXD9|CSKI1_HUMAN Caskin-1 OS=Homo sapiens GN=CASKIN1 PE=1 SV=1 Back     alignment and function description
>sp|Q8VHK2|CSKI1_RAT Caskin-1 OS=Rattus norvegicus GN=Caskin1 PE=1 SV=1 Back     alignment and function description
>sp|Q6P6B7|ANR16_HUMAN Ankyrin repeat domain-containing protein 16 OS=Homo sapiens GN=ANKRD16 PE=1 SV=1 Back     alignment and function description
>sp|O75762|TRPA1_HUMAN Transient receptor potential cation channel subfamily A member 1 OS=Homo sapiens GN=TRPA1 PE=2 SV=3 Back     alignment and function description
>sp|Q810B6|ANFY1_MOUSE Ankyrin repeat and FYVE domain-containing protein 1 OS=Mus musculus GN=Ankfy1 PE=2 SV=2 Back     alignment and function description
>sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query444
255539875430 ankyrin repeat-containing protein, putat 0.903 0.932 0.378 1e-65
255539879315 protein binding protein, putative [Ricin 0.650 0.917 0.382 7e-41
224136414459 predicted protein [Populus trichocarpa] 0.858 0.830 0.286 6e-32
224114660448 predicted protein [Populus trichocarpa] 0.801 0.794 0.289 5e-31
343887311473 ankyrin repeat family protein [Citrus un 0.840 0.788 0.272 8e-30
359490025450 PREDICTED: LOW QUALITY PROTEIN: ankyrin 0.707 0.697 0.302 1e-27
225447366462 PREDICTED: ankyrin repeat-containing pro 0.806 0.774 0.283 8e-26
343887300469 ankyrin repeat family protein [Citrus un 0.806 0.763 0.277 8e-25
343887301470 Ankyrin repeat family protein [Citrus un 0.734 0.693 0.281 1e-24
255560685525 ankyrin repeat-containing protein, putat 0.477 0.403 0.340 1e-24
>gi|255539875|ref|XP_002511002.1| ankyrin repeat-containing protein, putative [Ricinus communis] gi|223550117|gb|EEF51604.1| ankyrin repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  256 bits (655), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 160/423 (37%), Positives = 236/423 (55%), Gaps = 22/423 (5%)

Query: 4   EALRKDDHVDEVKLLLSKIPKLSDDVIRASSSSENNPLLTACEYGNHQVAKEIASRWPKL 63
           EA+R DD V+ V + L    +  +     S+  + NP L AC++G+ + A++IA  + + 
Sbjct: 11  EAVRNDD-VNLVSMYLLTCQEFFEATAAPSTYRDENPFLVACKHGSLRSAEQIARNYRQF 69

Query: 64  AMIKNQHGQTAVHTVAERGDVEMVQFLGKQNPESCLVEDNLSMIPLHRAAMNGQSVDVIR 123
             ++ Q G TA+H    RGD+ +V+ L K + E C  +D  SMIPL  A   G + +VI 
Sbjct: 70  LRVRYQEGYTALHLACSRGDLPLVELLLKLDSELCFEKDKFSMIPLQTAISFGYT-EVIS 128

Query: 124 ALVSICPESLEKLTSNQDTALHLAVKNSHLEAFQVLVKVSKIHNKEHVFNWKNEDGNTVL 183
            L++  PES+ KLT  ++T  HLA K+    AF+ L++  K   +EH+ + K+  GN VL
Sbjct: 129 TLIAARPESVRKLTPQRETLFHLAAKHHQSSAFEALLEEVKKLKQEHLLHRKDRQGNNVL 188

Query: 184 HLATFNKSIEIVKALALESSNSSSIMIRVNTLNKQGQTALEVCKANSEDSVFKEIGLILQ 243
           H+A  NK I IVK L      +   M+RVNTLNK+  TAL+V   NS+D   ++IG IL 
Sbjct: 189 HIAASNKLIGIVKLLL----PADRAMVRVNTLNKKRLTALDVYYQNSKDISTRDIGRILC 244

Query: 244 EASARSPVQQSPQIAVGTTNIVSWNNLTRWPIETRNVLLMIVGTIAAVFFTVTCNLPAPF 303
           EA      +  P  A             RW +ET+NV+L+++G I    FT  C+LP  F
Sbjct: 245 EAGGLEG-RSLPMRA-----------YIRWTLETKNVILVVLGIITGAAFTTVCSLPKSF 292

Query: 304 LK-EYYLAGKTLHVKDVATGGLPTIFYLMLFNSAGFMTTMAAIVVLGWPLHFRTILLFLV 362
           ++    + G   HV DV  GGLP IFYLM+FN+A  +  + AIVVL W L FR ++LF+ 
Sbjct: 293 VEGSNSIEGAEYHVTDVLFGGLPHIFYLMVFNTAILIVCVGAIVVLLWSLPFRPVVLFVT 352

Query: 363 TCVCIVYVIIVDELMPKLVVRLGKSSISSIALMWSLVLALIFFGISVLSLRKFTPSLCRF 422
             V IVY ++V+++MPK    +G   I S  L+    +A I FG   ++   F+  LCR 
Sbjct: 353 ISVGIVYCLLVNDIMPKFSFTIGNHRIFSFPLVALFAVAFICFG--AIAYYAFS-CLCRL 409

Query: 423 IQW 425
            +W
Sbjct: 410 TKW 412

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255539879|ref|XP_002511004.1| protein binding protein, putative [Ricinus communis] gi|223550119|gb|EEF51606.1| protein binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224136414|ref|XP_002326854.1| predicted protein [Populus trichocarpa] gi|222835169|gb|EEE73604.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224114660|ref|XP_002332335.1| predicted protein [Populus trichocarpa] gi|222832582|gb|EEE71059.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|343887311|dbj|BAK61857.1| ankyrin repeat family protein [Citrus unshiu] Back     alignment and taxonomy information
>gi|359490025|ref|XP_003634016.1| PREDICTED: LOW QUALITY PROTEIN: ankyrin repeat-containing protein At2g01680-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|225447366|ref|XP_002274771.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|343887300|dbj|BAK61846.1| ankyrin repeat family protein [Citrus unshiu] Back     alignment and taxonomy information
>gi|343887301|dbj|BAK61847.1| Ankyrin repeat family protein [Citrus unshiu] Back     alignment and taxonomy information
>gi|255560685|ref|XP_002521356.1| ankyrin repeat-containing protein, putative [Ricinus communis] gi|223539434|gb|EEF41024.1| ankyrin repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query444
TAIR|locus:2176252442 AT5G51160 "AT5G51160" [Arabido 0.423 0.425 0.353 4.3e-21
TAIR|locus:2172099431 AT5G54620 [Arabidopsis thalian 0.691 0.712 0.270 6.1e-19
TAIR|locus:2172089426 ANK "ankyrin" [Arabidopsis tha 0.459 0.478 0.304 1.2e-18
TAIR|locus:2128781677 AT4G03460 "AT4G03460" [Arabido 0.590 0.387 0.280 6.6e-17
TAIR|locus:2129685694 AT4G14390 "AT4G14390" [Arabido 0.612 0.391 0.240 5.2e-15
TAIR|locus:2180882457 AT5G15500 [Arabidopsis thalian 0.851 0.827 0.242 5.3e-14
WB|WBGene00185078240 F40G9.17 [Caenorhabditis elega 0.378 0.7 0.292 6e-14
TAIR|locus:2129690670 ACD6 "AT4G14400" [Arabidopsis 0.612 0.405 0.245 9.2e-14
TAIR|locus:2132711445 AT4G10720 "AT4G10720" [Arabido 0.461 0.460 0.264 1.1e-13
TAIR|locus:2045233662 AT2G31820 [Arabidopsis thalian 0.488 0.327 0.305 1.5e-13
TAIR|locus:2176252 AT5G51160 "AT5G51160" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 255 (94.8 bits), Expect = 4.3e-21, Sum P(2) = 4.3e-21
 Identities = 70/198 (35%), Positives = 111/198 (56%)

Query:    68 NQHGQTAVHTVAERGDVEMVQF-LGKQNPESCLVEDNLSMIPLHRAAMNGQSVDVIRALV 126
             +++G + +H  A  G VE V+  LG +  + C ++D     PLH A M G+ +DVIR +V
Sbjct:    44 DKNGFSPLHAAAAAGQVETVRATLGVEK-KLCRLKDRDGKTPLHVATMRGK-IDVIREIV 101

Query:   127 SICPESLEKLTSNQDTALHLAVKNSHLEAFQVLVKVSKIHNKEHVFNWKNEDGNTVLHLA 186
             + C + LE  T    TALHLAV +  +EA   +V++    N+  V N K+E GNT LHLA
Sbjct:   102 ASCVDCLEDETVQGQTALHLAVLHLEIEAVIAIVELITETNRFDVLNKKDEQGNTALHLA 161

Query:   187 TFNKSIEIVKALALESSNSSSIMIRVNTLNKQGQTALEVCKANSEDSVFKEIGLILQEAS 246
             T+ K+ ++++ L +++    S    VN +NK G +A+++      ++  +EI   L EA 
Sbjct:   162 TWRKNRQVIEVL-VQAIPEESRSFEVNAMNKMGLSAMDLLVMFPSEAGDREIYEKLIEAG 220

Query:   247 ARSPVQQSPQIAVGTTNI 264
             A    Q+   I  GTTN+
Sbjct:   221 A----QRGRDI--GTTNV 232
GO:0005575 "cellular_component" evidence=ND
GO:0008150 "biological_process" evidence=ND
GO:0006826 "iron ion transport" evidence=RCA
GO:0010043 "response to zinc ion" evidence=RCA
GO:0010106 "cellular response to iron ion starvation" evidence=RCA
GO:0010167 "response to nitrate" evidence=RCA
GO:0015706 "nitrate transport" evidence=RCA
TAIR|locus:2172099 AT5G54620 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2172089 ANK "ankyrin" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2128781 AT4G03460 "AT4G03460" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2129685 AT4G14390 "AT4G14390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2180882 AT5G15500 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
WB|WBGene00185078 F40G9.17 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
TAIR|locus:2129690 ACD6 "AT4G14400" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2132711 AT4G10720 "AT4G10720" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2045233 AT2G31820 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query444
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 9e-19
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 1e-15
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 5e-15
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 1e-12
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 3e-09
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 4e-09
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 1e-06
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 1e-06
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 1e-06
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 4e-06
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 5e-06
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 8e-06
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 8e-05
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 4e-04
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 5e-04
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 0.001
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 0.002
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information 
 Score = 81.7 bits (202), Expect = 9e-19
 Identities = 40/133 (30%), Positives = 70/133 (52%), Gaps = 9/133 (6%)

Query: 66  IKNQHGQTAVHTVAERGDVEMVQFLGKQNPESCLVEDNLSMIPLHRAAMNGQSVDVIRAL 125
            +++ G+T +H  A  G +E+V+ L +   +     DN    PLH AA NG  +++++ L
Sbjct: 2   ARDEDGRTPLHLAASNGHLEVVKLLLENGADVNAK-DNDGRTPLHLAAKNGH-LEIVKLL 59

Query: 126 VSICPESLEKLTSNQDTALHLAVKNSHLEAFQVLVKVSKIHNKEHVFNWKNEDGNTVLHL 185
           +      +     + +T LHLA +N +L+  ++L+K     N       +++DG T LHL
Sbjct: 60  LEKGA-DVNARDKDGNTPLHLAARNGNLDVVKLLLKHGADVNA------RDKDGRTPLHL 112

Query: 186 ATFNKSIEIVKAL 198
           A  N  +E+VK L
Sbjct: 113 AAKNGHLEVVKLL 125

The number of ANK repeats in a protein can range from 2 to over 20 (ankyrins, for example). ANK repeats may occur in combinations with other types of domains. The structural repeat unit contains two antiparallel helices and a beta-hairpin, repeats are stacked in a superhelical arrangement; this alignment contains 4 consecutive repeats. Length = 126
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 444
KOG4412226 consensus 26S proteasome regulatory complex, subun 100.0
PHA02791284 ankyrin-like protein; Provisional 100.0
PHA02875413 ankyrin repeat protein; Provisional 100.0
KOG4412226 consensus 26S proteasome regulatory complex, subun 100.0
PHA02791284 ankyrin-like protein; Provisional 100.0
PHA02874434 ankyrin repeat protein; Provisional 100.0
PHA02874434 ankyrin repeat protein; Provisional 100.0
PHA03100480 ankyrin repeat protein; Provisional 100.0
PHA02878477 ankyrin repeat protein; Provisional 100.0
PHA03100480 ankyrin repeat protein; Provisional 100.0
PHA02946446 ankyin-like protein; Provisional 100.0
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 100.0
PHA02716764 CPXV016; CPX019; EVM010; Provisional 99.98
PHA03095471 ankyrin-like protein; Provisional 99.98
KOG0510 929 consensus Ankyrin repeat protein [General function 99.98
PHA03095471 ankyrin-like protein; Provisional 99.98
PHA02875413 ankyrin repeat protein; Provisional 99.98
PHA02946446 ankyin-like protein; Provisional 99.97
PHA02989494 ankyrin repeat protein; Provisional 99.97
PHA02876682 ankyrin repeat protein; Provisional 99.97
PHA02798489 ankyrin-like protein; Provisional 99.97
KOG0510 929 consensus Ankyrin repeat protein [General function 99.97
PHA02878477 ankyrin repeat protein; Provisional 99.97
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 99.97
PHA02876682 ankyrin repeat protein; Provisional 99.97
PHA02859209 ankyrin repeat protein; Provisional 99.96
PHA02989494 ankyrin repeat protein; Provisional 99.96
KOG0508 615 consensus Ankyrin repeat protein [General function 99.96
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.95
PHA02859209 ankyrin repeat protein; Provisional 99.95
PHA02917 661 ankyrin-like protein; Provisional 99.95
PHA02795437 ankyrin-like protein; Provisional 99.95
PHA02917 661 ankyrin-like protein; Provisional 99.94
PHA02798489 ankyrin-like protein; Provisional 99.94
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 99.94
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 99.94
PHA02795437 ankyrin-like protein; Provisional 99.93
KOG0508 615 consensus Ankyrin repeat protein [General function 99.93
PHA02730672 ankyrin-like protein; Provisional 99.93
PHA02792631 ankyrin-like protein; Provisional 99.93
PLN03192823 Voltage-dependent potassium channel; Provisional 99.93
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.92
PHA02730 672 ankyrin-like protein; Provisional 99.92
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.91
PF13962113 PGG: Domain of unknown function 99.9
KOG0514452 consensus Ankyrin repeat protein [General function 99.9
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.9
PLN03192823 Voltage-dependent potassium channel; Provisional 99.9
KOG0505527 consensus Myosin phosphatase, regulatory subunit [ 99.89
PHA02792631 ankyrin-like protein; Provisional 99.89
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.89
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.87
KOG0514452 consensus Ankyrin repeat protein [General function 99.87
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.87
PHA02741169 hypothetical protein; Provisional 99.85
PHA02743166 Viral ankyrin protein; Provisional 99.85
PHA02743166 Viral ankyrin protein; Provisional 99.85
PHA02741169 hypothetical protein; Provisional 99.83
PHA02736154 Viral ankyrin protein; Provisional 99.83
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.82
PHA02884300 ankyrin repeat protein; Provisional 99.82
KOG0505527 consensus Myosin phosphatase, regulatory subunit [ 99.8
PHA02736154 Viral ankyrin protein; Provisional 99.8
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.8
PHA02884300 ankyrin repeat protein; Provisional 99.8
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.8
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.79
KOG0195448 consensus Integrin-linked kinase [Signal transduct 99.78
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.74
KOG0195448 consensus Integrin-linked kinase [Signal transduct 99.73
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.69
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.68
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.68
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.68
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.63
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.56
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.5
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.48
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.44
KOG1710396 consensus MYND Zn-finger and ankyrin repeat protei 99.39
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.39
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.37
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.33
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.32
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.3
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.3
KOG1710396 consensus MYND Zn-finger and ankyrin repeat protei 99.28
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.28
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.21
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.87
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.69
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.68
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.64
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 98.62
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.54
KOG0522560 consensus Ankyrin repeat protein [General function 98.53
KOG0522 560 consensus Ankyrin repeat protein [General function 98.52
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.51
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.51
PF1360630 Ank_3: Ankyrin repeat 98.49
KOG0818669 consensus GTPase-activating proteins of the GIT fa 98.48
PF1360630 Ank_3: Ankyrin repeat 98.46
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.42
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.35
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.3
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 98.24
KOG0520975 consensus Uncharacterized conserved protein, conta 98.17
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 98.1
KOG0521785 consensus Putative GTPase activating proteins (GAP 98.02
KOG0520975 consensus Uncharacterized conserved protein, conta 97.89
KOG0511516 consensus Ankyrin repeat protein [General function 97.89
KOG0521785 consensus Putative GTPase activating proteins (GAP 97.84
KOG2384223 consensus Major histocompatibility complex protein 97.77
KOG0511516 consensus Ankyrin repeat protein [General function 97.69
KOG2384223 consensus Major histocompatibility complex protein 97.47
KOG2505591 consensus Ankyrin repeat protein [General function 96.74
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 96.42
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 95.97
KOG2505591 consensus Ankyrin repeat protein [General function 95.89
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 93.47
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 90.0
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 89.01
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 88.38
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 83.94
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 83.85
cd07920322 Pumilio Pumilio-family RNA binding domain. Puf rep 82.23
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=1e-36  Score=252.58  Aligned_cols=205  Identities=21%  Similarity=0.242  Sum_probs=183.6

Q ss_pred             hhHHhhcCCcHHHHHHHHhcCCCCchHHhhhcCCCCChHHHHHHhcCCHHHHHHHHhhCCcccccccCCCChHHHHHHHC
Q 013369            2 FEEALRKDDHVDEVKLLLSKIPKLSDDVIRASSSSENNPLLTACEYGNHQVAKEIASRWPKLAMIKNQHGQTAVHTVAER   81 (444)
Q Consensus         2 L~~A~~~g~~~~~v~~Ll~~~~~~~~~~~~~~d~~g~t~Lh~Aa~~g~~~~v~~Ll~~~~~~~~~~d~~G~tpLh~Aa~~   81 (444)
                      .+.+++... ...|+.+++..++   +.+...|.+|+||||+||..|+.+++++|++.....++.+|..||||||.||+.
T Consensus         7 ~~~~~~~~~-~~kveel~~s~~k---SL~~r~dqD~Rt~LHwa~S~g~~eiv~fLlsq~nv~~ddkDdaGWtPlhia~s~   82 (226)
T KOG4412|consen    7 GKAICENCE-EFKVEELIQSDPK---SLNARDDQDGRTPLHWACSFGHVEIVYFLLSQPNVKPDDKDDAGWTPLHIAASN   82 (226)
T ss_pred             HHHHHhhch-HHHHHHHHhcChh---hhhccccccCCceeeeeeecCchhHHHHHHhcCCCCCCCccccCCchhhhhhhc
Confidence            456667777 8899999999883   233334458999999999999999999999755445677899999999999999


Q ss_pred             CCHHHHHHHhhc-CCCCccccCCCCCCHHHHHHHcCCcHHHHHHHHHhCcchhhccccCCCCHHHHHHHcCCHHHHHHHH
Q 013369           82 GDVEMVQFLGKQ-NPESCLVEDNLSMIPLHRAAMNGQSVDVIRALVSICPESLEKLTSNQDTALHLAVKNSHLEAFQVLV  160 (444)
Q Consensus        82 g~~~~v~~Ll~~-~~~~~~~~d~~g~tpLh~Aa~~g~~~~~v~~Ll~~~~~~~~~~d~~g~t~Lh~A~~~g~~~iv~~Ll  160 (444)
                      |+.++|+.|+.+ ++++ +..++.|.|+||+|+..|. .|++.+|++++ ..+..+|+.|.||||-|+.-|..+++++|+
T Consensus        83 g~~evVk~Ll~r~~adv-na~tn~G~T~LHyAagK~r-~eIaqlLle~g-a~i~~kD~~~qtplHRAAavGklkvie~Li  159 (226)
T KOG4412|consen   83 GNDEVVKELLNRSGADV-NATTNGGQTCLHYAAGKGR-LEIAQLLLEKG-ALIRIKDKQGQTPLHRAAAVGKLKVIEYLI  159 (226)
T ss_pred             CcHHHHHHHhcCCCCCc-ceecCCCcceehhhhcCCh-hhHHHHHHhcC-CCCcccccccCchhHHHHhccchhhHHHHH
Confidence            999999999999 7777 7899999999999999999 99999999985 779999999999999999999999999999


Q ss_pred             HhcccccccccccccCCCCCcHHHHHHhcCCHHHHHHHHhccCCCccccccccccccCCCCHHHHHH
Q 013369          161 KVSKIHNKEHVFNWKNEDGNTVLHLATFNKSIEIVKALALESSNSSSIMIRVNTLNKQGQTALEVCK  227 (444)
Q Consensus       161 ~~~~~~~~~~~~~~~d~~G~T~Lh~A~~~~~~~iv~~Ll~~ga~~~~~~v~~~~~n~~G~T~L~~A~  227 (444)
                      .      .++.+|.+|+.|+||||.|..-++.++..+|+++|++       ++..|++| ||+-.++
T Consensus       160 ~------~~a~~n~qDk~G~TpL~~al~e~~~d~a~lLV~~gAd-------~~~edke~-t~~~~a~  212 (226)
T KOG4412|consen  160 S------QGAPLNTQDKYGFTPLHHALAEGHPDVAVLLVRAGAD-------TDREDKEG-TALRIAC  212 (226)
T ss_pred             h------cCCCCCcccccCccHHHHHHhccCchHHHHHHHhccc-------eeeccccC-chHHHHH
Confidence            8      6678999999999999999888999999999999988       89999999 9988874

>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>PF13962 PGG: Domain of unknown function Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>cd07920 Pumilio Pumilio-family RNA binding domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query444
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 2e-09
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 5e-06
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 1e-08
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 2e-08
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 1e-07
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 4e-07
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 2e-06
2l6b_A115 Nrc Consensus Ankyrin Repeat Protein Solution Struc 2e-06
2dzn_A228 Crystal Structure Analysis Of Yeast Nas6p Complexed 5e-06
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 5e-06
1ixv_A231 Crystal Structure Analysis Of Homolog Of Oncoprotei 6e-06
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 6e-06
1wg0_A243 Structural Comparison Of Nas6p Protein Structures I 6e-06
2xeh_A157 Structural Determinants For Improved Thermal Stabil 7e-06
2bkg_A166 Crystal Structure Of E3_19 An Designed Ankyrin Repe 3e-05
2xee_A157 Structural Determinants For Improved Thermal Stabil 6e-05
2v5q_C167 Crystal Structure Of Wild-type Plk-1 Kinase Domain 6e-05
3q9u_C158 In Silico And In Vitro Co-Evolution Of A High Affin 9e-05
3b7b_A237 Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le 9e-05
3c5r_A137 Crystal Structure Of The Bard1 Ankyrin Repeat Domai 1e-04
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 2e-04
2v4h_C136 Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 2e-04
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 2e-04
3zuv_B136 Crystal Structure Of A Designed Selected Ankyrin Re 2e-04
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 2e-04
1qym_A227 X-Ray Structure Of Human Gankyrin Length = 227 3e-04
1uoh_A226 Human Gankyrin Length = 226 3e-04
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 4e-04
1nfi_E213 I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 4e-04
1n11_A437 D34 Region Of Human Ankyrin-R And Linker Length = 4 4e-04
3noc_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 4e-04
2bkk_B169 Crystal Structure Of Aminoglycoside Phosphotransfer 5e-04
1ikn_D236 IkappabalphaNF-Kappab Complex Length = 236 8e-04
4b93_B269 Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyri 9e-04
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure 
Iteration: 1

 Score = 60.1 bits (144), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 43/129 (33%), Positives = 68/129 (52%), Gaps = 9/129 (6%)
Query: 70  HGQTAVHTVAERGDVEMVQFLGKQNPESCLVEDNLSMIPLHRAAMNGQSVDVIRALVSIC 129
           +G+T +H  A  G +E+V+ L +   +    +D     PLH AA NG  ++V++ L+   
Sbjct: 1   NGRTPLHLAARNGHLEVVKLLLEAGAD-VNAKDKNGRTPLHLAARNGH-LEVVKLLLEAG 58
Query: 130 PESLEKLTSNQDTALHLAVKNSHLEAFQVLVKVSKIHNKEHVFNWKNEDGNTVLHLATFN 189
            +   K   N  T LHLA +N HLE  ++L++           N K+++G T LHLA  N
Sbjct: 59  ADVNAK-DKNGRTPLHLAARNGHLEVVKLLLEAGAD------VNAKDKNGRTPLHLAARN 111
Query: 190 KSIEIVKAL 198
             +E+VK L
Sbjct: 112 GHLEVVKLL 120
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 Back     alignment and structure
>pdb|2DZN|A Chain A, Crystal Structure Analysis Of Yeast Nas6p Complexed With The Proteasome Subunit, Rpt3 Length = 228 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|1IXV|A Chain A, Crystal Structure Analysis Of Homolog Of Oncoprotein Gankyrin, An Interactor Of Rb And Cdk46 Length = 231 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|1WG0|A Chain A, Structural Comparison Of Nas6p Protein Structures In Two Different Crystal Forms Length = 243 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 Back     alignment and structure
>pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 Back     alignment and structure
>pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 Back     alignment and structure
>pdb|3C5R|A Chain A, Crystal Structure Of The Bard1 Ankyrin Repeat Domain And Its Functional Consequences Length = 137 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 Back     alignment and structure
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure
>pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 Back     alignment and structure
>pdb|1UOH|A Chain A, Human Gankyrin Length = 226 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|1NFI|E Chain E, I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 Back     alignment and structure
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure
>pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 Back     alignment and structure
>pdb|1IKN|D Chain D, IkappabalphaNF-Kappab Complex Length = 236 Back     alignment and structure
>pdb|4B93|B Chain B, Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyrin Repeat Domain Of Varp Length = 269 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query444
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 2e-24
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 3e-20
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 4e-19
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 9e-18
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 1e-11
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 2e-04
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 2e-24
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 5e-20
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 2e-18
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 5e-15
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 3e-10
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 1e-05
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 9e-24
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 6e-23
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-22
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-22
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 8e-20
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-05
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 3e-23
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 6e-23
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 3e-23
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 9e-22
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 9e-21
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 5e-18
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-17
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 9e-05
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 7e-23
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 7e-22
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 1e-19
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 6e-16
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-10
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 9e-23
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 3e-16
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 4e-13
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 2e-06
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 1e-22
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 4e-19
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-12
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 1e-22
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 8e-22
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 2e-20
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 5e-18
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 4e-05
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-22
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-20
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 3e-18
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 5e-11
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 3e-22
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 4e-19
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 1e-16
3v30_A172 DNA-binding protein rfxank; structural genomics co 8e-22
3v30_A172 DNA-binding protein rfxank; structural genomics co 5e-19
3v30_A172 DNA-binding protein rfxank; structural genomics co 3e-17
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 9e-22
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-20
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 6e-20
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 3e-15
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 9e-13
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 5e-21
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 1e-17
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 5e-21
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-17
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-16
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-15
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-09
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 4e-08
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 6e-21
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-20
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 5e-14
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-20
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-17
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 8e-15
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 3e-13
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-20
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 5e-19
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 5e-17
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 1e-13
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 3e-20
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 5e-20
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 2e-12
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 3e-20
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 2e-15
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 2e-12
3hra_A201 Ankyrin repeat family protein; structural protein; 5e-20
3hra_A201 Ankyrin repeat family protein; structural protein; 8e-20
3hra_A201 Ankyrin repeat family protein; structural protein; 4e-19
3hra_A201 Ankyrin repeat family protein; structural protein; 1e-12
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 6e-20
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 4e-16
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 5e-13
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 7e-04
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 8e-20
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 4e-10
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 7e-05
3v31_A167 Ankyrin repeat family A protein 2; structural geno 8e-20
3v31_A167 Ankyrin repeat family A protein 2; structural geno 5e-19
3v31_A167 Ankyrin repeat family A protein 2; structural geno 1e-13
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 8e-20
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 3e-17
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 3e-11
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 1e-19
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 8e-19
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 1e-13
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-19
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-18
2pnn_A273 Transient receptor potential cation channel subfa 4e-19
2pnn_A273 Transient receptor potential cation channel subfa 2e-17
2pnn_A273 Transient receptor potential cation channel subfa 2e-15
2pnn_A273 Transient receptor potential cation channel subfa 5e-08
2etb_A256 Transient receptor potential cation channel subfam 9e-19
2etb_A256 Transient receptor potential cation channel subfam 9e-16
2etb_A256 Transient receptor potential cation channel subfam 1e-13
2etb_A256 Transient receptor potential cation channel subfam 5e-09
2etb_A256 Transient receptor potential cation channel subfam 2e-04
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 1e-18
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 3e-17
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-09
2rfa_A232 Transient receptor potential cation channel subfa 2e-18
2rfa_A232 Transient receptor potential cation channel subfa 5e-18
2rfa_A232 Transient receptor potential cation channel subfa 4e-16
2rfa_A232 Transient receptor potential cation channel subfa 5e-12
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 2e-18
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 4e-11
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-18
1awc_B153 Protein (GA binding protein beta 1); complex (tran 1e-17
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 3e-18
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 3e-17
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 7e-17
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-15
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 4e-11
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 9e-08
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 5e-18
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 2e-17
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 3e-07
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 9e-07
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 5e-18
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 2e-12
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 9e-10
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 1e-17
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 3e-14
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 1e-12
3jxi_A260 Vanilloid receptor-related osmotically activated p 2e-17
3jxi_A260 Vanilloid receptor-related osmotically activated p 8e-12
3deo_A183 Signal recognition particle 43 kDa protein; chloro 3e-17
3deo_A183 Signal recognition particle 43 kDa protein; chloro 3e-11
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 1e-15
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 4e-12
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 2e-11
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 2e-15
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 2e-13
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 2e-08
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 3e-15
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 1e-14
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 9e-09
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 4e-05
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 3e-15
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 3e-13
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 3e-10
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 4e-15
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 9e-12
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 3e-10
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 7e-06
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 1e-04
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 1e-13
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 4e-13
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 8e-04
1sw6_A327 Regulatory protein SWI6; transcription regulation, 6e-13
1sw6_A327 Regulatory protein SWI6; transcription regulation, 1e-11
1sw6_A327 Regulatory protein SWI6; transcription regulation, 1e-08
1sw6_A327 Regulatory protein SWI6; transcription regulation, 5e-08
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 2e-12
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 8e-11
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 5e-10
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 1e-07
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 2e-11
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 1e-08
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 3e-05
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 5e-09
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 1e-08
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 2e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-08
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 2e-06
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 5e-05
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 2e-06
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 5e-06
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 1e-04
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
 Score =  100 bits (251), Expect = 2e-24
 Identities = 41/191 (21%), Positives = 77/191 (40%), Gaps = 18/191 (9%)

Query: 11  HVDEVKLLLSKIPKLSDDVIRASSSSENNPLLTACEYGNHQVAKEIASRWPKLAMIKNQH 70
            +D VK  +SK       V +      + PL  A   G+  +  ++         + +  
Sbjct: 54  RIDLVKYYISK----GAIVDQLGGDLNSTPLHWATRQGHLSMVVQLMKYGADP-SLIDGE 108

Query: 71  GQTAVHTVAERGDVEMVQFLGKQ--NPESCLVEDNLSMIPLHRAAMNGQSVDVIRALVSI 128
           G + +H  A+ G   +V +L  +  + +     D   M PL  AA    SVD  R L++ 
Sbjct: 109 GCSCIHLAAQFGHTSIVAYLIAKGQDVDM---MDQNGMTPLMWAAYRTHSVDPTRLLLTF 165

Query: 129 CPESLEKLTSNQDTALHLAVKNSHLEAFQVLVKV-SKIHNKEHVFNWKNEDGNTVLHLAT 187
                     +++TALH AV   +     +L++  + +       + +N  G + L LA 
Sbjct: 166 NVSVNLGDKYHKNTALHWAVLAGNTTVISLLLEAGANV-------DAQNIKGESALDLAK 218

Query: 188 FNKSIEIVKAL 198
             K++ ++  L
Sbjct: 219 QRKNVWMINHL 229
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query444
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 100.0
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 100.0
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 100.0
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 100.0
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 100.0
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
3hra_A201 Ankyrin repeat family protein; structural protein; 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 100.0
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 100.0
2rfa_A232 Transient receptor potential cation channel subfa 100.0
2rfa_A232 Transient receptor potential cation channel subfa 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 100.0
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 100.0
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 100.0
3hra_A201 Ankyrin repeat family protein; structural protein; 100.0
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 100.0
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 100.0
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 100.0
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
4gpm_A169 Engineered protein OR264; de novo protein, structu 100.0
2pnn_A273 Transient receptor potential cation channel subfa 100.0
2etb_A256 Transient receptor potential cation channel subfam 99.98
2etb_A256 Transient receptor potential cation channel subfam 99.98
2pnn_A273 Transient receptor potential cation channel subfa 99.98
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.97
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.97
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.97
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.97
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 99.97
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.97
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.97
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.97
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.97
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.96
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.96
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.96
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.96
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.96
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.96
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.96
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.96
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.96
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.96
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.96
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.96
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.95
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.95
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.95
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.95
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.95
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.95
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.94
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.94
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.94
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.93
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.92
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.92
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.92
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.92
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.92
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.92
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.91
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.91
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.9
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.9
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.9
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.9
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.88
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.88
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.88
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.88
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.87
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.87
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.87
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.87
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.86
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.86
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.86
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.84
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.83
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.83
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.83
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.82
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.8
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.8
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.8
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.78
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.78
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.71
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.67
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
Probab=100.00  E-value=3.5e-38  Score=289.16  Aligned_cols=222  Identities=21%  Similarity=0.232  Sum_probs=203.8

Q ss_pred             ChhHHhhcCCcHHHHHHHHhcCCCCchHHhhhcCCCCChHHHHHHhcCCHHHHHHHHhhCCcccccccCCCChHHHHHHH
Q 013369            1 MFEEALRKDDHVDEVKLLLSKIPKLSDDVIRASSSSENNPLLTACEYGNHQVAKEIASRWPKLAMIKNQHGQTAVHTVAE   80 (444)
Q Consensus         1 ~L~~A~~~g~~~~~v~~Ll~~~~~~~~~~~~~~d~~g~t~Lh~Aa~~g~~~~v~~Ll~~~~~~~~~~d~~G~tpLh~Aa~   80 (444)
                      |||.|++.|+ .+.++.+++.++..    .+..|..|.||||+|+..|+.+++++|++.+.+ ++..|..|+||||+|+.
T Consensus         9 ~l~~A~~~g~-~~~v~~ll~~~~~~----~~~~~~~g~t~L~~A~~~g~~~~v~~Ll~~g~~-~~~~~~~g~t~L~~A~~   82 (231)
T 3aji_A            9 MICNLAYSGK-LDELKERILADKSL----ATRTDQDSRTALHWACSAGHTEIVEFLLQLGVP-VNDKDDAGWSPLHIAAS   82 (231)
T ss_dssp             HHHHHHHHTC-HHHHHHHHHHCGGG----GGCCCTTSCCHHHHHHHHTCHHHHHHHHHTTCC-SCCCCTTSCCHHHHHHH
T ss_pred             hHHHHHHhCC-HHHHHHHHHhchhh----hhcCCCCCCCHHHHHHHcCcHHHHHHHHHhCCC-CCCcCCCCCCHHHHHHH
Confidence            5899999999 99999999987653    455668899999999999999999999999987 67889999999999999


Q ss_pred             CCCHHHHHHHhhcCCCCccccCCCCCCHHHHHHHcCCcHHHHHHHHHhCcchhhccccCCCCHHHHHHHcCCHHHHHHHH
Q 013369           81 RGDVEMVQFLGKQNPESCLVEDNLSMIPLHRAAMNGQSVDVIRALVSICPESLEKLTSNQDTALHLAVKNSHLEAFQVLV  160 (444)
Q Consensus        81 ~g~~~~v~~Ll~~~~~~~~~~d~~g~tpLh~Aa~~g~~~~~v~~Ll~~~~~~~~~~d~~g~t~Lh~A~~~g~~~iv~~Ll  160 (444)
                      .|+.+++++|++++.++ +.+|..|.||||+|+..|+ .+++++|++.+ .+++..|..|.||||+|+..|+.+++++|+
T Consensus        83 ~~~~~~v~~Ll~~g~~~-~~~~~~g~t~L~~A~~~~~-~~~~~~Ll~~g-~~~~~~~~~g~t~L~~A~~~~~~~~v~~Ll  159 (231)
T 3aji_A           83 AGXDEIVKALLVKGAHV-NAVNQNGCTPLHYAASKNR-HEIAVMLLEGG-ANPDAKDHYDATAMHRAAAKGNLKMVHILL  159 (231)
T ss_dssp             HTCHHHHHHHHHTTCCT-TCCCTTSCCHHHHHHHTTC-HHHHHHHHHTT-CCTTCCCTTSCCHHHHHHHHTCHHHHHHHH
T ss_pred             cCHHHHHHHHHHcCCCC-CCCCCCCCCHHHHHHHcCC-HHHHHHHHHcC-CCCCCcCCCCCcHHHHHHHcCCHHHHHHHH
Confidence            99999999999999998 6889999999999999999 99999999984 557888999999999999999999999999


Q ss_pred             HhcccccccccccccCCCCCcHHHHHHhcCCHHHHHHHHhccCCCccccccccccccCCCCHHHHHHHcCCchhHHHHHH
Q 013369          161 KVSKIHNKEHVFNWKNEDGNTVLHLATFNKSIEIVKALALESSNSSSIMIRVNTLNKQGQTALEVCKANSEDSVFKEIGL  240 (444)
Q Consensus       161 ~~~~~~~~~~~~~~~d~~G~T~Lh~A~~~~~~~iv~~Ll~~ga~~~~~~v~~~~~n~~G~T~L~~A~~~~~~~~~~~i~~  240 (444)
                      +      .+.+++.+|.+|+||||+|+..++.+++++|+++|++       ++.+|..|+||+++|...    ...++.+
T Consensus       160 ~------~g~~~~~~~~~g~t~L~~A~~~~~~~~v~~Ll~~ga~-------~~~~~~~g~t~l~~A~~~----~~~~i~~  222 (231)
T 3aji_A          160 F------YKASTNIQDTEGNTPLHLACDEERVEEAKFLVTQGAS-------IYIENKEEKTPLQVAKGG----LGLILKR  222 (231)
T ss_dssp             H------TTCCSCCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCC-------SCCCCTTSCCHHHHSCHH----HHHHHHH
T ss_pred             h------cCCCccccCCCCCCHHHHHHHCCCHHHHHHHHHCCCC-------CCCCCCCCCCHHHHHHhh----HHHHHHH
Confidence            9      5567788999999999999999999999999999887       899999999999999765    4788999


Q ss_pred             HHHHcCCC
Q 013369          241 ILQEASAR  248 (444)
Q Consensus       241 ~L~~~ga~  248 (444)
                      +|.+.|+.
T Consensus       223 lL~~~~a~  230 (231)
T 3aji_A          223 LAEGEEAS  230 (231)
T ss_dssp             HHHHHHHC
T ss_pred             HHcccccc
Confidence            99888764
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 444
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 8e-15
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 8e-14
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 5e-11
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 4e-09
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 1e-13
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 5e-13
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 2e-11
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 1e-08
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 2e-06
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 4e-12
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 3e-07
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 3e-04
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 8e-11
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 2e-09
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 1e-08
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 2e-07
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 4e-07
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 3e-05
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 4e-09
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 3e-07
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 1e-08
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 1e-06
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 4e-06
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 1e-05
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 0.003
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 3e-08
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 2e-07
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 5e-07
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 3e-06
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 2e-05
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 2e-04
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 0.002
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 7e-07
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-04
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 0.002
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 0.003
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 3e-06
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 7e-06
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 8e-06
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 8e-05
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 2e-04
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 8e-06
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 9e-05
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 2e-04
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 2e-04
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 4e-04
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 0.001
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 0.002
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 73.5 bits (179), Expect = 8e-15
 Identities = 39/188 (20%), Positives = 70/188 (37%), Gaps = 14/188 (7%)

Query: 38  NNPLLTACEYGNHQVAKEIASRWPKLAMIKNQHGQTAVHTVAERGDVEMVQFLGKQNPES 97
             PL  A + G+ ++   + S+      + N+ G T +H VA+ G V +   L K     
Sbjct: 232 VTPLHLAAQEGHAEMVALLLSKQANG-NLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMV 290

Query: 98  CLVEDNLSMIPLHRAAMNGQSVDVIRALVSICPESLEKLTSNQDTALHLAVKNSHLEAFQ 157
                 +   PLH A+  G    V    +      +   T    + LH A +  H +   
Sbjct: 291 D-ATTRMGYTPLHVASHYGNIKLVKF--LLQHQADVNAKTKLGYSPLHQAAQQGHTDIVT 347

Query: 158 VLVKVSKIHNKEHVFNWKNEDGNTVLHLATFNKSIEIVKALALESSNSSSIMIRVNTLNK 217
           +L+K           N  + DG T L +A     I +   L + +  +S +++     +K
Sbjct: 348 LLLK------NGASPNEVSSDGTTPLAIAKRLGYISVTDVLKVVTDETSFVLVS----DK 397

Query: 218 QGQTALEV 225
              +  E 
Sbjct: 398 HRMSFPET 405
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query444
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 100.0
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 100.0
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.98
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.98
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.97
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.97
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.97
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.96
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.96
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.96
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.96
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.96
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.96
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.95
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.94
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.94
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.94
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.93
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.93
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.93
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.93
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.92
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.92
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.92
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.92
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.92
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.88
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.87
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.86
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.86
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.86
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.85
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.85
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.84
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.83
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: 26S proteasome non-ATPase regulatory subunit 10, gankyrin
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=8.8e-36  Score=270.21  Aligned_cols=217  Identities=22%  Similarity=0.237  Sum_probs=196.2

Q ss_pred             ChhHHhhcCCcHHHHHHHHhcCCCCchHHhhhcCCCCChHHHHHHhcCCHHHHHHHHhhCCcccccccCCCChHHHHHHH
Q 013369            1 MFEEALRKDDHVDEVKLLLSKIPKLSDDVIRASSSSENNPLLTACEYGNHQVAKEIASRWPKLAMIKNQHGQTAVHTVAE   80 (444)
Q Consensus         1 ~L~~A~~~g~~~~~v~~Ll~~~~~~~~~~~~~~d~~g~t~Lh~Aa~~g~~~~v~~Ll~~~~~~~~~~d~~G~tpLh~Aa~   80 (444)
                      +|+.+|++|+ .+.|+.+++.++..    .+.+|..|+||||+||..|+.+++++|++.+.. ....+..+.++++.|+.
T Consensus         6 ~~~~~a~~G~-~~~v~~~l~~~~~~----~~~~D~~G~TpLh~Aa~~g~~e~~~~l~~~~~~-~~~~~~~~~~~~~~~~~   79 (223)
T d1uoha_           6 MVCNLAYSGK-LEELKESILADKSL----ATRTDQDSRTALHWACSAGHTEIVEFLLQLGVP-VNDKDDAGWSPLHIAAS   79 (223)
T ss_dssp             HHHHHHHTTC-HHHHHHHHHHCGGG----GGCCCTTSCCHHHHHHHHTCHHHHHHHHHHTCC-SCCCCTTCCCHHHHHHH
T ss_pred             HHHHHHHhCC-HHHHHHHHHhCCCc----CcCcCCCCCCHHHHHHHhhhhcccccccccccc-ccccccccccccccccc
Confidence            4788999999 99999999886643    566788999999999999999999999999877 44677789999999999


Q ss_pred             CCCHHHHHHHhhcCCCCccccCCCCCCHHHHHHHcCCcHHHHHHHHHhCcchhhccccCCCCHHHHHHHcCCHHHHHHHH
Q 013369           81 RGDVEMVQFLGKQNPESCLVEDNLSMIPLHRAAMNGQSVDVIRALVSICPESLEKLTSNQDTALHLAVKNSHLEAFQVLV  160 (444)
Q Consensus        81 ~g~~~~v~~Ll~~~~~~~~~~d~~g~tpLh~Aa~~g~~~~~v~~Ll~~~~~~~~~~d~~g~t~Lh~A~~~g~~~iv~~Ll  160 (444)
                      .|+.+++++|++++.++ +..|.+|.||||+|+..|+ .+++++|++++ .+++..|..|.||||+|+..++.+++++|.
T Consensus        80 ~~~~~i~~~Ll~~~~d~-~~~d~~g~tpL~~A~~~~~-~e~~~~Ll~~g-~d~~~~~~~~~t~L~~a~~~~~~~~~~~L~  156 (223)
T d1uoha_          80 AGRDEIVKALLGKGAQV-NAVNQNGCTPLHYAASKNR-HEIAVMLLEGG-ANPDAKDHYEATAMHRAAAKGNLKMIHILL  156 (223)
T ss_dssp             HTCHHHHHHHHHTTCCT-TCCCTTCCCHHHHHHHHTC-HHHHHHHHHTT-CCTTCCCTTSCCHHHHHHHTTCHHHHHHHH
T ss_pred             ccccchhHHHhccCcee-EeeCCCCCchhhHHHHcCC-HHHHHHHHHCC-CCCCCcCCCCCccchhhhhcCCcchhhhhc
Confidence            99999999999999987 7899999999999999999 99999999985 557889999999999999999999999999


Q ss_pred             HhcccccccccccccCCCCCcHHHHHHhcCCHHHHHHHHhccCCCccccccccccccCCCCHHHHHHHcCCchhHHHHHH
Q 013369          161 KVSKIHNKEHVFNWKNEDGNTVLHLATFNKSIEIVKALALESSNSSSIMIRVNTLNKQGQTALEVCKANSEDSVFKEIGL  240 (444)
Q Consensus       161 ~~~~~~~~~~~~~~~d~~G~T~Lh~A~~~~~~~iv~~Ll~~ga~~~~~~v~~~~~n~~G~T~L~~A~~~~~~~~~~~i~~  240 (444)
                      +      .+.+++.+|.+|+||||+|++.++.+++++|+++|++       ++.+|++|+||||+|. .    ...++++
T Consensus       157 ~------~~~~i~~~d~~g~TpL~~Aa~~g~~~~v~~LL~~Gad-------~~~~d~~g~tpl~~A~-~----~~~~i~~  218 (223)
T d1uoha_         157 Y------YKASTNIQDTEGNTPLHLACDEERVEEAKLLVSQGAS-------IYIENKEEKTPLQVAK-G----GLGLILK  218 (223)
T ss_dssp             H------TTCCSCCCCTTCCCHHHHHHHTTCHHHHHHHHHTTCC-------SCCCCTTSCCHHHHCC-T----THHHHHH
T ss_pred             c------ccceeeeccCCCCceeccccccCcHHHHHHHHHCCCC-------CCCCCCCCCCHHHHHH-C----CCHHHHh
Confidence            8      5667889999999999999999999999999999887       9999999999999984 3    3667877


Q ss_pred             HHHH
Q 013369          241 ILQE  244 (444)
Q Consensus       241 ~L~~  244 (444)
                      .|++
T Consensus       219 ~Ll~  222 (223)
T d1uoha_         219 RMVE  222 (223)
T ss_dssp             HHHC
T ss_pred             cccC
Confidence            7764
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure