Citrus Sinensis ID: 013498

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440--

MAATTAAAAFFTNRQPTFISSSPKTKANASQLFFHCNNSKPFFKTTISCSLQKPPPSLYPRITATRPEYIPNRIPDPNYVRVFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDIIEAGFPAASKEDFEAVRTIAKEVGNAVDAESGYVPVICGLSRCNERDIKTAWEAVKYAKRPRIHTFIATSGIHMEHKLRKTKQQVVEIARSMVKFARSLGCDDVEFSPEDAGRSDRKFLYEILGEVIKVGATTLNIPDTVGITMPTEFGKLIADIKANTPGIENVVISTHCQNDLGLSTANTIAGACAGARQVEVTINGIGERAGNASLEEVVMAFKCRGEHILGGLYTGINTRHIVMASKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIISPEDIGLERSSEAGIVLGKLSGRHALKDRLKEVCQYVIFID

cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEccccccccccccccccHHHHHHHHHHHHHccccEEEcccccccHHHHHHHHHHHHHHcccccccccccccEEEEccccHHHHHHHHHHHHHcccccEEEEEcccHHHHHHHccccHHHHHHHHHHHHHHHHHcccccEEEcccccccccHHHHHHHHHHHHHHcccEEccccccccccHHHHHHHHHHHHHHcccccccEEEEcccccccHHHHHHHHHHHHcccEEEEEccccHHHHcccHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHccccccccc

ccccccccccccccccccccccccccccccEEEEEcccccccccccccccccccccccccccccccccccccccccccEEEEEEcccccccccccccccHHHHHHHHHHHHHccccEEEccccccccccHHHHHHHHHHHccccccccccccEEHHHHHHHHHHHHHHHHHHHHcccccEEEEEEccHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccEEEcccccccccHHHHHHHHHHHHHccccEEEcccccccccHHHHHHHHHHHHHHcccccEEEEEEcccccHHHHHHHHHHHHHHcccEEEEEEcccccccccHHHHHHHHHHHHHHHHccccccccccccHEHHHHHHHHHHcccccccccEEEcccHHHHcccccccccEccccEEEEEcHHHcccEccccccEEEccccHHHHHHHHHHHHccEEEEcc

MAATTAAAAFftnrqptfissspktkanASQLffhcnnskpffkttiscslqkpppslypritatrpeyipnripdpnyvrVFDTTlrdgeqspgatltskEKLDIARQLAKLGVDIIeagfpaaskedFEAVRTIAKEVGnavdaesgyvpvicglsrcneRDIKTAWEAVKYakrprihtfiatsgihmehKLRKTKQQVVEIARSMVKFARslgcddvefspedagrsdRKFLYEILGEVIKVGattlnipdtvgitmptEFGKLIADIkantpgieNVVISTHcqndlglstANTIAGACAGARQVEVTINGigeragnaSLEEVVMAFKCRgehilgglytgiNTRHIVMASKMVEEytglhvqphkaivganafahesgihqdgmlkhkgtyeiispediglersseaGIVLGKLSGRHALKDRLKEVCQYVIFID

MAATTAAaafftnrqptfisssPKTKANASQLFFHCNNSKPFFKTTISCSLQKPPPSLYPRITATrpeyipnripdpNYVRVFDTTLrdgeqspgatltskeklDIARQLAKLGVDIIEAGfpaaskedfEAVRTIAKEvgnavdaesgyvPVICGLSRCNERDIKTAWEavkyakrprIHTFiatsgihmehklRKTKQQVVEIARSMVKFarslgcddvefspedagrsdRKFLYEILGEVIkvgattlnipdtvgITMPTEFGKLIADIKANTPGIENVVISTHCQNDLGLSTANTIAGACAGARQVEVTINGIGERAGNASLEEVVMAFKCRGEHILGGLYTGINTRHIVMASKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIISPEDIGLERSSEAGIVLGKlsgrhalkdrlKEVCQYVIFID

MaattaaaafftNRQPTFISSSPKTKANASQLFFHCNNSKPFFKTTISCSLQKPPPSLYPRITATRPEYIPNRIPDPNYVRVFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDIIEAGFPAASKEDFEAVRTIAKEVGNAVDAESGYVPVICGLSRCNERDIKTAWEAVKYAKRPRIHTFIATSGIHMEHKLRKTKQQVVEIARSMVKFARSLGCDDVEFSPEDAGRSDRKFLYEILGEVIKVGATTLNIPDTVGITMPTEFGKLIADIKANTPGIENVVISTHCQNDLGLSTANTIAGACAGARQVEVTINGIGERAGNASLEEVVMAFKCRGEHILGGLYTGINTRHIVMASKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIISPEDIGLERSSEAGIVLGKLSGRHALKDRLKEVCQYVIFID

******************************QLFFHCNNSKPFFKTTISCSLQ****SLYPRITATRPEYIPNRIPDPNYVRVFDTTL****************LDIARQLAKLGVDIIEAGFPAASKEDFEAVRTIAKEVGNAVDAESGYVPVICGLSRCNERDIKTAWEAVKYAKRPRIHTFIATSGIHMEHKLRKTKQQVVEIARSMVKFARSLGCDDVEFS*******DRKFLYEILGEVIKVGATTLNIPDTVGITMPTEFGKLIADIKANTPGIENVVISTHCQNDLGLSTANTIAGACAGARQVEVTINGIGERAGNASLEEVVMAFKCRGEHILGGLYTGINTRHIVMASKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIISPEDIGLERSSEAGIVLGKLSGRHALKDRLKEVCQYVIFI*

*****************************************************************************NYVRVFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDIIEAGFPAASKEDFEAVRTIAKEVGNAVDAESGYVPVICGLSRCNERDIKTAWEAVKYAKRPRIHTFIATSGIHMEHKLRKTKQQVVEIARSMVKFARSLGCDDVEFSPEDAGRSDRKFLYEILGEVIKVGATTLNIPDTVGITMPTEFGKLIADIKANTPGIENVVISTHCQNDLGLSTANTIAGACAGARQVEVTINGIGERAGNASLEEVVMAFKCRGEHILGGLYTGINTRHIVMASKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIISPEDIGLERSSEAGIVLGKLSGRHALKDRLKEVCQYVI***

MAATTAAAAFFTNRQPTFISSSPKTKANASQLFFHCNNSKPFFKTTISCSLQKPPPSLYPRITATRPEYIPNRIPDPNYVRVFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDIIEAGFPAASKEDFEAVRTIAKEVGNAVDAESGYVPVICGLSRCNERDIKTAWEAVKYAKRPRIHTFIATSGIHME*********VVEIARSMVKFARSLGCDDVEFSPEDAGRSDRKFLYEILGEVIKVGATTLNIPDTVGITMPTEFGKLIADIKANTPGIENVVISTHCQNDLGLSTANTIAGACAGARQVEVTINGIGERAGNASLEEVVMAFKCRGEHILGGLYTGINTRHIVMASKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIISPEDIGLERSSEAGIVLGKLSGRHALKDRLKEVCQYVIFID

******************ISSSPKTKANASQLFFHCNN************************TATRPEYIPNRIPDPNYVRVFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDIIEAGFPAASKEDFEAVRTIAKEVGNAVDAESGYVPVICGLSRCNERDIKTAWEAVKYAKRPRIHTFIATSGIHMEHKLRKTKQQVVEIARSMVKFARSLGCDDVEFSPEDAGRSDRKFLYEILGEVIKVGATTLNIPDTVGITMPTEFGKLIADIKANTPGIENVVISTHCQNDLGLSTANTIAGACAGARQVEVTINGIGERAGNASLEEVVMAFKCRGEHILGGLYTGINTRHIVMASKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIISPEDIGLERSSEAGIVLGKLSGRHALKDRLKEVCQYVIFI*

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

SSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		442	2.2.26 [Sep-21-2011]
Q9C550		631	2-isopropylmalate synthas	yes	no	0.886	0.621	0.818	0.0
Q9LPR4		631	2-isopropylmalate synthas	no	no	0.875	0.613	0.835	0.0
O04973		589	2-isopropylmalate synthas	N/A	no	0.873	0.655	0.768	0.0
O04974		612	2-isopropylmalate synthas	N/A	no	0.925	0.668	0.724	1e-176
Q39891		565	Probable 2-isopropylmalat	no	no	0.857	0.670	0.734	1e-167
Q9FG67		506	Methylthioalkylmalate syn	no	no	0.893	0.780	0.635	1e-153
Q9FN52		503	Methylthioalkylmalate syn	no	no	0.923	0.811	0.608	1e-152
Q8VX04		506	Methylthioalkylmalate syn	no	no	0.893	0.780	0.630	1e-151
Q8DJ32		535	2-isopropylmalate synthas	yes	no	0.805	0.665	0.597	1e-116
B7JYP4		536	2-isopropylmalate synthas	yes	no	0.787	0.649	0.594	1e-115

>sp\|Q9C550\|LEU12_ARATH 2-isopropylmalate synthase 2, chloroplastic OS=Arabidopsis thaliana GN=IPMS2 PE=1 SV=1	Back alignment and function desciption

 Score =  685 bits (1767), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/397 (81%), Positives = 368/397 (92%), Gaps = 5/397 (1%)

Query: 43  FKTTISCSLQKPPPSLYPRITATRPEYIPNRIPDPNYVRVFDTTLRDGEQSPGATLTSKE 102
           F+ + S S   P P   PR    RP YIPNRI DPNYVR+FDTTLRDGEQSPGATLTSKE
Sbjct: 53  FRVSYSLSASSPLPPHAPR---RRPNYIPNRISDPNYVRIFDTTLRDGEQSPGATLTSKE 109

Query: 103 KLDIARQLAKLGVDIIEAGFPAASKEDFEAVRTIAKEVGNAVDAESGYVPVICGLSRCNE 162
           KLDIARQLAKLGVDIIEAGFPAASK+DFEAV+TIA+ VGN VD E+GYVPVICGLSRCN+
Sbjct: 110 KLDIARQLAKLGVDIIEAGFPAASKDDFEAVKTIAETVGNTVD-ENGYVPVICGLSRCNK 168

Query: 163 RDIKTAWEAVKYAKRPRIHTFIATSGIHMEHKLRKTKQQVVEIARSMVKFARSLGCDDVE 222
           +DI+TAWEAVKYAKRPRIHTFIATS IH+++KL+K+K++V+EIAR+MV+FARSLGC+DVE
Sbjct: 169 KDIETAWEAVKYAKRPRIHTFIATSDIHLKYKLKKSKEEVIEIARNMVRFARSLGCEDVE 228

Query: 223 FSPEDAGRSDRKFLYEILGEVIKVGATTLNIPDTVGITMPTEFGKLIADIKANTPGIENV 282
           FSPEDAGRS+R++LYEILGEVIK GATTLNIPDTVGIT+P+EFG+LIADIKANTPGI+NV
Sbjct: 229 FSPEDAGRSEREYLYEILGEVIKAGATTLNIPDTVGITLPSEFGQLIADIKANTPGIQNV 288

Query: 283 VISTHCQNDLGLSTANTIAGACAGARQVEVTINGIGERAGNASLEEVVMAFKCRGEHILG 342
           +ISTHCQNDLGLSTANT++GA +GARQVEVTINGIGERAGNASLEEVVMA KCRG+H+LG
Sbjct: 289 IISTHCQNDLGLSTANTLSGAHSGARQVEVTINGIGERAGNASLEEVVMAIKCRGDHVLG 348

Query: 343 GLYTGINTRHIVMASKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIIS 402
           GL+TGI+TRHIVM SKMVEEYTG+  QPHKAIVGANAFAHESGIHQDGMLKHKGTYEI+S
Sbjct: 349 GLFTGIDTRHIVMTSKMVEEYTGMQTQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIMS 408

Query: 403 PEDIGLERSSEAGIVLGKLSGRHALKDRLKEVCQYVI 439
           PE+IGLERS++AGIVLGKLSGRHALKDRL E+  YV+
Sbjct: 409 PEEIGLERSNDAGIVLGKLSGRHALKDRLNEL-GYVL 444

Catalyzes the condensation of the acetyl group of acetyl-CoA with 3-methyl-2-oxobutanoate (2-oxoisovalerate) to form 3-carboxy-3-hydroxy-4-methylpentanoate (2-isopropylmalate). Involved in Leu biosynthesis, but do not participate in the chain elongation of glucosinolates.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 3EC: .EC: 3EC: .EC: 1EC: 3

>sp\|Q9LPR4\|LEU11_ARATH 2-isopropylmalate synthase 1, chloroplastic OS=Arabidopsis thaliana GN=IPMS1 PE=1 SV=2	Back alignment and function description

>sp\|O04973\|LEU1A_SOLPN 2-isopropylmalate synthase A OS=Solanum pennellii GN=IPMSA PE=2 SV=1	Back alignment and function description

>sp\|O04974\|LEU1B_SOLPN 2-isopropylmalate synthase B OS=Solanum pennellii GN=IPMSB PE=2 SV=1	Back alignment and function description

>sp\|Q39891\|LEU1_SOYBN Probable 2-isopropylmalate synthase OS=Glycine max GN=GMN56 PE=2 SV=1	Back alignment and function description

>sp\|Q9FG67\|MAM1_ARATH Methylthioalkylmalate synthase 1, chloroplastic OS=Arabidopsis thaliana GN=MAM1 PE=1 SV=1	Back alignment and function description

>sp\|Q9FN52\|MAM3_ARATH Methylthioalkylmalate synthase 3, chloroplastic OS=Arabidopsis thaliana GN=MAM3 PE=1 SV=1	Back alignment and function description

>sp\|Q8VX04\|MAM2_ARATH Methylthioalkylmalate synthase 2, chloroplastic OS=Arabidopsis thaliana GN=MAM2 PE=2 SV=1	Back alignment and function description

>sp\|Q8DJ32\|LEU1_THEEB 2-isopropylmalate synthase OS=Thermosynechococcus elongatus (strain BP-1) GN=leuA PE=3 SV=1	Back alignment and function description

>sp\|B7JYP4\|LEU1_CYAP8 2-isopropylmalate synthase OS=Cyanothece sp. (strain PCC 8801) GN=leuA PE=3 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		442
255579410		632	isopropylmalate synthase, putative [Rici	0.832	0.582	0.905	0.0
224083783		558	predicted protein [Populus trichocarpa]	0.832	0.659	0.894	0.0
75707983		623	2-isopropylmalate synthase 1 [Brassica i	0.945	0.670	0.791	0.0
58743500		623	Putative 2-isopropylmalate synthase [Bra	0.945	0.670	0.786	0.0
449516089		639	PREDICTED: 2-isopropylmalate synthase 2,	0.889	0.615	0.821	0.0
15221125		631	2-isopropylmalate synthase 2 [Arabidopsi	0.886	0.621	0.818	0.0
171921096		672	2-isopropylmalate synthase [Brassica ole	0.837	0.550	0.862	0.0
6714306		675	F15H18.3 [Arabidopsis thaliana]	0.875	0.573	0.837	0.0
297844800		630	hypothetical protein ARALYDRAFT_472070 [	0.875	0.614	0.835	0.0
449463448		633	PREDICTED: 2-isopropylmalate synthase 2,	0.889	0.620	0.811	0.0

>gi\|255579410\|ref\|XP_002530549.1\| isopropylmalate synthase, putative [Ricinus communis] gi\|223529911\|gb\|EEF31840.1\| isopropylmalate synthase, putative [Ricinus communis]	Back alignment and taxonomy information

 Score =  700 bits (1807), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/369 (90%), Positives = 357/369 (96%), Gaps = 1/369 (0%)

Query: 66  RPEYIPNRIPDPNYVRVFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDIIEAGFPAA 125
           RPEYIP+ IPDP+YVR+FDTTLRDGEQSPGATLTSKEKLDIARQL+KLGVDIIEAGFPAA
Sbjct: 74  RPEYIPSHIPDPSYVRIFDTTLRDGEQSPGATLTSKEKLDIARQLSKLGVDIIEAGFPAA 133

Query: 126 SKEDFEAVRTIAKEVGNAVDAESGYVPVICGLSRCNERDIKTAWEAVKYAKRPRIHTFIA 185
           SK+DFEAV+TIAKEVGNAVD E GYVPVICGLSRCNE+DI+TAWEAVKYAKRPRIHTFIA
Sbjct: 134 SKDDFEAVKTIAKEVGNAVD-EDGYVPVICGLSRCNEKDIRTAWEAVKYAKRPRIHTFIA 192

Query: 186 TSGIHMEHKLRKTKQQVVEIARSMVKFARSLGCDDVEFSPEDAGRSDRKFLYEILGEVIK 245
           TS IHME+KLRK+K++VVEIARSMVKFARSLGCDDVEFSPEDAGRSDR+FLY ILGEVIK
Sbjct: 193 TSAIHMEYKLRKSKEEVVEIARSMVKFARSLGCDDVEFSPEDAGRSDREFLYHILGEVIK 252

Query: 246 VGATTLNIPDTVGITMPTEFGKLIADIKANTPGIENVVISTHCQNDLGLSTANTIAGACA 305
            GATTLNIPDTVGIT+P+EFG+LIADIKANTPGI+ V+ISTHCQNDLGLSTANT+AGA A
Sbjct: 253 AGATTLNIPDTVGITLPSEFGQLIADIKANTPGIDKVIISTHCQNDLGLSTANTLAGAYA 312

Query: 306 GARQVEVTINGIGERAGNASLEEVVMAFKCRGEHILGGLYTGINTRHIVMASKMVEEYTG 365
           GARQVEVTINGIGERAGNASLEEVVMA KCRGEHILGGLYTGIN R I MASKMVEEYTG
Sbjct: 313 GARQVEVTINGIGERAGNASLEEVVMAIKCRGEHILGGLYTGINPRQITMASKMVEEYTG 372

Query: 366 LHVQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIISPEDIGLERSSEAGIVLGKLSGRH 425
           LH+QPHKAIVGANAFAHESGIHQDGMLKHKGTYEIISPEDIGLERS++AGIVLGKLSGRH
Sbjct: 373 LHLQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIISPEDIGLERSNDAGIVLGKLSGRH 432

Query: 426 ALKDRLKEV 434
           ALKDRLKE+
Sbjct: 433 ALKDRLKEL 441

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|224083783\|ref\|XP_002307122.1\| predicted protein [Populus trichocarpa] gi\|222856571\|gb\|EEE94118.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|75707983\|gb\|ABA26446.1\| 2-isopropylmalate synthase 1 [Brassica insularis]	Back alignment and taxonomy information

>gi\|58743500\|gb\|AAW81741.1\| Putative 2-isopropylmalate synthase [Brassica oleracea]	Back alignment and taxonomy information

>gi\|449516089\|ref\|XP_004165080.1\| PREDICTED: 2-isopropylmalate synthase 2, chloroplastic-like [Cucumis sativus]	Back alignment and taxonomy information

>gi|15221125|ref|NP_177544.1| 2-isopropylmalate synthase 2 [Arabidopsis thaliana] gi|75168891|sp|Q9C550.1|LEU12_ARATH RecName: Full=2-isopropylmalate synthase 2, chloroplastic; AltName: Full=2-isopropylmalate synthase 1; AltName: Full=Methylthioalkylmalate synthase-like 3; Flags: Precursor gi|12325154|gb|AAG52530.1|AC016662_24 putative 2-isopropylmalate synthase; 30920-27612 [Arabidopsis thaliana] gi|12330687|gb|AAG52882.1|AF327647_1 2-isopropylmalate synthase [Arabidopsis thaliana] gi|16323111|gb|AAL15290.1| At1g74040/F2P9_9 [Arabidopsis thaliana] gi|23463041|gb|AAN33190.1| At1g74040/F2P9_9 [Arabidopsis thaliana] gi|332197419|gb|AEE35540.1| 2-isopropylmalate synthase 2 [Arabidopsis thaliana]

Back alignment and taxonomy information

>gi\|171921096\|gb\|ACB59195.1\| 2-isopropylmalate synthase [Brassica oleracea]	Back alignment and taxonomy information

>gi\|6714306\|gb\|AAF26002.1\|AC013354_21 F15H18.3 [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|297844800\|ref\|XP_002890281.1\| hypothetical protein ARALYDRAFT_472070 [Arabidopsis lyrata subsp. lyrata] gi\|297336123\|gb\|EFH66540.1\| hypothetical protein ARALYDRAFT_472070 [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi\|449463448\|ref\|XP_004149446.1\| PREDICTED: 2-isopropylmalate synthase 2, chloroplastic-like [Cucumis sativus]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		442
TAIR\|locus:2014179		631	MAML-4 "methylthioalkylmalate	0.943	0.660	0.793	2e-175
TAIR\|locus:2031586		631	IMS1 "2-isopropylmalate syntha	0.886	0.621	0.818	8.6e-175
TAIR\|locus:2181151		506	MAM1 "methylthioalkylmalate sy	0.832	0.727	0.671	7.4e-137
TAIR\|locus:2178317		503	IMS2 "2-isopropylmalate syntha	0.893	0.785	0.626	3.2e-136
TIGR_CMR\|DET_0830		505	DET_0830 "2-isopropylmalate sy	0.769	0.673	0.569	1.8e-101
TIGR_CMR\|CHY_0521		509	CHY_0521 "2-isopropylmalate sy	0.769	0.667	0.560	1.8e-94
TIGR_CMR\|GSU_1906		512	GSU_1906 "2-isopropylmalate sy	0.769	0.664	0.556	2.7e-93
TIGR_CMR\|SPO_0422		524	SPO_0422 "2-isopropylmalate sy	0.780	0.658	0.523	1.6e-88
TIGR_CMR\|SO_4236		522	SO_4236 "2-isopropylmalate syn	0.773	0.655	0.504	8e-85
UNIPROTKB\|Q9KP83		516	leuA "2-isopropylmalate syntha	0.766	0.656	0.531	1.3e-84

TAIR\|locus:2014179 MAML-4 "methylthioalkylmalate synthase-like 4" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 1704 (604.9 bits), Expect = 2.0e-175, P = 2.0e-175
 Identities = 334/421 (79%), Positives = 374/421 (88%)

Query:    16 PTFISS-SPKTKANASQLFFHCNNSKPFFKTTISCSLQKPPPSLYPRITAT-RPEYIPNR 73
             PTF S  +P + +   Q   H + S       +SCS+  P P L P      RPEYIPNR
Sbjct:    24 PTFSSKPTPISSSFRFQPSHHRSISLRSQTLRLSCSISDPSP-LPPHTPRRPRPEYIPNR 82

Query:    74 IPDPNYVRVFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDIIEAGFPAASKEDFEAV 133
             I DPNYVRVFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDIIEAGFPAASK+DFEAV
Sbjct:    83 ISDPNYVRVFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDIIEAGFPAASKDDFEAV 142

Query:   134 RTIAKEVGNAVDAESGYVPVICGLSRCNERDIKTAWEAVKYAKRPRIHTFIATSGIHMEH 193
             +TIA+ VGN VD E+GYVPVICGLSRCN++DI+ AW+AVKYAKRPRIHTFIATS IH+E+
Sbjct:   143 KTIAETVGNTVD-ENGYVPVICGLSRCNKKDIERAWDAVKYAKRPRIHTFIATSDIHLEY 201

Query:   194 KLRKTKQQVVEIARSMVKFARSLGCDDVEFSPEDAGRSDRKFLYEILGEVIKVGATTLNI 253
             KL+KTK +V+EIARSMV+FARSLGC+DVEFSPEDAGRS+R++LYEILGEVIK GATTLNI
Sbjct:   202 KLKKTKAEVIEIARSMVRFARSLGCEDVEFSPEDAGRSEREYLYEILGEVIKAGATTLNI 261

Query:   254 PDTVGITMPTEFGKLIADIKANTPGIENVVISTHCQNDLGLSTANTIAGACAGARQVEVT 313
             PDTVGIT+P+EFG+LI D+KANTPGIENVVISTHCQNDLGLSTANT++GA AGARQ+EVT
Sbjct:   262 PDTVGITLPSEFGQLITDLKANTPGIENVVISTHCQNDLGLSTANTLSGAHAGARQMEVT 321

Query:   314 INGIGERAGNASLEEVVMAFKCRGEHILGGLYTGINTRHIVMASKMVEEYTGLHVQPHKA 373
             INGIGERAGNASLEEVVMA KCRG+H+LGGL+TGI+TRHIVM SKMVEEYTG+  QPHKA
Sbjct:   322 INGIGERAGNASLEEVVMAIKCRGDHVLGGLFTGIDTRHIVMTSKMVEEYTGMQTQPHKA 381

Query:   374 IVGANAFAHESGIHQDGMLKHKGTYEIISPEDIGLERSSEAGIVLGKLSGRHALKDRLKE 433
             IVGANAFAHESGIHQDGMLKHKGTYEII PE+IGLERS++AGIVLGKLSGRHALKDRL E
Sbjct:   382 IVGANAFAHESGIHQDGMLKHKGTYEIICPEEIGLERSNDAGIVLGKLSGRHALKDRLTE 441

Query:   434 V 434
             +
Sbjct:   442 L 442

GO:0003824 "catalytic activity" evidence=IEA

GO:0003852 "2-isopropylmalate synthase activity" evidence=IEA;IDA

GO:0009098 "leucine biosynthetic process" evidence=IEA;IDA

GO:0009507 "chloroplast" evidence=ISM;IDA

GO:0019752 "carboxylic acid metabolic process" evidence=IEA

GO:0046912 "transferase activity, transferring acyl groups, acyl groups converted into alkyl on transfer" evidence=IEA

GO:0009570 "chloroplast stroma" evidence=IDA

TAIR\|locus:2031586 IMS1 "2-isopropylmalate synthase 1" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2181151 MAM1 "methylthioalkylmalate synthase 1" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2178317 IMS2 "2-isopropylmalate synthase 2" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TIGR_CMR\|DET_0830 DET_0830 "2-isopropylmalate synthase" [Dehalococcoides ethenogenes 195 (taxid:243164)]	Back alignment and assigned GO terms

TIGR_CMR\|CHY_0521 CHY_0521 "2-isopropylmalate synthase" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)]	Back alignment and assigned GO terms

TIGR_CMR\|GSU_1906 GSU_1906 "2-isopropylmalate synthase" [Geobacter sulfurreducens PCA (taxid:243231)]	Back alignment and assigned GO terms

TIGR_CMR\|SPO_0422 SPO_0422 "2-isopropylmalate synthase" [Ruegeria pomeroyi DSS-3 (taxid:246200)]	Back alignment and assigned GO terms

TIGR_CMR\|SO_4236 SO_4236 "2-isopropylmalate synthase" [Shewanella oneidensis MR-1 (taxid:211586)]	Back alignment and assigned GO terms

UNIPROTKB\|Q9KP83 leuA "2-isopropylmalate synthase" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
B7JYP4	LEU1_CYAP8	2, ., 3, ., 3, ., 1, 3	0.5940	0.7873	0.6492	yes	no
Q9JUK6	LEU1_NEIMA	2, ., 3, ., 3, ., 1, 3	0.5770	0.7737	0.6615	yes	no
A2SHL8	LEU1_METPP	2, ., 3, ., 3, ., 1, 3	0.5677	0.7647	0.6588	yes	no
Q112U2	LEU1_TRIEI	2, ., 3, ., 3, ., 1, 3	0.5864	0.7941	0.6487	yes	no
A1TRT4	LEU1_ACIAC	2, ., 3, ., 3, ., 1, 3	0.5649	0.7647	0.6601	yes	no
O67862	LEU1_AQUAE	2, ., 3, ., 3, ., 1, 3	0.6028	0.7714	0.6557	yes	no
Q7P0H2	LEU1_CHRVO	2, ., 3, ., 3, ., 1, 3	0.5750	0.7647	0.6601	yes	no
B0JGK2	LEU1_MICAN	2, ., 3, ., 3, ., 1, 3	0.5831	0.7895	0.6547	yes	no
Q2LWJ3	LEU1_SYNAS	2, ., 3, ., 3, ., 1, 3	0.5549	0.7692	0.6589	yes	no
Q7V121	LEU1_PROMP	2, ., 3, ., 3, ., 1, 3	0.5691	0.7873	0.6373	yes	no
Q9JZG1	LEU1_NEIMB	2, ., 3, ., 3, ., 1, 3	0.5798	0.7737	0.6615	yes	no
B1XLQ9	LEU1_SYNP2	2, ., 3, ., 3, ., 1, 3	0.5828	0.7760	0.6435	yes	no
A2BRP4	LEU1_PROMS	2, ., 3, ., 3, ., 1, 3	0.5718	0.7873	0.6373	yes	no
A1KTV6	LEU1_NEIMF	2, ., 3, ., 3, ., 1, 3	0.5770	0.7737	0.6615	yes	no
A8G5D5	LEU1_PROM2	2, ., 3, ., 3, ., 1, 3	0.5691	0.7873	0.6373	yes	no
Q46K01	LEU1_PROMT	2, ., 3, ., 3, ., 1, 3	0.5516	0.7895	0.6474	yes	no
Q820M0	LEU1_NITEU	2, ., 3, ., 3, ., 1, 3	0.5561	0.7714	0.6686	yes	no
B1WQQ4	LEU1_CYAA5	2, ., 3, ., 3, ., 1, 3	0.5940	0.7873	0.6480	yes	no
B8I1T7	LEU1_CLOCE	2, ., 3, ., 3, ., 1, 3	0.5436	0.7692	0.6692	yes	no
C5CYP2	LEU1_VARPS	2, ., 3, ., 3, ., 1, 3	0.5649	0.7647	0.6601	yes	no
A5GM47	LEU1_SYNPW	2, ., 3, ., 3, ., 1, 3	0.5706	0.7895	0.6462	yes	no
Q0AGN5	LEU1_NITEC	2, ., 3, ., 3, ., 1, 3	0.5722	0.7647	0.6627	yes	no
Q9C550	LEU12_ARATH	2, ., 3, ., 3, ., 1, 3	0.8186	0.8868	0.6212	yes	no
A1W6T7	LEU1_ACISJ	2, ., 3, ., 3, ., 1, 3	0.5706	0.7647	0.6601	yes	no
A4J181	LEU1_DESRM	2, ., 3, ., 3, ., 1, 3	0.5686	0.7737	0.6772	yes	no
P48575	LEU1_NOSS1	2, ., 3, ., 3, ., 1, 3	0.5803	0.7873	0.6553	yes	no
Q0IBI3	LEU1_SYNS3	2, ., 3, ., 3, ., 1, 3	0.5625	0.7895	0.6462	yes	no
B1H0A7	LEU1_UNCTG	2, ., 3, ., 3, ., 1, 3	0.5431	0.7782	0.6666	yes	no
B1XYA8	LEU1_LEPCP	2, ., 3, ., 3, ., 1, 3	0.5649	0.7647	0.6588	yes	no
O04973	LEU1A_SOLPN	2, ., 3, ., 3, ., 1, 3	0.7688	0.8733	0.6553	N/A	no
B7KJX8	LEU1_CYAP7	2, ., 3, ., 3, ., 1, 3	0.5940	0.7873	0.6492	yes	no
B1I1Y1	LEU1_DESAP	2, ., 3, ., 3, ., 1, 3	0.5690	0.7692	0.6679	yes	no
O04974	LEU1B_SOLPN	2, ., 3, ., 3, ., 1, 3	0.7248	0.9253	0.6683	N/A	no
A2BX52	LEU1_PROM5	2, ., 3, ., 3, ., 1, 3	0.5663	0.7873	0.6373	yes	no
A9BB43	LEU1_PROM4	2, ., 3, ., 3, ., 1, 3	0.5522	0.7782	0.6417	yes	no
Q31AF9	LEU1_PROM9	2, ., 3, ., 3, ., 1, 3	0.5609	0.7873	0.6373	yes	no
A5GRZ0	LEU1_SYNR3	2, ., 3, ., 3, ., 1, 3	0.5788	0.7895	0.6499	yes	no
B9MA32	LEU1_ACIET	2, ., 3, ., 3, ., 1, 3	0.5706	0.7647	0.6601	yes	no
P94907	LEU1_MICAE	2, ., 3, ., 3, ., 1, 3	0.5831	0.7895	0.6547	yes	no
Q7U892	LEU1_SYNPX	2, ., 3, ., 3, ., 1, 3	0.5733	0.7895	0.6462	yes	no
A3PDH0	LEU1_PROM0	2, ., 3, ., 3, ., 1, 3	0.5663	0.7873	0.6373	yes	no
Q3MBA3	LEU1_ANAVT	2, ., 3, ., 3, ., 1, 3	0.5776	0.7873	0.6553	yes	no
A2C3L7	LEU1_PROM1	2, ., 3, ., 3, ., 1, 3	0.5516	0.7895	0.6474	yes	no
Q8DJ32	LEU1_THEEB	2, ., 3, ., 3, ., 1, 3	0.5978	0.8054	0.6654	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	2.3.3	0.963
3rd Layer	2.3.3.13	0.946

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	gw1.V.3049.1	2-isopropylmalate synthase (EC-2.3.3.13) (545 aa)
		(Populus trichocarpa)
Predicted Functional Partners:
	gw1.III.2339.1	3-isopropylmalate isomerase/dehydratase small subunit (EC-4.2.1.33) (172 aa)	•	•	•	•	•	0.999
	estExt_fgenesh4_pg.C_LG_VIII1506	SubName- Full=Putative uncharacterized protein; (443 aa)	•	•	•	•	•	0.998
	estExt_fgenesh4_pg.C_LG_X0404	hypothetical protein (463 aa)	•	•	•	•	•	0.998
	estExt_fgenesh4_pm.C_LG_III0598	hypothetical protein (605 aa)	•	•		•	•	0.997
	estExt_fgenesh4_pg.C_LG_I0451	hypothetical protein (611 aa)	•	•		•	•	0.997
	grail3.0005029001	acetolactate synthase I/II/III large subunit (EC-2.2.1.6) (651 aa)	•	•	•	•	•	0.994
	gw1.VII.445.1	hypothetical protein (410 aa)	•	•		•	•	0.980
	gw1.VIII.1377.1	hypothetical protein (414 aa)	•	•		•	•	0.979
	gw1.I.272.1	hypothetical protein; Catalyzes the oxidation of 3-carboxy-2-hydroxy-4- methylpentanoate (3-iso [...] (382 aa)	•	•	•		•	0.978
	gw1.VII.52.1	branched-chain amino acid aminotransferase (EC-2.6.1.42) (338 aa)	•			•	•	0.976

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		442
PLN02321		632	PLN02321, PLN02321, 2-isopropylmalate synthase	0.0
PRK00915		513	PRK00915, PRK00915, 2-isopropylmalate synthase; Va	0.0
PLN03228		503	PLN03228, PLN03228, methylthioalkylmalate synthase	0.0
TIGR00973		494	TIGR00973, leuA_bact, 2-isopropylmalate synthase,	0.0
cd07940		268	cd07940, DRE_TIM_IPMS, 2-isopropylmalate synthase	1e-169
COG0119		409	COG0119, LeuA, Isopropylmalate/homocitrate/citrama	1e-143
PRK11858		378	PRK11858, aksA, trans-homoaconitate synthase; Revi	1e-138
TIGR02090		363	TIGR02090, LEU1_arch, isopropylmalate/citramalate/	1e-126
PRK09389		488	PRK09389, PRK09389, (R)-citramalate synthase; Prov	1e-122
TIGR02660		365	TIGR02660, nifV_homocitr, homocitrate synthase Nif	5e-92
pfam00682		236	pfam00682, HMGL-like, HMGL-like	1e-90
cd03174		265	cd03174, DRE_TIM_metallolyase, DRE-TIM metallolyas	6e-90
cd07939		259	cd07939, DRE_TIM_NifV, Streptomyces rubellomurinus	1e-73
TIGR02146		344	TIGR02146, LysS_fung_arch, homocitrate synthase	4e-53
PRK12344		524	PRK12344, PRK12344, putative alpha-isopropylmalate	3e-49
TIGR00977		526	TIGR00977, LeuA_rel, 2-isopropylmalate synthase/ho	3e-43
cd07945		280	cd07945, DRE_TIM_CMS, Leptospira interrogans citra	5e-41
cd07948		262	cd07948, DRE_TIM_HCS, Saccharomyces cerevisiae hom	3e-38
cd07942		284	cd07942, DRE_TIM_LeuA, Mycobacterium tuberculosis	1e-35
cd07941		273	cd07941, DRE_TIM_LeuA3, Desulfobacterium autotroph	2e-35
TIGR00970		564	TIGR00970, leuA_yeast, 2-isopropylmalate synthase,	5e-34
PRK03739		552	PRK03739, PRK03739, 2-isopropylmalate synthase; Va	3e-23
PRK14847		333	PRK14847, PRK14847, hypothetical protein; Provisio	3e-18
cd07947		279	cd07947, DRE_TIM_Re_CS, Clostridium kluyveri Re-ci	3e-18
cd07943		263	cd07943, DRE_TIM_HOA, 4-hydroxy-2-oxovalerate aldo	2e-16
TIGR03217		333	TIGR03217, 4OH_2_O_val_ald, 4-hydroxy-2-oxovalerat	1e-14
PRK08195		337	PRK08195, PRK08195, 4-hyroxy-2-oxovalerate/4-hydro	3e-12
cd07944		266	cd07944, DRE_TIM_HOA_like, 4-hydroxy-2-oxovalerate	2e-10
cd07938		274	cd07938, DRE_TIM_HMGL, 3-hydroxy-3-methylglutaryl-	8e-09
COG5016		472	COG5016, COG5016, Pyruvate/oxaloacetate carboxyltr	2e-05
cd07937		275	cd07937, DRE_TIM_PC_TC_5S, Pyruvate carboxylase an	2e-04
PRK12581		468	PRK12581, PRK12581, oxaloacetate decarboxylase; Pr	2e-04
TIGR01235		1143	TIGR01235, pyruv_carbox, pyruvate carboxylase	0.004

>gnl\|CDD\|215182 PLN02321, PLN02321, 2-isopropylmalate synthase	Back alignment and domain information

 Score =  774 bits (1999), Expect = 0.0
 Identities = 328/435 (75%), Positives = 357/435 (82%), Gaps = 6/435 (1%)

Query: 2   AATTAAAAFFTNRQPTFI---SSSPKTKANASQLFFHCNNSKPFFKTTISCSLQKPPPSL 58
           ++ TAA+   +    T     SS+   +  A         ++     + + S     PS 
Sbjct: 8   SSATAASPAKSLSAFTPAPTRSSASSARFPAFLARP--AAARSPSLASRASSALAASPSR 65

Query: 59  YPRITATRPEYIPNRIPDPNYVRVFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDII 118
                  RPEYIPNRI DPNYVR+FDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDII
Sbjct: 66  PQVARRPRPEYIPNRIDDPNYVRIFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDII 125

Query: 119 EAGFPAASKEDFEAVRTIAKEVGNAVDAESGYVPVICGLSRCNERDIKTAWEAVKYAKRP 178
           EAGFP AS +D EAV+TIAKEVGN VD E GYVPVICGLSRCN++DI  AWEAVK+AKRP
Sbjct: 126 EAGFPIASPDDLEAVKTIAKEVGNEVD-EDGYVPVICGLSRCNKKDIDAAWEAVKHAKRP 184

Query: 179 RIHTFIATSGIHMEHKLRKTKQQVVEIARSMVKFARSLGCDDVEFSPEDAGRSDRKFLYE 238
           RIHTFIATS IHMEHKLRKT  +VVEIAR MVK+ARSLGC+DVEFSPEDAGRSD +FLY 
Sbjct: 185 RIHTFIATSEIHMEHKLRKTPDEVVEIARDMVKYARSLGCEDVEFSPEDAGRSDPEFLYR 244

Query: 239 ILGEVIKVGATTLNIPDTVGITMPTEFGKLIADIKANTPGIENVVISTHCQNDLGLSTAN 298
           ILGEVIK GATTLNIPDTVG T+P+EFG+LIADIKANTPGIENV+ISTHCQNDLGLSTAN
Sbjct: 245 ILGEVIKAGATTLNIPDTVGYTLPSEFGQLIADIKANTPGIENVIISTHCQNDLGLSTAN 304

Query: 299 TIAGACAGARQVEVTINGIGERAGNASLEEVVMAFKCRGEHILGGLYTGINTRHIVMASK 358
           T+AGA AGARQVEVTINGIGERAGNASLEEVVMA KCRG+  LGGLYTGIN  HI   SK
Sbjct: 305 TLAGAHAGARQVEVTINGIGERAGNASLEEVVMAIKCRGDEQLGGLYTGINPVHITPTSK 364

Query: 359 MVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIISPEDIGLERSSEAGIVL 418
           MV EYTG+ VQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIISPEDIGL R ++AGIVL
Sbjct: 365 MVSEYTGMQVQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIISPEDIGLFRGNDAGIVL 424

Query: 419 GKLSGRHALKDRLKE 433
           GKLSGRHALK RLKE
Sbjct: 425 GKLSGRHALKSRLKE 439

Length = 632

>gnl\|CDD\|234864 PRK00915, PRK00915, 2-isopropylmalate synthase; Validated	Back alignment and domain information

>gnl\|CDD\|178767 PLN03228, PLN03228, methylthioalkylmalate synthase; Provisional	Back alignment and domain information

>gnl\|CDD\|130046 TIGR00973, leuA_bact, 2-isopropylmalate synthase, bacterial type	Back alignment and domain information

>gnl\|CDD\|163678 cd07940, DRE_TIM_IPMS, 2-isopropylmalate synthase (IPMS), N-terminal catalytic TIM barrel domain	Back alignment and domain information

>gnl\|CDD\|223197 COG0119, LeuA, Isopropylmalate/homocitrate/citramalate synthases [Amino acid transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|183341 PRK11858, aksA, trans-homoaconitate synthase; Reviewed	Back alignment and domain information

>gnl\|CDD\|233719 TIGR02090, LEU1_arch, isopropylmalate/citramalate/homocitrate synthases	Back alignment and domain information

>gnl\|CDD\|236493 PRK09389, PRK09389, (R)-citramalate synthase; Provisional	Back alignment and domain information

>gnl\|CDD\|233965 TIGR02660, nifV_homocitr, homocitrate synthase NifV	Back alignment and domain information

>gnl\|CDD\|201390 pfam00682, HMGL-like, HMGL-like	Back alignment and domain information

>gnl\|CDD\|163674 cd03174, DRE_TIM_metallolyase, DRE-TIM metallolyase superfamily	Back alignment and domain information

>gnl\|CDD\|163677 cd07939, DRE_TIM_NifV, Streptomyces rubellomurinus FrbC and related proteins, catalytic TIM barrel domain	Back alignment and domain information

>gnl\|CDD\|162728 TIGR02146, LysS_fung_arch, homocitrate synthase	Back alignment and domain information

>gnl\|CDD\|237068 PRK12344, PRK12344, putative alpha-isopropylmalate/homocitrate synthase family transferase; Provisional	Back alignment and domain information

>gnl\|CDD\|130050 TIGR00977, LeuA_rel, 2-isopropylmalate synthase/homocitrate synthase family protein	Back alignment and domain information

>gnl\|CDD\|163683 cd07945, DRE_TIM_CMS, Leptospira interrogans citramalate synthase (CMS) and related proteins, N-terminal catalytic TIM barrel domain	Back alignment and domain information

>gnl\|CDD\|163685 cd07948, DRE_TIM_HCS, Saccharomyces cerevisiae homocitrate synthase and related proteins, catalytic TIM barrel domain	Back alignment and domain information

>gnl\|CDD\|163680 cd07942, DRE_TIM_LeuA, Mycobacterium tuberculosis LeuA3 and related proteins, N-terminal catalytic TIM barrel domain	Back alignment and domain information

>gnl\|CDD\|163679 cd07941, DRE_TIM_LeuA3, Desulfobacterium autotrophicum LeuA3 and related proteins, N-terminal catalytic TIM barrel domain	Back alignment and domain information

>gnl\|CDD\|233216 TIGR00970, leuA_yeast, 2-isopropylmalate synthase, yeast type	Back alignment and domain information

>gnl\|CDD\|235154 PRK03739, PRK03739, 2-isopropylmalate synthase; Validated	Back alignment and domain information

>gnl\|CDD\|184849 PRK14847, PRK14847, hypothetical protein; Provisional	Back alignment and domain information

>gnl\|CDD\|163684 cd07947, DRE_TIM_Re_CS, Clostridium kluyveri Re-citrate synthase and related proteins, catalytic TIM barrel domain	Back alignment and domain information

>gnl\|CDD\|163681 cd07943, DRE_TIM_HOA, 4-hydroxy-2-oxovalerate aldolase, N-terminal catalytic TIM barrel domain	Back alignment and domain information

>gnl\|CDD\|132261 TIGR03217, 4OH_2_O_val_ald, 4-hydroxy-2-oxovalerate aldolase	Back alignment and domain information

>gnl\|CDD\|181282 PRK08195, PRK08195, 4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic acid aldolase,; Validated	Back alignment and domain information

>gnl\|CDD\|163682 cd07944, DRE_TIM_HOA_like, 4-hydroxy-2-oxovalerate aldolase-like, N-terminal catalytic TIM barrel domain	Back alignment and domain information

>gnl\|CDD\|163676 cd07938, DRE_TIM_HMGL, 3-hydroxy-3-methylglutaryl-CoA lyase, catalytic TIM barrel domain	Back alignment and domain information

>gnl\|CDD\|227349 COG5016, COG5016, Pyruvate/oxaloacetate carboxyltransferase [Energy production and conversion]	Back alignment and domain information

>gnl\|CDD\|163675 cd07937, DRE_TIM_PC_TC_5S, Pyruvate carboxylase and Transcarboxylase 5S, carboxyltransferase domain	Back alignment and domain information

>gnl\|CDD\|79056 PRK12581, PRK12581, oxaloacetate decarboxylase; Provisional	Back alignment and domain information

>gnl\|CDD\|130302 TIGR01235, pyruv_carbox, pyruvate carboxylase	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		442
PLN02321		632	2-isopropylmalate synthase	100.0
PLN03228		503	methylthioalkylmalate synthase; Provisional	100.0
TIGR00973		494	leuA_bact 2-isopropylmalate synthase, bacterial ty	100.0
PRK00915		513	2-isopropylmalate synthase; Validated	100.0
KOG2367		560	consensus Alpha-isopropylmalate synthase/homocitra	100.0
PRK11858		378	aksA trans-homoaconitate synthase; Reviewed	100.0
TIGR02660		365	nifV_homocitr homocitrate synthase NifV. This fami	100.0
PRK09389		488	(R)-citramalate synthase; Provisional	100.0
TIGR00977		526	LeuA_rel 2-isopropylmalate synthase/homocitrate sy	100.0
PRK03739		552	2-isopropylmalate synthase; Validated	100.0
TIGR02090		363	LEU1_arch isopropylmalate/citramalate/homocitrate	100.0
TIGR00970		564	leuA_yeast 2-isopropylmalate synthase, yeast type.	100.0
COG0119		409	LeuA Isopropylmalate/homocitrate/citramalate synth	100.0
PRK12344		524	putative alpha-isopropylmalate/homocitrate synthas	100.0
PRK14847		333	hypothetical protein; Provisional	100.0
cd07945		280	DRE_TIM_CMS Leptospira interrogans citramalate syn	100.0
cd07942		284	DRE_TIM_LeuA Mycobacterium tuberculosis LeuA3 and	100.0
cd07948		262	DRE_TIM_HCS Saccharomyces cerevisiae homocitrate s	100.0
PLN02746		347	hydroxymethylglutaryl-CoA lyase	100.0
cd07939		259	DRE_TIM_NifV Streptomyces rubellomurinus FrbC and	100.0
cd07940		268	DRE_TIM_IPMS 2-isopropylmalate synthase (IPMS), N-	100.0
PRK05692		287	hydroxymethylglutaryl-CoA lyase; Provisional	100.0
TIGR02146		344	LysS_fung_arch homocitrate synthase. This model in	100.0
cd07941		273	DRE_TIM_LeuA3 Desulfobacterium autotrophicum LeuA3	100.0
cd07938		274	DRE_TIM_HMGL 3-hydroxy-3-methylglutaryl-CoA lyase,	100.0
cd07947		279	DRE_TIM_Re_CS Clostridium kluyveri Re-citrate synt	100.0
cd03174		265	DRE_TIM_metallolyase DRE-TIM metallolyase superfam	100.0
cd07943		263	DRE_TIM_HOA 4-hydroxy-2-oxovalerate aldolase, N-te	100.0
cd07937		275	DRE_TIM_PC_TC_5S Pyruvate carboxylase and Transcar	100.0
cd07944		266	DRE_TIM_HOA_like 4-hydroxy-2-oxovalerate aldolase-	100.0
PF00682		237	HMGL-like: HMGL-like of this family is not conserv	100.0
PRK08195		337	4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic ac	100.0
PRK14040		593	oxaloacetate decarboxylase; Provisional	100.0
TIGR03217		333	4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase.	100.0
PRK12330		499	oxaloacetate decarboxylase; Provisional	100.0
TIGR01108		582	oadA oxaloacetate decarboxylase alpha subunit. Thi	100.0
PRK12331		448	oxaloacetate decarboxylase; Provisional	100.0
PRK09282		592	pyruvate carboxylase subunit B; Validated	100.0
PRK14041		467	oxaloacetate decarboxylase; Provisional	100.0
PRK12581		468	oxaloacetate decarboxylase; Provisional	100.0
PRK12999		1146	pyruvate carboxylase; Reviewed	100.0
PRK14042		596	pyruvate carboxylase subunit B; Provisional	100.0
TIGR01235		1143	pyruv_carbox pyruvate carboxylase. This enzyme pla	100.0
KOG2368		316	consensus Hydroxymethylglutaryl-CoA lyase [Energy	100.0
COG5016		472	Pyruvate/oxaloacetate carboxyltransferase [Energy	100.0
COG1038		1149	PycA Pyruvate carboxylase [Energy production and c	99.9
KOG0369		1176	consensus Pyruvate carboxylase [Energy production	99.81
TIGR02146		344	LysS_fung_arch homocitrate synthase. This model in	99.71
PRK07028		430	bifunctional hexulose-6-phosphate synthase/ribonuc	98.53
TIGR00262		256	trpA tryptophan synthase, alpha subunit. Tryptopha	98.17
TIGR00423		309	radical SAM domain protein, CofH subfamily. This p	98.15
PLN02591		250	tryptophan synthase	98.12
TIGR03699		340	mena_SCO4550 menaquinone biosynthesis protein, SCO	98.11
TIGR03700		351	mena_SCO4494 putative menaquinone biosynthesis pro	98.1
CHL00200		263	trpA tryptophan synthase alpha subunit; Provisiona	98.09
TIGR03551		343	F420_cofH 7,8-didemethyl-8-hydroxy-5-deazariboflav	97.98
PRK13111		258	trpA tryptophan synthase subunit alpha; Provisiona	97.96
PRK08445		348	hypothetical protein; Provisional	97.94
PRK13125		244	trpA tryptophan synthase subunit alpha; Provisiona	97.67
PRK08444		353	hypothetical protein; Provisional	97.66
PRK07360		371	FO synthase subunit 2; Reviewed	97.65
PF00290		259	Trp_syntA: Tryptophan synthase alpha chain; InterP	97.52
COG0159		265	TrpA Tryptophan synthase alpha chain [Amino acid t	97.45
PRK07094		323	biotin synthase; Provisional	97.45
PRK15108		345	biotin synthase; Provisional	97.39
TIGR03128		206	RuMP_HxlA 3-hexulose-6-phosphate synthase. at the	97.38
PLN02389		379	biotin synthase	97.31
cd00945		201	Aldolase_Class_I Class I aldolases. The class I al	97.29
cd04726		202	KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxyl	97.22
PRK05927		350	hypothetical protein; Provisional	97.2
TIGR00433		296	bioB biotin synthetase. Catalyzes the last step of	97.16
PRK05926		370	hypothetical protein; Provisional	97.16
cd04724		242	Tryptophan_synthase_alpha Ttryptophan synthase (TR	97.13
PRK06256		336	biotin synthase; Validated	97.03
PRK06552		213	keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog	97.0
PRK05301		378	pyrroloquinoline quinone biosynthesis protein PqqE	96.98
PRK09613		469	thiH thiamine biosynthesis protein ThiH; Reviewed	96.92
TIGR01496		257	DHPS dihydropteroate synthase. This model represen	96.87
PRK13361		329	molybdenum cofactor biosynthesis protein A; Provis	96.85
PRK09240		371	thiH thiamine biosynthesis protein ThiH; Reviewed	96.72
PRK08508		279	biotin synthase; Provisional	96.69
PRK05718		212	keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog	96.61
TIGR02351		366	thiH thiazole biosynthesis protein ThiH. Members t	96.59
cd00452		190	KDPG_aldolase KDPG and KHG aldolase. This family b	96.55
PRK06245		336	cofG FO synthase subunit 1; Reviewed	96.54
TIGR02109		358	PQQ_syn_pqqE coenzyme PQQ biosynthesis protein E.	96.51
PRK13397		250	3-deoxy-7-phosphoheptulonate synthase; Provisional	96.5
TIGR01163		210	rpe ribulose-phosphate 3-epimerase. This family co	96.43
TIGR03550		322	F420_cofG 7,8-didemethyl-8-hydroxy-5-deazariboflav	96.43
TIGR01182		204	eda Entner-Doudoroff aldolase. 2-deydro-3-deoxypho	96.42
PRK09997		258	hydroxypyruvate isomerase; Provisional	96.37
COG0269		217	SgbH 3-hexulose-6-phosphate synthase and related p	96.34
TIGR01769		205	GGGP geranylgeranylglyceryl phosphate synthase. Th	96.3
TIGR03470		318	HpnH hopanoid biosynthesis associated radical SAM	96.29
PLN02951		373	Molybderin biosynthesis protein CNX2	96.22
PRK13307		391	bifunctional formaldehyde-activating enzyme/3-hexu	96.2
cd00331		217	IGPS Indole-3-glycerol phosphate synthase (IGPS);	96.19
PRK09234		843	fbiC FO synthase; Reviewed	96.15
PRK09140		206	2-dehydro-3-deoxy-6-phosphogalactonate aldolase; R	96.15
PRK09856		275	fructoselysine 3-epimerase; Provisional	96.14
PRK06801		286	hypothetical protein; Provisional	96.12
cd00954		288	NAL N-Acetylneuraminic acid aldolase, also called	96.09
PRK06015		201	keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog	96.06
COG0502		335	BioB Biotin synthase and related enzymes [Coenzyme	96.04
PRK13209		283	L-xylulose 5-phosphate 3-epimerase; Reviewed	96.03
TIGR01859		282	fruc_bis_ald_ fructose-1,6-bisphosphate aldolase,	95.98
TIGR02320		285	PEP_mutase phosphoenolpyruvate phosphomutase. A cl	95.98
TIGR03234		254	OH-pyruv-isom hydroxypyruvate isomerase. This enzy	95.95
TIGR02320		285	PEP_mutase phosphoenolpyruvate phosphomutase. A cl	95.9
cd04740		296	DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) c	95.88
PRK00507		221	deoxyribose-phosphate aldolase; Provisional	95.86
PRK13210		284	putative L-xylulose 5-phosphate 3-epimerase; Revie	95.86
TIGR00126		211	deoC deoxyribose-phosphate aldolase. Deoxyribose-p	95.78
PRK07998		283	gatY putative fructose-1,6-bisphosphate aldolase;	95.76
KOG4175		268	consensus Tryptophan synthase alpha chain [Amino a	95.72
cd00408		281	DHDPS-like Dihydrodipicolinate synthase family. A	95.71
PRK00164		331	moaA molybdenum cofactor biosynthesis protein A; R	95.71
cd00959		203	DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of	95.69
PRK01060		281	endonuclease IV; Provisional	95.67
PRK07315		293	fructose-bisphosphate aldolase; Provisional	95.65
COG2896		322	MoaA Molybdenum cofactor biosynthesis enzyme [Coen	95.64
PRK11320		292	prpB 2-methylisocitrate lyase; Provisional	95.59
cd00950		284	DHDPS Dihydrodipicolinate synthase (DHDPS) is a ke	95.58
PRK07114		222	keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog	95.56
cd02810		289	DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD)	95.5
PRK13398		266	3-deoxy-7-phosphoheptulonate synthase; Provisional	95.5
cd00019		279	AP2Ec AP endonuclease family 2; These endonuclease	95.43
cd00739		257	DHPS DHPS subgroup of Pterin binding enzymes. DHPS	95.38
TIGR00542		279	hxl6Piso_put hexulose-6-phosphate isomerase, putat	95.31
PRK07709		285	fructose-bisphosphate aldolase; Provisional	95.3
TIGR02666		334	moaA molybdenum cofactor biosynthesis protein A, b	95.3
cd00423		258	Pterin_binding Pterin binding enzymes. This family	95.28
PRK06267		350	hypothetical protein; Provisional	95.27
PRK12928		290	lipoyl synthase; Provisional	95.2
PRK09196		347	fructose-1,6-bisphosphate aldolase; Reviewed	95.18
PRK08185		283	hypothetical protein; Provisional	95.05
TIGR02313		294	HpaI-NOT-DapA 2,4-dihydroxyhept-2-ene-1,7-dioic ac	95.01
TIGR03249		296	KdgD 5-dehydro-4-deoxyglucarate dehydratase. 5-deh	94.93
cd00952		309	CHBPH_aldolase Trans-o-hydroxybenzylidenepyruvate	94.93
PRK09195		284	gatY tagatose-bisphosphate aldolase; Reviewed	94.82
TIGR02319		294	CPEP_Pphonmut carboxyvinyl-carboxyphosphonate phos	94.82
PRK00278		260	trpC indole-3-glycerol-phosphate synthase; Reviewe	94.77
TIGR03581		236	EF_0839 conserved hypothetical protein EF_0839/AHA	94.77
PRK09989		258	hypothetical protein; Provisional	94.76
TIGR00587		274	nfo apurinic endonuclease (APN1). All proteins in	94.71
COG2100		414	Predicted Fe-S oxidoreductase [General function pr	94.68
PF01081		196	Aldolase: KDPG and KHG aldolase; InterPro: IPR0008	94.67
TIGR01858		282	tag_bisphos_ald class II aldolase, tagatose bispho	94.67
PTZ00413		398	lipoate synthase; Provisional	94.65
PRK12857		284	fructose-1,6-bisphosphate aldolase; Reviewed	94.62
PRK12595		360	bifunctional 3-deoxy-7-phosphoheptulonate synthase	94.57
COG1060		370	ThiH Thiamine biosynthesis enzyme ThiH and related	94.56
TIGR00284		499	dihydropteroate synthase-related protein. This pro	94.56
PF00701		289	DHDPS: Dihydrodipicolinate synthetase family; Inte	94.56
cd00951		289	KDGDH 5-dehydro-4-deoxyglucarate dehydratase, also	94.52
PF04055		166	Radical_SAM: Radical SAM superfamily; InterPro: IP	94.51
PRK08610		286	fructose-bisphosphate aldolase; Reviewed	94.5
TIGR02317		285	prpB methylisocitrate lyase. Members of this famil	94.46
TIGR02668		302	moaA_archaeal probable molybdenum cofactor biosynt	94.44
PF01261		213	AP_endonuc_2: Xylose isomerase-like TIM barrel; In	94.39
TIGR00674		285	dapA dihydrodipicolinate synthase. Dihydrodipicoli	94.39
smart00729		216	Elp3 Elongator protein 3, MiaB family, Radical SAM	94.32
PRK07535		261	methyltetrahydrofolate:corrinoid/iron-sulfur prote	94.29
COG0329		299	DapA Dihydrodipicolinate synthase/N-acetylneuramin	94.16
PRK13399		347	fructose-1,6-bisphosphate aldolase; Provisional	94.14
PRK12738		286	kbaY tagatose-bisphosphate aldolase; Reviewed	94.14
PLN02428		349	lipoic acid synthase	94.12
COG2513		289	PrpB PEP phosphonomutase and related enzymes [Carb	94.1
PRK13585		241	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met	94.08
TIGR00167		288	cbbA ketose-bisphosphate aldolases. fructose-bisph	94.06
PRK07084		321	fructose-bisphosphate aldolase; Provisional	94.02
COG2876		286	AroA 3-deoxy-D-arabino-heptulosonate 7-phosphate (	93.92
TIGR01521		347	FruBisAldo_II_B fructose-bisphosphate aldolase, cl	93.81
PF04131		192	NanE: Putative N-acetylmannosamine-6-phosphate epi	93.81
cd04732		234	HisA HisA. Phosphoribosylformimino-5-aminoimidazol	93.78
cd00947		276	TBP_aldolase_IIB Tagatose-1,6-bisphosphate (TBP) a	93.76
TIGR00735		254	hisF imidazoleglycerol phosphate synthase, cyclase	93.76
TIGR01290		442	nifB nitrogenase cofactor biosynthesis protein Nif	93.68
smart00518		273	AP2Ec AP endonuclease family 2. These endonuclease	93.64
TIGR01496		257	DHPS dihydropteroate synthase. This model represen	93.62
TIGR01361		260	DAHP_synth_Bsub phospho-2-dehydro-3-deoxyheptonate	93.53
TIGR01037		300	pyrD_sub1_fam dihydroorotate dehydrogenase (subfam	93.52
PRK13813		215	orotidine 5'-phosphate decarboxylase; Provisional	93.5
COG2513		289	PrpB PEP phosphonomutase and related enzymes [Carb	93.49
COG0274		228	DeoC Deoxyribose-phosphate aldolase [Nucleotide tr	93.48
PRK07455		187	keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog	93.47
COG0800		211	Eda 2-keto-3-deoxy-6-phosphogluconate aldolase [Ca	93.42
PRK12737		284	gatY tagatose-bisphosphate aldolase; Reviewed	93.42
TIGR01303		475	IMP_DH_rel_1 IMP dehydrogenase family protein. Thi	93.4
PRK09234		843	fbiC FO synthase; Reviewed	93.37
cd00958		235	DhnA Class I fructose-1,6-bisphosphate (FBP) aldol	93.35
cd00429		211	RPE Ribulose-5-phosphate 3-epimerase (RPE). This e	93.31
PRK07259		301	dihydroorotate dehydrogenase 1B; Reviewed	93.23
cd00377		243	ICL_PEPM Members of the ICL/PEPM enzyme family cat	93.17
PRK13753		279	dihydropteroate synthase; Provisional	93.16
PRK15108		345	biotin synthase; Provisional	93.12
PRK05835		307	fructose-bisphosphate aldolase; Provisional	93.03
COG0826		347	Collagenase and related proteases [Posttranslation	93.02
TIGR00539		360	hemN_rel putative oxygen-independent coproporphyri	93.01
TIGR02317		285	prpB methylisocitrate lyase. Members of this famil	92.98
cd04722		200	TIM_phosphate_binding TIM barrel proteins share a	92.94
TIGR03586		327	PseI pseudaminic acid synthase.	92.83
cd02940		299	DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FM	92.81
cd00377		243	ICL_PEPM Members of the ICL/PEPM enzyme family cat	92.74
cd00952		309	CHBPH_aldolase Trans-o-hydroxybenzylidenepyruvate	92.72
PRK13396		352	3-deoxy-7-phosphoheptulonate synthase; Provisional	92.72
PRK11320		292	prpB 2-methylisocitrate lyase; Provisional	92.71
PF13714		238	PEP_mutase: Phosphoenolpyruvate phosphomutase; PDB	92.68
COG1082		274	IolE Sugar phosphate isomerases/epimerases [Carboh	92.66
TIGR00538		455	hemN oxygen-independent coproporphyrinogen III oxi	92.62
cd06556		240	ICL_KPHMT Members of the ICL/PEPM_KPHMT enzyme sup	92.59
cd04731		243	HisF The cyclase subunit of imidazoleglycerol phos	92.53
PRK05660		378	HemN family oxidoreductase; Provisional	92.53
TIGR00510		302	lipA lipoate synthase. The family shows strong seq	92.51
PRK15452		443	putative protease; Provisional	92.46
cd02933		338	OYE_like_FMN Old yellow enzyme (OYE)-like FMN bind	92.44
PRK10481		224	hypothetical protein; Provisional	92.39
PRK04147		293	N-acetylneuraminate lyase; Provisional	92.34
PRK06096		284	molybdenum transport protein ModD; Provisional	92.31
cd02803		327	OYE_like_FMN_family Old yellow enzyme (OYE)-like F	92.3
TIGR00683		290	nanA N-acetylneuraminate lyase. N-acetylneuraminat	92.3
TIGR01334		277	modD putative molybdenum utilization protein ModD.	92.28
PRK09249		453	coproporphyrinogen III oxidase; Provisional	92.25
PF01116		287	F_bP_aldolase: Fructose-bisphosphate aldolase clas	92.21
TIGR00683		290	nanA N-acetylneuraminate lyase. N-acetylneuraminat	92.2
PRK03170		292	dihydrodipicolinate synthase; Provisional	92.17
PRK08673		335	3-deoxy-7-phosphoheptulonate synthase; Reviewed	92.13
PRK03170		292	dihydrodipicolinate synthase; Provisional	92.13
PRK06806		281	fructose-bisphosphate aldolase; Provisional	92.04
PF03102		241	NeuB: NeuB family; InterPro: IPR013132 NeuB is the	92.02
cd00951		289	KDGDH 5-dehydro-4-deoxyglucarate dehydratase, also	92.0
PRK13347		453	coproporphyrinogen III oxidase; Provisional	91.98
cd04733		338	OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN	91.81
TIGR01361		260	DAHP_synth_Bsub phospho-2-dehydro-3-deoxyheptonate	91.81
TIGR03569		329	NeuB_NnaB N-acetylneuraminate synthase. This famil	91.81
cd01572		268	QPRTase Quinolinate phosphoribosyl transferase (QA	91.63
PRK04165		450	acetyl-CoA decarbonylase/synthase complex subunit	91.57
PRK01130		221	N-acetylmannosamine-6-phosphate 2-epimerase; Provi	91.56
TIGR02319		294	CPEP_Pphonmut carboxyvinyl-carboxyphosphonate phos	91.51
PRK03620		303	5-dehydro-4-deoxyglucarate dehydratase; Provisiona	91.5
PRK08446		350	coproporphyrinogen III oxidase; Provisional	91.46
cd02930		353	DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-bindin	91.45
PRK08318		420	dihydropyrimidine dehydrogenase subunit B; Validat	91.45
PRK05481		289	lipoyl synthase; Provisional	91.41
PF00701		289	DHDPS: Dihydrodipicolinate synthetase family; Inte	91.39
PRK03620		303	5-dehydro-4-deoxyglucarate dehydratase; Provisiona	91.39
COG1856		275	Uncharacterized homolog of biotin synthetase [Func	91.34
TIGR03822		321	AblA_like_2 lysine-2,3-aminomutase-related protein	91.34
cd04740		296	DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) c	91.32
TIGR02631		382	xylA_Arthro xylose isomerase, Arthrobacter type. T	91.31
PRK13398		266	3-deoxy-7-phosphoheptulonate synthase; Provisional	91.25
cd01568		269	QPRTase_NadC Quinolinate phosphoribosyl transferas	91.24
cd00950		284	DHDPS Dihydrodipicolinate synthase (DHDPS) is a ke	91.21
cd04728		248	ThiG Thiazole synthase (ThiG) is the tetrameric en	91.17
TIGR03249		296	KdgD 5-dehydro-4-deoxyglucarate dehydratase. 5-deh	91.16
PRK07107		502	inosine 5-monophosphate dehydrogenase; Validated	91.1
TIGR03849		237	arch_ComA phosphosulfolactate synthase. This model	91.04
PLN02858		1378	fructose-bisphosphate aldolase	91.0
PRK04147		293	N-acetylneuraminate lyase; Provisional	90.88
TIGR02313		294	HpaI-NOT-DapA 2,4-dihydroxyhept-2-ene-1,7-dioic ac	90.82
TIGR03551		343	F420_cofH 7,8-didemethyl-8-hydroxy-5-deazariboflav	90.77
TIGR01210		313	conserved hypothetical protein TIGR01210. This fam	90.7
TIGR00674		285	dapA dihydrodipicolinate synthase. Dihydrodipicoli	90.69
PTZ00170		228	D-ribulose-5-phosphate 3-epimerase; Provisional	90.66
cd01335		204	Radical_SAM Radical SAM superfamily. Enzymes of th	90.65
PLN02417		280	dihydrodipicolinate synthase	90.63
COG3473		238	Maleate cis-trans isomerase [Secondary metabolites	90.56
COG0191		286	Fba Fructose/tagatose bisphosphate aldolase [Carbo	90.47
cd06557		254	KPHMT-like Ketopantoate hydroxymethyltransferase (	90.4
PRK12595		360	bifunctional 3-deoxy-7-phosphoheptulonate synthase	90.33
PRK02083		253	imidazole glycerol phosphate synthase subunit HisF	90.29
PLN02417		280	dihydrodipicolinate synthase	90.28
cd00408		281	DHDPS-like Dihydrodipicolinate synthase family. A	90.23
cd00954		288	NAL N-Acetylneuraminic acid aldolase, also called	90.22
PRK00311		264	panB 3-methyl-2-oxobutanoate hydroxymethyltransfer	90.1
COG2089		347	SpsE Sialic acid synthase [Cell envelope biogenesi	90.04
PRK11613		282	folP dihydropteroate synthase; Provisional	90.04
PRK05628		375	coproporphyrinogen III oxidase; Validated	90.01
PRK09240		371	thiH thiamine biosynthesis protein ThiH; Reviewed	90.0
PRK05799		374	coproporphyrinogen III oxidase; Provisional	89.97
TIGR03586		327	PseI pseudaminic acid synthase.	89.97
PF02679		244	ComA: (2R)-phospho-3-sulfolactate synthase (ComA);	89.95
PRK00366		360	ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate s	89.88
cd00959		203	DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of	89.86
PTZ00170		228	D-ribulose-5-phosphate 3-epimerase; Provisional	89.86
TIGR02321		290	Pphn_pyruv_hyd phosphonopyruvate hydrolase. This f	89.83
TIGR02026		497	BchE magnesium-protoporphyrin IX monomethyl ester	89.72
TIGR00284		499	dihydropteroate synthase-related protein. This pro	89.67
cd02801		231	DUS_like_FMN Dihydrouridine synthase-like (DUS-lik	89.64
PRK06843		404	inosine 5-monophosphate dehydrogenase; Validated	89.62
TIGR00007		230	phosphoribosylformimino-5-aminoimidazole carboxami	89.62
PRK13397		250	3-deoxy-7-phosphoheptulonate synthase; Provisional	89.61
PRK00748		233	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met	89.6
COG0635		416	HemN Coproporphyrinogen III oxidase and related Fe	89.51
cd01320		325	ADA Adenosine deaminase (ADA) is a monomeric zinc	89.38
cd04724		242	Tryptophan_synthase_alpha Ttryptophan synthase (TR	89.37
PRK12677		384	xylose isomerase; Provisional	89.31
cd04735		353	OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN	89.3
TIGR01304		369	IMP_DH_rel_2 IMP dehydrogenase family protein. Thi	89.26
PRK09490		1229	metH B12-dependent methionine synthase; Provisiona	89.23
PRK13745		412	anaerobic sulfatase-maturase; Provisional	89.16
PTZ00372		413	endonuclease 4-like protein; Provisional	89.11
PRK07259		301	dihydroorotate dehydrogenase 1B; Reviewed	89.05
PRK08208		430	coproporphyrinogen III oxidase; Validated	89.03
COG0329		299	DapA Dihydrodipicolinate synthase/N-acetylneuramin	88.99
TIGR01211		522	ELP3 histone acetyltransferase, ELP3 family. The S	88.97
PRK10605		362	N-ethylmaleimide reductase; Provisional	88.95
TIGR00222		263	panB 3-methyl-2-oxobutanoate hydroxymethyltransfer	88.89
PRK05283		257	deoxyribose-phosphate aldolase; Provisional	88.88
cd00953		279	KDG_aldolase KDG (2-keto-3-deoxygluconate) aldolas	88.87
PRK08227		264	autoinducer 2 aldolase; Validated	88.87
PRK07565		334	dihydroorotate dehydrogenase 2; Reviewed	88.83
COG0535		347	Predicted Fe-S oxidoreductases [General function p	88.76
COG0821		361	gcpE 1-hydroxy-2-methyl-2-(e)-butenyl 4-diphosphat	88.75
PRK00115		346	hemE uroporphyrinogen decarboxylase; Validated	88.64
TIGR00612		346	ispG_gcpE 1-hydroxy-2-methyl-2-(E)-butenyl 4-dipho	88.63
PRK07226		267	fructose-bisphosphate aldolase; Provisional	88.62
TIGR00343		287	pyridoxal 5'-phosphate synthase, synthase subunit	88.61
COG3623		287	SgaU Putative L-xylulose-5-phosphate 3-epimerase [	88.6
cd03315		265	MLE_like Muconate lactonizing enzyme (MLE) like su	88.56
PRK08508		279	biotin synthase; Provisional	88.51
cd04739		325	DHOD_like Dihydroorotate dehydrogenase (DHOD) like	88.49
TIGR01740		213	pyrF orotidine 5'-phosphate decarboxylase, subfami	88.44
cd04734		343	OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN	88.4
cd02810		289	DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD)	88.36
TIGR01949		258	AroFGH_arch predicted phospho-2-dehydro-3-deoxyhep	88.3
PRK00112		366	tgt queuine tRNA-ribosyltransferase; Provisional	88.25
PF13714		238	PEP_mutase: Phosphoenolpyruvate phosphomutase; PDB	88.24
PF02679		244	ComA: (2R)-phospho-3-sulfolactate synthase (ComA);	88.23
PRK14024		241	phosphoribosyl isomerase A; Provisional	88.23
PRK13396		352	3-deoxy-7-phosphoheptulonate synthase; Provisional	88.22
PRK13111		258	trpA tryptophan synthase subunit alpha; Provisiona	88.19
PRK05904		353	coproporphyrinogen III oxidase; Provisional	88.07
PRK07094		323	biotin synthase; Provisional	88.05
cd04727		283	pdxS PdxS is a subunit of the pyridoxal 5'-phospha	88.01
PF07302		221	AroM: AroM protein; InterPro: IPR010843 This famil	87.98
COG1244		358	Predicted Fe-S oxidoreductase [General function pr	87.92
cd00405		203	PRAI Phosphoribosylanthranilate isomerase (PRAI) c	87.69
TIGR03471		472	HpnJ hopanoid biosynthesis associated radical SAM	87.68
PRK05581		220	ribulose-phosphate 3-epimerase; Validated	87.66
PTZ00314		495	inosine-5'-monophosphate dehydrogenase; Provisiona	87.64
PRK06801		286	hypothetical protein; Provisional	87.52
PRK13523		337	NADPH dehydrogenase NamA; Provisional	87.46
PRK08673		335	3-deoxy-7-phosphoheptulonate synthase; Reviewed	87.34
cd06556		240	ICL_KPHMT Members of the ICL/PEPM_KPHMT enzyme sup	87.3
TIGR02321		290	Pphn_pyruv_hyd phosphonopyruvate hydrolase. This f	87.24
TIGR00736		231	nifR3_rel_arch TIM-barrel protein, putative. Membe	87.22
cd02932		336	OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN	87.11
TIGR00078		265	nadC nicotinate-nucleotide pyrophosphorylase. Syno	87.11
PRK08072		277	nicotinate-nucleotide pyrophosphorylase; Provision	87.05
TIGR01859		282	fruc_bis_ald_ fructose-1,6-bisphosphate aldolase,	87.02
cd00945		201	Aldolase_Class_I Class I aldolases. The class I al	87.01
TIGR03569		329	NeuB_NnaB N-acetylneuraminate synthase. This famil	86.92
PRK08207		488	coproporphyrinogen III oxidase; Provisional	86.91
PF01702		238	TGT: Queuine tRNA-ribosyltransferase; InterPro: IP	86.89
PF03102		241	NeuB: NeuB family; InterPro: IPR013132 NeuB is the	86.77
PLN02623		581	pyruvate kinase	86.77
PLN02424		332	ketopantoate hydroxymethyltransferase	86.73
PRK07360		371	FO synthase subunit 2; Reviewed	86.71
PRK07428		288	nicotinate-nucleotide pyrophosphorylase; Provision	86.71
TIGR00737		319	nifR3_yhdG putative TIM-barrel protein, nifR3 fami	86.67
PRK00208		250	thiG thiazole synthase; Reviewed	86.59
PRK09250		348	fructose-bisphosphate aldolase; Provisional	86.53
PF09370		268	TIM-br_sig_trns: TIM-barrel signal transduction pr	86.49
PRK06852		304	aldolase; Validated	86.47
TIGR03572		232	WbuZ glycosyl amidation-associated protein WbuZ. T	86.11
cd03315		265	MLE_like Muconate lactonizing enzyme (MLE) like su	86.04
cd04729		219	NanE N-acetylmannosamine-6-phosphate epimerase (Na	85.94
PRK00694		606	4-hydroxy-3-methylbut-2-en-1-yl diphosphate syntha	85.93
PRK09197		350	fructose-bisphosphate aldolase; Provisional	85.84
PF01791		236	DeoC: DeoC/LacD family aldolase; InterPro: IPR0029	85.78
PF04551		359	GcpE: GcpE protein; InterPro: IPR004588 This prote	85.78
PRK12737		284	gatY tagatose-bisphosphate aldolase; Reviewed	85.7
cd02803		327	OYE_like_FMN_family Old yellow enzyme (OYE)-like F	85.68
PF04481		242	DUF561: Protein of unknown function (DUF561); Inte	85.65
cd01299		342	Met_dep_hydrolase_A Metallo-dependent hydrolases,	85.62
TIGR02990		239	ectoine_eutA ectoine utilization protein EutA. Mem	85.59
PRK09875		292	putative hydrolase; Provisional	85.4
PRK07379		400	coproporphyrinogen III oxidase; Provisional	85.16
KOG3111		224	consensus D-ribulose-5-phosphate 3-epimerase [Carb	85.09
PRK02048		611	4-hydroxy-3-methylbut-2-en-1-yl diphosphate syntha	84.96
cd07937		275	DRE_TIM_PC_TC_5S Pyruvate carboxylase and Transcar	84.94
TIGR00222		263	panB 3-methyl-2-oxobutanoate hydroxymethyltransfer	84.92
TIGR01464		338	hemE uroporphyrinogen decarboxylase. This model re	84.91
TIGR03821		321	AblA_like_1 lysine-2,3-aminomutase-related protein	84.74
cd04747		361	OYE_like_5_FMN Old yellow enzyme (OYE)-related FMN	84.73
TIGR03849		237	arch_ComA phosphosulfolactate synthase. This model	84.67
TIGR03700		351	mena_SCO4494 putative menaquinone biosynthesis pro	84.53
TIGR03234		254	OH-pyruv-isom hydroxypyruvate isomerase. This enzy	84.52
PRK07565		334	dihydroorotate dehydrogenase 2; Reviewed	84.48
PRK07896		289	nicotinate-nucleotide pyrophosphorylase; Provision	84.47
PRK12738		286	kbaY tagatose-bisphosphate aldolase; Reviewed	84.47
PRK05283		257	deoxyribose-phosphate aldolase; Provisional	84.4
TIGR01302		450	IMP_dehydrog inosine-5'-monophosphate dehydrogenas	84.31
PRK05848		273	nicotinate-nucleotide pyrophosphorylase; Provision	84.29
COG0167		310	PyrD Dihydroorotate dehydrogenase [Nucleotide tran	84.27
PRK01008		372	queuine tRNA-ribosyltransferase; Provisional	84.22
PF04273		110	DUF442: Putative phosphatase (DUF442); InterPro: I	84.17
COG0274		228	DeoC Deoxyribose-phosphate aldolase [Nucleotide tr	84.01
PRK06294		370	coproporphyrinogen III oxidase; Provisional	83.95
cd04741		294	DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) c	83.85
PLN02495		385	oxidoreductase, acting on the CH-CH group of donor	83.85
PRK05265		239	pyridoxine 5'-phosphate synthase; Provisional	83.83
TIGR00559		237	pdxJ pyridoxine 5'-phosphate synthase. PdxJ is req	83.82
cd00958		235	DhnA Class I fructose-1,6-bisphosphate (FBP) aldol	83.68
COG0502		335	BioB Biotin synthase and related enzymes [Coenzyme	83.68
cd00947		276	TBP_aldolase_IIB Tagatose-1,6-bisphosphate (TBP) a	83.67
PRK05567		486	inosine 5'-monophosphate dehydrogenase; Reviewed	83.59
PRK11613		282	folP dihydropteroate synthase; Provisional	83.58
PLN02389		379	biotin synthase	83.34
cd04722		200	TIM_phosphate_binding TIM barrel proteins share a	83.22
cd04733		338	OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN	83.18
COG0036		220	Rpe Pentose-5-phosphate-3-epimerase [Carbohydrate	82.83
PRK09195		284	gatY tagatose-bisphosphate aldolase; Reviewed	82.8
cd02940		299	DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FM	82.76
PF04481		242	DUF561: Protein of unknown function (DUF561); Inte	82.74
PRK12581		468	oxaloacetate decarboxylase; Provisional	82.73
cd06557		254	KPHMT-like Ketopantoate hydroxymethyltransferase (	82.68
PLN02433		345	uroporphyrinogen decarboxylase	82.65
PF04476		235	DUF556: Protein of unknown function (DUF556); Inte	82.45
cd04739		325	DHOD_like Dihydroorotate dehydrogenase (DHOD) like	82.45
PRK08185		283	hypothetical protein; Provisional	82.24
PRK09358		340	adenosine deaminase; Provisional	82.2
PRK05718		212	keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog	82.17
PRK13210		284	putative L-xylulose 5-phosphate 3-epimerase; Revie	82.15
TIGR02493		235	PFLA pyruvate formate-lyase 1-activating enzyme. A	82.14
TIGR01858		282	tag_bisphos_ald class II aldolase, tagatose bispho	82.11
cd00953		279	KDG_aldolase KDG (2-keto-3-deoxygluconate) aldolas	82.1
PRK12857		284	fructose-1,6-bisphosphate aldolase; Reviewed	82.09
COG1830		265	FbaB DhnA-type fructose-1,6-bisphosphate aldolase	82.05
PRK05985		391	cytosine deaminase; Provisional	81.9
cd03174		265	DRE_TIM_metallolyase DRE-TIM metallolyase superfam	81.87
PRK05742		277	nicotinate-nucleotide pyrophosphorylase; Provision	81.81
PRK06252		339	methylcobalamin:coenzyme M methyltransferase; Vali	81.6
TIGR01302		450	IMP_dehydrog inosine-5'-monophosphate dehydrogenas	81.57
PLN02433		345	uroporphyrinogen decarboxylase	81.43
TIGR00449		367	tgt_general tRNA-guanine transglycosylases, variou	81.36
cd04730		236	NPD_like 2-Nitropropane dioxygenase (NPD), one of	81.35
TIGR02666		334	moaA molybdenum cofactor biosynthesis protein A, b	81.21
TIGR00430		368	Q_tRNA_tgt tRNA-guanine transglycosylase, queuosin	81.15
TIGR00262		256	trpA tryptophan synthase, alpha subunit. Tryptopha	81.1
PRK08599		377	coproporphyrinogen III oxidase; Provisional	81.09
PRK00311		264	panB 3-methyl-2-oxobutanoate hydroxymethyltransfer	80.97
PRK14340		445	(dimethylallyl)adenosine tRNA methylthiotransferas	80.91
PRK09057		380	coproporphyrinogen III oxidase; Provisional	80.8
PTZ00314		495	inosine-5'-monophosphate dehydrogenase; Provisiona	80.8
PRK04180		293	pyridoxal biosynthesis lyase PdxS; Provisional	80.79
PRK06256		336	biotin synthase; Validated	80.78
PF02548		261	Pantoate_transf: Ketopantoate hydroxymethyltransfe	80.65
cd00717		335	URO-D Uroporphyrinogen decarboxylase (URO-D) is a	80.45
PRK15063		428	isocitrate lyase; Provisional	80.41
cd02931		382	ER_like_FMN Enoate reductase (ER)-like FMN-binding	80.35
PRK11858		378	aksA trans-homoaconitate synthase; Reviewed	80.31
PLN02951		373	Molybderin biosynthesis protein CNX2	80.28
PRK13758		370	anaerobic sulfatase-maturase; Provisional	80.24
cd03309		321	CmuC_like CmuC_like. Proteins similar to the putat	80.15
TIGR01212		302	radical SAM protein, TIGR01212 family. This unchar	80.12

>PLN02321 2-isopropylmalate synthase	Back alignment and domain information

Probab=100.00  E-value=3e-98  Score=802.25  Aligned_cols=392  Identities=82%  Similarity=1.201  Sum_probs=365.9

Q ss_pred             cccCCCCCCCCCCccccCCCCCCCCCCCCCCceEEEeCCCCcCCCCCCCCCCHHHHHHHHHHHhHcCCCEEEEccCCCCh
Q 013498           48 SCSLQKPPPSLYPRITATRPEYIPNRIPDPNYVRVFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDIIEAGFPAASK  127 (442)
Q Consensus        48 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~V~I~DtTLRDG~Q~~g~~fs~e~kl~ia~~L~~~GV~~IEvG~p~~~~  127 (442)
                      .|+....++......+++||+|+|+.|++|++|+|+|||||||+|+++..|+.++|++|++.|+++||+.||+|||.++|
T Consensus        55 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~V~I~DtTLRDGeQ~~g~~~s~eeKl~Ia~~L~~lGVd~IEvGfP~~Sp  134 (632)
T PLN02321         55 ASSALAASPSRPQVARRPRPEYIPNRIDDPNYVRIFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDIIEAGFPIASP  134 (632)
T ss_pred             hhhccCCCcccccccccCCcccccccCCCCCceEEEECCCCccccCCCCCCCHHHHHHHHHHHHHcCCCEEEEeCcCCCc
Confidence            34444455666666778999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hHHHHHHHHHHHhcccccccCCccceEeeecccchhhHHHHHHHHHhCCCCEEEEeecCChHHHHHHhCCCHHHHHHHHH
Q 013498          128 EDFEAVRTIAKEVGNAVDAESGYVPVICGLSRCNERDIKTAWEAVKYAKRPRIHTFIATSGIHMEHKLRKTKQQVVEIAR  207 (442)
Q Consensus       128 ~d~e~v~~l~~~~~~~~~~~~~l~~~i~~~~r~~~~dI~~a~e~l~~~g~~~v~i~~~~Sd~h~~~~l~~s~~e~l~~~~  207 (442)
                      .|+++++.|++.+++.+..+ .+++.|++|+|++.+||+++++++..++.++|++|+++||+|+++++++|++|+++++.
T Consensus       135 ~D~e~vr~i~~~~~~~v~~~-~~v~~i~a~~ra~~~dId~A~~al~~a~~~~I~i~~stSd~h~~~~l~~t~ee~l~~~~  213 (632)
T PLN02321        135 DDLEAVKTIAKEVGNEVDED-GYVPVICGLSRCNKKDIDAAWEAVKHAKRPRIHTFIATSEIHMEHKLRKTPDEVVEIAR  213 (632)
T ss_pred             cHHHHHHHHHHhcccCCCcc-ccceeeeeehhccHHhHHHHHHHhcCCCCCEEEEEEcCCHHHHHHHhCCCHHHHHHHHH
Confidence            99999999988754443333 66789999999999999999999887777899999999999999999999999999999


Q ss_pred             HHHHHHHHcCCCeEEEccCCCCCCCHHHHHHHHHHHHHcCCcEEeccCcccccCHHHHHHHHHHHHHhCCCCcceeEEEe
Q 013498          208 SMVKFARSLGCDDVEFSPEDAGRSDRKFLYEILGEVIKVGATTLNIPDTVGITMPTEFGKLIADIKANTPGIENVVISTH  287 (442)
Q Consensus       208 ~~v~~ar~~G~~~V~f~~edasr~d~~~l~~~~~~~~~~Gad~I~laDT~G~~~P~~v~~li~~l~~~~p~~~~v~i~~H  287 (442)
                      ++|++||++|+..|.|++||++|+|++|+.++++++.++|+++|+||||+|+++|++++++|+.+++++|+.++++|++|
T Consensus       214 ~~V~~Ak~~G~~~v~fs~EDa~rtd~d~l~~~~~~a~~aGa~~I~L~DTvG~~~P~~v~~li~~l~~~~~~~~~v~i~vH  293 (632)
T PLN02321        214 DMVKYARSLGCEDVEFSPEDAGRSDPEFLYRILGEVIKAGATTLNIPDTVGYTLPSEFGQLIADIKANTPGIENVIISTH  293 (632)
T ss_pred             HHHHHHHHcCCceEEEecccCCCCCHHHHHHHHHHHHHcCCCEEEecccccCCCHHHHHHHHHHHHHhcCCCCCceEEEE
Confidence            99999999998569999999999999999999999999999999999999999999999999999999986556889999


Q ss_pred             ecCCcchHHHHHHHHHHhCCCEEEecccccccccCcccHHHHHHHHHhccccccCCccCCCChhHHHHHHHHHHHHhCCC
Q 013498          288 CQNDLGLSTANTIAGACAGARQVEVTINGIGERAGNASLEEVVMAFKCRGEHILGGLYTGINTRHIVMASKMVEEYTGLH  367 (442)
Q Consensus       288 ~HNDlGLA~ANalaAl~aGa~~vd~Tv~GlGeraGNa~lEevv~~L~~~g~~~~~G~~tgidl~~L~~ls~~v~~~~g~~  367 (442)
                      ||||+|||+||+++|+++||++||+|++|||||+||++||+|+++|+.++...++|+.+++|+++|.++++++++++|++
T Consensus       294 ~HND~GlAvANslaAv~AGA~~Vd~TinGlGERaGNa~LEevv~~L~~~~~~~~~g~~tgidl~~L~~~s~~V~~~~g~~  373 (632)
T PLN02321        294 CQNDLGLSTANTLAGAHAGARQVEVTINGIGERAGNASLEEVVMAIKCRGDEQLGGLYTGINPVHITPTSKMVSEYTGMQ  373 (632)
T ss_pred             eCCCCCHHHHHHHHHHHhCCCEEEEecccccccccCccHHHHHHHHHhccCccccCcccccCHHHHHHHHHHHHHHhCcC
Confidence            99999999999999999999999999999999999999999999999876433468999999999999999999999999


Q ss_pred             CCCCCccccchhhhhccCccccccccCCCCCCCCCccccCCCccccceEEecccccHHHHHHHHHHcCCCccc
Q 013498          368 VQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIISPEDIGLERSSEAGIVLGKLSGRHALKDRLKEVCQYVIF  440 (442)
Q Consensus       368 i~~~~pivG~~aF~h~sGiH~dg~lk~~~~Ye~~~Pe~iG~~r~~~~~i~lg~~SG~~~v~~~l~e~G~~~~~  440 (442)
                      +++|+||||+|+|+|+|||||||++|||.+||||+||+||++|+++.+|+||||||+++|+++|+++||++++
T Consensus       374 v~~~kPiVG~naFaheSGIH~dgvlk~~~tYe~i~Pe~VG~~r~~~~~i~lgk~SGr~~v~~~L~~lG~~l~~  446 (632)
T PLN02321        374 VQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIISPEDIGLFRGNDAGIVLGKLSGRHALKSRLKELGYELDD  446 (632)
T ss_pred             CCCCcccccccceehhcCccHHHHccCcccccccCHHHhCCcccccceecccccccHHHHHHHHHHhCCCCCH
Confidence            9999999999999999999999999999999999999999988777889999999999999999999999874

>PLN03228 methylthioalkylmalate synthase; Provisional	Back alignment and domain information

>TIGR00973 leuA_bact 2-isopropylmalate synthase, bacterial type	Back alignment and domain information

>PRK00915 2-isopropylmalate synthase; Validated	Back alignment and domain information

>KOG2367 consensus Alpha-isopropylmalate synthase/homocitrate synthase [Amino acid transport and metabolism]	Back alignment and domain information

>PRK11858 aksA trans-homoaconitate synthase; Reviewed	Back alignment and domain information

>TIGR02660 nifV_homocitr homocitrate synthase NifV	Back alignment and domain information

>PRK09389 (R)-citramalate synthase; Provisional	Back alignment and domain information

>TIGR00977 LeuA_rel 2-isopropylmalate synthase/homocitrate synthase family protein	Back alignment and domain information

>PRK03739 2-isopropylmalate synthase; Validated	Back alignment and domain information

>TIGR02090 LEU1_arch isopropylmalate/citramalate/homocitrate synthases	Back alignment and domain information

>TIGR00970 leuA_yeast 2-isopropylmalate synthase, yeast type	Back alignment and domain information

>COG0119 LeuA Isopropylmalate/homocitrate/citramalate synthases [Amino acid transport and metabolism]	Back alignment and domain information

>PRK12344 putative alpha-isopropylmalate/homocitrate synthase family transferase; Provisional	Back alignment and domain information

>PRK14847 hypothetical protein; Provisional	Back alignment and domain information

>cd07945 DRE_TIM_CMS Leptospira interrogans citramalate synthase (CMS) and related proteins, N-terminal catalytic TIM barrel domain	Back alignment and domain information

>cd07942 DRE_TIM_LeuA Mycobacterium tuberculosis LeuA3 and related proteins, N-terminal catalytic TIM barrel domain	Back alignment and domain information

>cd07948 DRE_TIM_HCS Saccharomyces cerevisiae homocitrate synthase and related proteins, catalytic TIM barrel domain	Back alignment and domain information

>PLN02746 hydroxymethylglutaryl-CoA lyase	Back alignment and domain information

>cd07939 DRE_TIM_NifV Streptomyces rubellomurinus FrbC and related proteins, catalytic TIM barrel domain	Back alignment and domain information

>cd07940 DRE_TIM_IPMS 2-isopropylmalate synthase (IPMS), N-terminal catalytic TIM barrel domain	Back alignment and domain information

>PRK05692 hydroxymethylglutaryl-CoA lyase; Provisional	Back alignment and domain information

>TIGR02146 LysS_fung_arch homocitrate synthase	Back alignment and domain information

>cd07941 DRE_TIM_LeuA3 Desulfobacterium autotrophicum LeuA3 and related proteins, N-terminal catalytic TIM barrel domain	Back alignment and domain information

>cd07938 DRE_TIM_HMGL 3-hydroxy-3-methylglutaryl-CoA lyase, catalytic TIM barrel domain	Back alignment and domain information

>cd07947 DRE_TIM_Re_CS Clostridium kluyveri Re-citrate synthase and related proteins, catalytic TIM barrel domain	Back alignment and domain information

>cd03174 DRE_TIM_metallolyase DRE-TIM metallolyase superfamily	Back alignment and domain information

>cd07943 DRE_TIM_HOA 4-hydroxy-2-oxovalerate aldolase, N-terminal catalytic TIM barrel domain	Back alignment and domain information

>cd07937 DRE_TIM_PC_TC_5S Pyruvate carboxylase and Transcarboxylase 5S, carboxyltransferase domain	Back alignment and domain information

>cd07944 DRE_TIM_HOA_like 4-hydroxy-2-oxovalerate aldolase-like, N-terminal catalytic TIM barrel domain	Back alignment and domain information

>PF00682 HMGL-like: HMGL-like of this family is not conserved in other members	Back alignment and domain information

>PRK08195 4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic acid aldolase,; Validated	Back alignment and domain information

>PRK14040 oxaloacetate decarboxylase; Provisional	Back alignment and domain information

>TIGR03217 4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase	Back alignment and domain information

>PRK12330 oxaloacetate decarboxylase; Provisional	Back alignment and domain information

>TIGR01108 oadA oxaloacetate decarboxylase alpha subunit	Back alignment and domain information

>PRK12331 oxaloacetate decarboxylase; Provisional	Back alignment and domain information

>PRK09282 pyruvate carboxylase subunit B; Validated	Back alignment and domain information

>PRK14041 oxaloacetate decarboxylase; Provisional	Back alignment and domain information

>PRK12581 oxaloacetate decarboxylase; Provisional	Back alignment and domain information

>PRK12999 pyruvate carboxylase; Reviewed	Back alignment and domain information

>PRK14042 pyruvate carboxylase subunit B; Provisional	Back alignment and domain information

>TIGR01235 pyruv_carbox pyruvate carboxylase	Back alignment and domain information

>KOG2368 consensus Hydroxymethylglutaryl-CoA lyase [Energy production and conversion; Amino acid transport and metabolism]	Back alignment and domain information

>COG5016 Pyruvate/oxaloacetate carboxyltransferase [Energy production and conversion]	Back alignment and domain information

>COG1038 PycA Pyruvate carboxylase [Energy production and conversion]	Back alignment and domain information

>KOG0369 consensus Pyruvate carboxylase [Energy production and conversion]	Back alignment and domain information

>TIGR02146 LysS_fung_arch homocitrate synthase	Back alignment and domain information

>PRK07028 bifunctional hexulose-6-phosphate synthase/ribonuclease regulator; Validated	Back alignment and domain information

>TIGR00262 trpA tryptophan synthase, alpha subunit	Back alignment and domain information

>TIGR00423 radical SAM domain protein, CofH subfamily	Back alignment and domain information

>PLN02591 tryptophan synthase	Back alignment and domain information

>TIGR03699 mena_SCO4550 menaquinone biosynthesis protein, SCO4550 family	Back alignment and domain information

>TIGR03700 mena_SCO4494 putative menaquinone biosynthesis protein, SCO4494 family	Back alignment and domain information

>CHL00200 trpA tryptophan synthase alpha subunit; Provisional	Back alignment and domain information

>TIGR03551 F420_cofH 7,8-didemethyl-8-hydroxy-5-deazariboflavin synthase, CofH subunit	Back alignment and domain information

>PRK13111 trpA tryptophan synthase subunit alpha; Provisional	Back alignment and domain information

>PRK08445 hypothetical protein; Provisional	Back alignment and domain information

>PRK13125 trpA tryptophan synthase subunit alpha; Provisional	Back alignment and domain information

>PRK08444 hypothetical protein; Provisional	Back alignment and domain information

>PRK07360 FO synthase subunit 2; Reviewed	Back alignment and domain information

>PF00290 Trp_syntA: Tryptophan synthase alpha chain; InterPro: IPR002028 Tryptophan synthase (4	Back alignment and domain information

>COG0159 TrpA Tryptophan synthase alpha chain [Amino acid transport and metabolism]	Back alignment and domain information

>PRK07094 biotin synthase; Provisional	Back alignment and domain information

>PRK15108 biotin synthase; Provisional	Back alignment and domain information

>TIGR03128 RuMP_HxlA 3-hexulose-6-phosphate synthase	Back alignment and domain information

>PLN02389 biotin synthase	Back alignment and domain information

>cd00945 Aldolase_Class_I Class I aldolases	Back alignment and domain information

>cd04726 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxylase (KGPDC) and D-arabino-3-hexulose-6-phosphate synthase (HPS)	Back alignment and domain information

>PRK05927 hypothetical protein; Provisional	Back alignment and domain information

>TIGR00433 bioB biotin synthetase	Back alignment and domain information

>PRK05926 hypothetical protein; Provisional	Back alignment and domain information

>cd04724 Tryptophan_synthase_alpha Ttryptophan synthase (TRPS) alpha subunit (TSA)	Back alignment and domain information

>PRK06256 biotin synthase; Validated	Back alignment and domain information

>PRK06552 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional	Back alignment and domain information

>PRK05301 pyrroloquinoline quinone biosynthesis protein PqqE; Provisional	Back alignment and domain information

>PRK09613 thiH thiamine biosynthesis protein ThiH; Reviewed	Back alignment and domain information

>TIGR01496 DHPS dihydropteroate synthase	Back alignment and domain information

>PRK13361 molybdenum cofactor biosynthesis protein A; Provisional	Back alignment and domain information

>PRK09240 thiH thiamine biosynthesis protein ThiH; Reviewed	Back alignment and domain information

>PRK08508 biotin synthase; Provisional	Back alignment and domain information

>PRK05718 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional	Back alignment and domain information

>TIGR02351 thiH thiazole biosynthesis protein ThiH	Back alignment and domain information

>cd00452 KDPG_aldolase KDPG and KHG aldolase	Back alignment and domain information

>PRK06245 cofG FO synthase subunit 1; Reviewed	Back alignment and domain information

>TIGR02109 PQQ_syn_pqqE coenzyme PQQ biosynthesis protein E	Back alignment and domain information

>PRK13397 3-deoxy-7-phosphoheptulonate synthase; Provisional	Back alignment and domain information

>TIGR01163 rpe ribulose-phosphate 3-epimerase	Back alignment and domain information

>TIGR03550 F420_cofG 7,8-didemethyl-8-hydroxy-5-deazariboflavin synthase, CofG subunit	Back alignment and domain information

>TIGR01182 eda Entner-Doudoroff aldolase	Back alignment and domain information

>PRK09997 hydroxypyruvate isomerase; Provisional	Back alignment and domain information

>COG0269 SgbH 3-hexulose-6-phosphate synthase and related proteins [Carbohydrate transport and metabolism]	Back alignment and domain information

>TIGR01769 GGGP geranylgeranylglyceryl phosphate synthase	Back alignment and domain information

>TIGR03470 HpnH hopanoid biosynthesis associated radical SAM protein HpnH	Back alignment and domain information

>PLN02951 Molybderin biosynthesis protein CNX2	Back alignment and domain information

>PRK13307 bifunctional formaldehyde-activating enzyme/3-hexulose-6-phosphate synthase; Provisional	Back alignment and domain information

>cd00331 IGPS Indole-3-glycerol phosphate synthase (IGPS); an enzyme in the tryptophan biosynthetic pathway, catalyzing the ring closure reaction of 1-(o-carboxyphenylamino)-1-deoxyribulose-5-phosphate (CdRP) to indole-3-glycerol phosphate (IGP), accompanied by the release of carbon dioxide and water	Back alignment and domain information

>PRK09234 fbiC FO synthase; Reviewed	Back alignment and domain information

>PRK09140 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; Reviewed	Back alignment and domain information

>PRK09856 fructoselysine 3-epimerase; Provisional	Back alignment and domain information

>PRK06801 hypothetical protein; Provisional	Back alignment and domain information

>cd00954 NAL N-Acetylneuraminic acid aldolase, also called N-acetylneuraminate lyase (NAL), which catalyses the reversible aldol reaction of N-acetyl-D-mannosamine and pyruvate to give N-acetyl-D-neuraminic acid (D-sialic acid)	Back alignment and domain information

>PRK06015 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional	Back alignment and domain information

>COG0502 BioB Biotin synthase and related enzymes [Coenzyme metabolism]	Back alignment and domain information

>PRK13209 L-xylulose 5-phosphate 3-epimerase; Reviewed	Back alignment and domain information

>TIGR01859 fruc_bis_ald_ fructose-1,6-bisphosphate aldolase, class II, various bacterial and amitochondriate protist	Back alignment and domain information

>TIGR02320 PEP_mutase phosphoenolpyruvate phosphomutase	Back alignment and domain information

>TIGR03234 OH-pyruv-isom hydroxypyruvate isomerase	Back alignment and domain information

>TIGR02320 PEP_mutase phosphoenolpyruvate phosphomutase	Back alignment and domain information

>cd04740 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain	Back alignment and domain information

>PRK00507 deoxyribose-phosphate aldolase; Provisional	Back alignment and domain information

>PRK13210 putative L-xylulose 5-phosphate 3-epimerase; Reviewed	Back alignment and domain information

>TIGR00126 deoC deoxyribose-phosphate aldolase	Back alignment and domain information

>PRK07998 gatY putative fructose-1,6-bisphosphate aldolase; Reviewed	Back alignment and domain information

>KOG4175 consensus Tryptophan synthase alpha chain [Amino acid transport and metabolism]	Back alignment and domain information

>cd00408 DHDPS-like Dihydrodipicolinate synthase family	Back alignment and domain information

>PRK00164 moaA molybdenum cofactor biosynthesis protein A; Reviewed	Back alignment and domain information

>cd00959 DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of the DeoC family	Back alignment and domain information

>PRK01060 endonuclease IV; Provisional	Back alignment and domain information

>PRK07315 fructose-bisphosphate aldolase; Provisional	Back alignment and domain information

>COG2896 MoaA Molybdenum cofactor biosynthesis enzyme [Coenzyme metabolism]	Back alignment and domain information

>PRK11320 prpB 2-methylisocitrate lyase; Provisional	Back alignment and domain information

>cd00950 DHDPS Dihydrodipicolinate synthase (DHDPS) is a key enzyme in lysine biosynthesis	Back alignment and domain information

>PRK07114 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional	Back alignment and domain information

>cd02810 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain	Back alignment and domain information

>PRK13398 3-deoxy-7-phosphoheptulonate synthase; Provisional	Back alignment and domain information

>cd00019 AP2Ec AP endonuclease family 2; These endonucleases play a role in DNA repair	Back alignment and domain information

>cd00739 DHPS DHPS subgroup of Pterin binding enzymes	Back alignment and domain information

>TIGR00542 hxl6Piso_put hexulose-6-phosphate isomerase, putative	Back alignment and domain information

>PRK07709 fructose-bisphosphate aldolase; Provisional	Back alignment and domain information

>TIGR02666 moaA molybdenum cofactor biosynthesis protein A, bacterial	Back alignment and domain information

>cd00423 Pterin_binding Pterin binding enzymes	Back alignment and domain information

>PRK06267 hypothetical protein; Provisional	Back alignment and domain information

>PRK12928 lipoyl synthase; Provisional	Back alignment and domain information

>PRK09196 fructose-1,6-bisphosphate aldolase; Reviewed	Back alignment and domain information

>PRK08185 hypothetical protein; Provisional	Back alignment and domain information

>TIGR02313 HpaI-NOT-DapA 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase	Back alignment and domain information

>TIGR03249 KdgD 5-dehydro-4-deoxyglucarate dehydratase	Back alignment and domain information

>cd00952 CHBPH_aldolase Trans-o-hydroxybenzylidenepyruvate hydratase-aldolase (HBPHA) and trans-2'-carboxybenzalpyruvate hydratase-aldolase (CBPHA)	Back alignment and domain information

>PRK09195 gatY tagatose-bisphosphate aldolase; Reviewed	Back alignment and domain information

>TIGR02319 CPEP_Pphonmut carboxyvinyl-carboxyphosphonate phosphorylmutase	Back alignment and domain information

>PRK00278 trpC indole-3-glycerol-phosphate synthase; Reviewed	Back alignment and domain information

>TIGR03581 EF_0839 conserved hypothetical protein EF_0839/AHA_3917	Back alignment and domain information

>PRK09989 hypothetical protein; Provisional	Back alignment and domain information

>TIGR00587 nfo apurinic endonuclease (APN1)	Back alignment and domain information

>COG2100 Predicted Fe-S oxidoreductase [General function prediction only]	Back alignment and domain information

>PF01081 Aldolase: KDPG and KHG aldolase; InterPro: IPR000887 4-Hydroxy-2-oxoglutarate aldolase (4	Back alignment and domain information

>TIGR01858 tag_bisphos_ald class II aldolase, tagatose bisphosphate family	Back alignment and domain information

>PTZ00413 lipoate synthase; Provisional	Back alignment and domain information

>PRK12857 fructose-1,6-bisphosphate aldolase; Reviewed	Back alignment and domain information

>PRK12595 bifunctional 3-deoxy-7-phosphoheptulonate synthase/chorismate mutase; Reviewed	Back alignment and domain information

>COG1060 ThiH Thiamine biosynthesis enzyme ThiH and related uncharacterized enzymes [Coenzyme metabolism / General function prediction only]	Back alignment and domain information

>TIGR00284 dihydropteroate synthase-related protein	Back alignment and domain information

>PF00701 DHDPS: Dihydrodipicolinate synthetase family; InterPro: IPR002220 Dihydropicolinate synthase (DHDPS) is the key enzyme in lysine biosynthesis via the diaminopimelate pathway of prokaryotes, some phycomycetes and higher plants	Back alignment and domain information

>cd00951 KDGDH 5-dehydro-4-deoxyglucarate dehydratase, also called 5-keto-4-deoxy-glucarate dehydratase (KDGDH), which is member of dihydrodipicolinate synthase (DHDPS) family that comprises several pyruvate-dependent class I aldolases	Back alignment and domain information

>PF04055 Radical_SAM: Radical SAM superfamily; InterPro: IPR007197 Radical SAM proteins catalyze diverse reactions, including unusual methylations, isomerization, sulphur insertion, ring formation, anaerobic oxidation and protein radical formation	Back alignment and domain information

>PRK08610 fructose-bisphosphate aldolase; Reviewed	Back alignment and domain information

>TIGR02317 prpB methylisocitrate lyase	Back alignment and domain information

>TIGR02668 moaA_archaeal probable molybdenum cofactor biosynthesis protein A, archaeal	Back alignment and domain information

>PF01261 AP_endonuc_2: Xylose isomerase-like TIM barrel; InterPro: IPR012307 This TIM alpha/beta barrel structure is found in xylose isomerase (P19148 from SWISSPROT) and in endonuclease IV (P12638 from SWISSPROT, 3	Back alignment and domain information

>TIGR00674 dapA dihydrodipicolinate synthase	Back alignment and domain information

>smart00729 Elp3 Elongator protein 3, MiaB family, Radical SAM	Back alignment and domain information

>PRK07535 methyltetrahydrofolate:corrinoid/iron-sulfur protein methyltransferase; Validated	Back alignment and domain information

>COG0329 DapA Dihydrodipicolinate synthase/N-acetylneuraminate lyase [Amino acid transport and metabolism / Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PRK13399 fructose-1,6-bisphosphate aldolase; Provisional	Back alignment and domain information

>PRK12738 kbaY tagatose-bisphosphate aldolase; Reviewed	Back alignment and domain information

>PLN02428 lipoic acid synthase	Back alignment and domain information

>COG2513 PrpB PEP phosphonomutase and related enzymes [Carbohydrate transport and metabolism]	Back alignment and domain information

>PRK13585 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional	Back alignment and domain information

>TIGR00167 cbbA ketose-bisphosphate aldolases	Back alignment and domain information

>PRK07084 fructose-bisphosphate aldolase; Provisional	Back alignment and domain information

>COG2876 AroA 3-deoxy-D-arabino-heptulosonate 7-phosphate (DAHP) synthase [Amino acid transport and metabolism]	Back alignment and domain information

>TIGR01521 FruBisAldo_II_B fructose-bisphosphate aldolase, class II, Calvin cycle subtype	Back alignment and domain information

>PF04131 NanE: Putative N-acetylmannosamine-6-phosphate epimerase; InterPro: IPR007260 This family represents a putative ManNAc-6-P-to-GlcNAc-6P epimerase in the N-acetylmannosamine (ManNAc) utilization pathway found mainly in pathogenic bacteria for the reaction: N-acyl-D-glucosamine 6-phosphate = N-acyl-D-mannosamine 6-phosphate It is probably encoded by the yhcJ gene []	Back alignment and domain information

>cd04732 HisA HisA	Back alignment and domain information

>cd00947 TBP_aldolase_IIB Tagatose-1,6-bisphosphate (TBP) aldolase and related Type B Class II aldolases	Back alignment and domain information

>TIGR00735 hisF imidazoleglycerol phosphate synthase, cyclase subunit	Back alignment and domain information

>TIGR01290 nifB nitrogenase cofactor biosynthesis protein NifB	Back alignment and domain information

>smart00518 AP2Ec AP endonuclease family 2	Back alignment and domain information

>TIGR01496 DHPS dihydropteroate synthase	Back alignment and domain information

>TIGR01361 DAHP_synth_Bsub phospho-2-dehydro-3-deoxyheptonate aldolase	Back alignment and domain information

>TIGR01037 pyrD_sub1_fam dihydroorotate dehydrogenase (subfamily 1) family protein	Back alignment and domain information

>PRK13813 orotidine 5'-phosphate decarboxylase; Provisional	Back alignment and domain information

>COG2513 PrpB PEP phosphonomutase and related enzymes [Carbohydrate transport and metabolism]	Back alignment and domain information

>COG0274 DeoC Deoxyribose-phosphate aldolase [Nucleotide transport and metabolism]	Back alignment and domain information

>PRK07455 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional	Back alignment and domain information

>COG0800 Eda 2-keto-3-deoxy-6-phosphogluconate aldolase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PRK12737 gatY tagatose-bisphosphate aldolase; Reviewed	Back alignment and domain information

>TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein	Back alignment and domain information

>PRK09234 fbiC FO synthase; Reviewed	Back alignment and domain information

>cd00958 DhnA Class I fructose-1,6-bisphosphate (FBP) aldolases of the archaeal type (DhnA homologs) found in bacteria and archaea	Back alignment and domain information

>cd00429 RPE Ribulose-5-phosphate 3-epimerase (RPE)	Back alignment and domain information

>PRK07259 dihydroorotate dehydrogenase 1B; Reviewed	Back alignment and domain information

>cd00377 ICL_PEPM Members of the ICL/PEPM enzyme family catalyze either P-C or C-C bond formation/cleavage	Back alignment and domain information

>PRK13753 dihydropteroate synthase; Provisional	Back alignment and domain information

>PRK15108 biotin synthase; Provisional	Back alignment and domain information

>PRK05835 fructose-bisphosphate aldolase; Provisional	Back alignment and domain information

>COG0826 Collagenase and related proteases [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR00539 hemN_rel putative oxygen-independent coproporphyrinogen III oxidase	Back alignment and domain information

>TIGR02317 prpB methylisocitrate lyase	Back alignment and domain information

>cd04722 TIM_phosphate_binding TIM barrel proteins share a structurally conserved phosphate binding motif and in general share an eight beta/alpha closed barrel structure	Back alignment and domain information

>TIGR03586 PseI pseudaminic acid synthase	Back alignment and domain information

>cd02940 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain	Back alignment and domain information

>cd00377 ICL_PEPM Members of the ICL/PEPM enzyme family catalyze either P-C or C-C bond formation/cleavage	Back alignment and domain information

>cd00952 CHBPH_aldolase Trans-o-hydroxybenzylidenepyruvate hydratase-aldolase (HBPHA) and trans-2'-carboxybenzalpyruvate hydratase-aldolase (CBPHA)	Back alignment and domain information

>PRK13396 3-deoxy-7-phosphoheptulonate synthase; Provisional	Back alignment and domain information

>PRK11320 prpB 2-methylisocitrate lyase; Provisional	Back alignment and domain information

>PF13714 PEP_mutase: Phosphoenolpyruvate phosphomutase; PDB: 1ZLP_A 3EOO_C 1UJQ_D 1O5Q_A 2DUA_A 2HJP_A 2HRW_A 2QIW_A 3KZ2_B 3IH1_B	Back alignment and domain information

>COG1082 IolE Sugar phosphate isomerases/epimerases [Carbohydrate transport and metabolism]	Back alignment and domain information

>TIGR00538 hemN oxygen-independent coproporphyrinogen III oxidase	Back alignment and domain information

>cd06556 ICL_KPHMT Members of the ICL/PEPM_KPHMT enzyme superfamily catalyze the formation and cleavage of either P-C or C-C bonds	Back alignment and domain information

>cd04731 HisF The cyclase subunit of imidazoleglycerol phosphate synthase (HisF)	Back alignment and domain information

>PRK05660 HemN family oxidoreductase; Provisional	Back alignment and domain information

>TIGR00510 lipA lipoate synthase	Back alignment and domain information

>PRK15452 putative protease; Provisional	Back alignment and domain information

>cd02933 OYE_like_FMN Old yellow enzyme (OYE)-like FMN binding domain	Back alignment and domain information

>PRK10481 hypothetical protein; Provisional	Back alignment and domain information

>PRK04147 N-acetylneuraminate lyase; Provisional	Back alignment and domain information

>PRK06096 molybdenum transport protein ModD; Provisional	Back alignment and domain information

>cd02803 OYE_like_FMN_family Old yellow enzyme (OYE)-like FMN binding domain	Back alignment and domain information

>TIGR00683 nanA N-acetylneuraminate lyase	Back alignment and domain information

>TIGR01334 modD putative molybdenum utilization protein ModD	Back alignment and domain information

>PRK09249 coproporphyrinogen III oxidase; Provisional	Back alignment and domain information

>PF01116 F_bP_aldolase: Fructose-bisphosphate aldolase class-II; InterPro: IPR000771 Fructose-bisphosphate aldolase [, ] is a glycolytic enzyme that catalyses the reversible aldol cleavage or condensation of fructose-1,6-bisphosphate into dihydroxyacetone-phosphate and glyceraldehyde 3-phosphate	Back alignment and domain information

>TIGR00683 nanA N-acetylneuraminate lyase	Back alignment and domain information

>PRK03170 dihydrodipicolinate synthase; Provisional	Back alignment and domain information

>PRK08673 3-deoxy-7-phosphoheptulonate synthase; Reviewed	Back alignment and domain information

>PRK03170 dihydrodipicolinate synthase; Provisional	Back alignment and domain information

>PRK06806 fructose-bisphosphate aldolase; Provisional	Back alignment and domain information

>PF03102 NeuB: NeuB family; InterPro: IPR013132 NeuB is the prokaryotic N-acetylneuraminic acid synthase (Neu5Ac)	Back alignment and domain information

>cd00951 KDGDH 5-dehydro-4-deoxyglucarate dehydratase, also called 5-keto-4-deoxy-glucarate dehydratase (KDGDH), which is member of dihydrodipicolinate synthase (DHDPS) family that comprises several pyruvate-dependent class I aldolases	Back alignment and domain information

>PRK13347 coproporphyrinogen III oxidase; Provisional	Back alignment and domain information

>cd04733 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 2	Back alignment and domain information

>TIGR01361 DAHP_synth_Bsub phospho-2-dehydro-3-deoxyheptonate aldolase	Back alignment and domain information

>TIGR03569 NeuB_NnaB N-acetylneuraminate synthase	Back alignment and domain information

>cd01572 QPRTase Quinolinate phosphoribosyl transferase (QAPRTase or QPRTase), also called nicotinate-nucleotide pyrophosphorylase, is involved in the de novo synthesis of NAD in both prokaryotes and eukaryotes	Back alignment and domain information

>PRK04165 acetyl-CoA decarbonylase/synthase complex subunit gamma; Provisional	Back alignment and domain information

>PRK01130 N-acetylmannosamine-6-phosphate 2-epimerase; Provisional	Back alignment and domain information

>TIGR02319 CPEP_Pphonmut carboxyvinyl-carboxyphosphonate phosphorylmutase	Back alignment and domain information

>PRK03620 5-dehydro-4-deoxyglucarate dehydratase; Provisional	Back alignment and domain information

>PRK08446 coproporphyrinogen III oxidase; Provisional	Back alignment and domain information

>cd02930 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-binding domain	Back alignment and domain information

>PRK08318 dihydropyrimidine dehydrogenase subunit B; Validated	Back alignment and domain information

>PRK05481 lipoyl synthase; Provisional	Back alignment and domain information

>PF00701 DHDPS: Dihydrodipicolinate synthetase family; InterPro: IPR002220 Dihydropicolinate synthase (DHDPS) is the key enzyme in lysine biosynthesis via the diaminopimelate pathway of prokaryotes, some phycomycetes and higher plants	Back alignment and domain information

>PRK03620 5-dehydro-4-deoxyglucarate dehydratase; Provisional	Back alignment and domain information

>COG1856 Uncharacterized homolog of biotin synthetase [Function unknown]	Back alignment and domain information

>TIGR03822 AblA_like_2 lysine-2,3-aminomutase-related protein	Back alignment and domain information

>cd04740 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain	Back alignment and domain information

>TIGR02631 xylA_Arthro xylose isomerase, Arthrobacter type	Back alignment and domain information

>PRK13398 3-deoxy-7-phosphoheptulonate synthase; Provisional	Back alignment and domain information

>cd01568 QPRTase_NadC Quinolinate phosphoribosyl transferase (QAPRTase or QPRTase), also called nicotinate-nucleotide pyrophosphorylase, is involved in the de novo synthesis of NAD in both prokaryotes and eukaryotes	Back alignment and domain information

>cd00950 DHDPS Dihydrodipicolinate synthase (DHDPS) is a key enzyme in lysine biosynthesis	Back alignment and domain information

>cd04728 ThiG Thiazole synthase (ThiG) is the tetrameric enzyme that is involved in the formation of the thiazole moiety of thiamin pyrophosphate, an essential ubiquitous cofactor that plays an important role in carbohydrate and amino acid metabolism	Back alignment and domain information

>TIGR03249 KdgD 5-dehydro-4-deoxyglucarate dehydratase	Back alignment and domain information

>PRK07107 inosine 5-monophosphate dehydrogenase; Validated	Back alignment and domain information

>TIGR03849 arch_ComA phosphosulfolactate synthase	Back alignment and domain information

>PLN02858 fructose-bisphosphate aldolase	Back alignment and domain information

>PRK04147 N-acetylneuraminate lyase; Provisional	Back alignment and domain information

>TIGR02313 HpaI-NOT-DapA 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase	Back alignment and domain information

>TIGR03551 F420_cofH 7,8-didemethyl-8-hydroxy-5-deazariboflavin synthase, CofH subunit	Back alignment and domain information

>TIGR01210 conserved hypothetical protein TIGR01210	Back alignment and domain information

>TIGR00674 dapA dihydrodipicolinate synthase	Back alignment and domain information

>PTZ00170 D-ribulose-5-phosphate 3-epimerase; Provisional	Back alignment and domain information

>cd01335 Radical_SAM Radical SAM superfamily	Back alignment and domain information

>PLN02417 dihydrodipicolinate synthase	Back alignment and domain information

>COG3473 Maleate cis-trans isomerase [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>COG0191 Fba Fructose/tagatose bisphosphate aldolase [Carbohydrate transport and metabolism]	Back alignment and domain information

>cd06557 KPHMT-like Ketopantoate hydroxymethyltransferase (KPHMT) is the first enzyme in the pantothenate biosynthesis pathway	Back alignment and domain information

>PRK12595 bifunctional 3-deoxy-7-phosphoheptulonate synthase/chorismate mutase; Reviewed	Back alignment and domain information

>PRK02083 imidazole glycerol phosphate synthase subunit HisF; Provisional	Back alignment and domain information

>PLN02417 dihydrodipicolinate synthase	Back alignment and domain information

>cd00408 DHDPS-like Dihydrodipicolinate synthase family	Back alignment and domain information

>cd00954 NAL N-Acetylneuraminic acid aldolase, also called N-acetylneuraminate lyase (NAL), which catalyses the reversible aldol reaction of N-acetyl-D-mannosamine and pyruvate to give N-acetyl-D-neuraminic acid (D-sialic acid)	Back alignment and domain information

>PRK00311 panB 3-methyl-2-oxobutanoate hydroxymethyltransferase; Reviewed	Back alignment and domain information

>COG2089 SpsE Sialic acid synthase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PRK11613 folP dihydropteroate synthase; Provisional	Back alignment and domain information

>PRK05628 coproporphyrinogen III oxidase; Validated	Back alignment and domain information

>PRK09240 thiH thiamine biosynthesis protein ThiH; Reviewed	Back alignment and domain information

>PRK05799 coproporphyrinogen III oxidase; Provisional	Back alignment and domain information

>TIGR03586 PseI pseudaminic acid synthase	Back alignment and domain information

>PF02679 ComA: (2R)-phospho-3-sulfolactate synthase (ComA); InterPro: IPR003830 Methanogenic archaea produce methane via the anaerobic reduction of acetate or single carbon compounds []	Back alignment and domain information

>PRK00366 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase; Reviewed	Back alignment and domain information

>cd00959 DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of the DeoC family	Back alignment and domain information

>PTZ00170 D-ribulose-5-phosphate 3-epimerase; Provisional	Back alignment and domain information

>TIGR02321 Pphn_pyruv_hyd phosphonopyruvate hydrolase	Back alignment and domain information

>TIGR02026 BchE magnesium-protoporphyrin IX monomethyl ester anaerobic oxidative cyclase	Back alignment and domain information

>TIGR00284 dihydropteroate synthase-related protein	Back alignment and domain information

>cd02801 DUS_like_FMN Dihydrouridine synthase-like (DUS-like) FMN-binding domain	Back alignment and domain information

>PRK06843 inosine 5-monophosphate dehydrogenase; Validated	Back alignment and domain information

>TIGR00007 phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase	Back alignment and domain information

>PRK13397 3-deoxy-7-phosphoheptulonate synthase; Provisional	Back alignment and domain information

>PRK00748 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Validated	Back alignment and domain information

>COG0635 HemN Coproporphyrinogen III oxidase and related Fe-S oxidoreductases [Coenzyme metabolism]	Back alignment and domain information

>cd01320 ADA Adenosine deaminase (ADA) is a monomeric zinc dependent enzyme which catalyzes the irreversible hydrolytic deamination of both adenosine, as well as desoxyadenosine, to ammonia and inosine or desoxyinosine, respectively	Back alignment and domain information

>cd04724 Tryptophan_synthase_alpha Ttryptophan synthase (TRPS) alpha subunit (TSA)	Back alignment and domain information

>PRK12677 xylose isomerase; Provisional	Back alignment and domain information

>cd04735 OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 4	Back alignment and domain information

>TIGR01304 IMP_DH_rel_2 IMP dehydrogenase family protein	Back alignment and domain information

>PRK09490 metH B12-dependent methionine synthase; Provisional	Back alignment and domain information

>PRK13745 anaerobic sulfatase-maturase; Provisional	Back alignment and domain information

>PTZ00372 endonuclease 4-like protein; Provisional	Back alignment and domain information

>PRK07259 dihydroorotate dehydrogenase 1B; Reviewed	Back alignment and domain information

>PRK08208 coproporphyrinogen III oxidase; Validated	Back alignment and domain information

>COG0329 DapA Dihydrodipicolinate synthase/N-acetylneuraminate lyase [Amino acid transport and metabolism / Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>TIGR01211 ELP3 histone acetyltransferase, ELP3 family	Back alignment and domain information

>PRK10605 N-ethylmaleimide reductase; Provisional	Back alignment and domain information

>TIGR00222 panB 3-methyl-2-oxobutanoate hydroxymethyltransferase	Back alignment and domain information

>PRK05283 deoxyribose-phosphate aldolase; Provisional	Back alignment and domain information

>cd00953 KDG_aldolase KDG (2-keto-3-deoxygluconate) aldolases found in archaea	Back alignment and domain information

>PRK08227 autoinducer 2 aldolase; Validated	Back alignment and domain information

>PRK07565 dihydroorotate dehydrogenase 2; Reviewed	Back alignment and domain information

>COG0535 Predicted Fe-S oxidoreductases [General function prediction only]	Back alignment and domain information

>COG0821 gcpE 1-hydroxy-2-methyl-2-(e)-butenyl 4-diphosphate synthase [Lipid metabolism]	Back alignment and domain information

>PRK00115 hemE uroporphyrinogen decarboxylase; Validated	Back alignment and domain information

>TIGR00612 ispG_gcpE 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase	Back alignment and domain information

>PRK07226 fructose-bisphosphate aldolase; Provisional	Back alignment and domain information

>TIGR00343 pyridoxal 5'-phosphate synthase, synthase subunit Pdx1	Back alignment and domain information

>COG3623 SgaU Putative L-xylulose-5-phosphate 3-epimerase [Carbohydrate transport and metabolism]	Back alignment and domain information

>cd03315 MLE_like Muconate lactonizing enzyme (MLE) like subgroup of the enolase superfamily	Back alignment and domain information

>PRK08508 biotin synthase; Provisional	Back alignment and domain information

>cd04739 DHOD_like Dihydroorotate dehydrogenase (DHOD) like proteins	Back alignment and domain information

>TIGR01740 pyrF orotidine 5'-phosphate decarboxylase, subfamily 1	Back alignment and domain information

>cd04734 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 3	Back alignment and domain information

>cd02810 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain	Back alignment and domain information

>TIGR01949 AroFGH_arch predicted phospho-2-dehydro-3-deoxyheptonate aldolase	Back alignment and domain information

>PRK00112 tgt queuine tRNA-ribosyltransferase; Provisional	Back alignment and domain information

>PF13714 PEP_mutase: Phosphoenolpyruvate phosphomutase; PDB: 1ZLP_A 3EOO_C 1UJQ_D 1O5Q_A 2DUA_A 2HJP_A 2HRW_A 2QIW_A 3KZ2_B 3IH1_B	Back alignment and domain information

>PF02679 ComA: (2R)-phospho-3-sulfolactate synthase (ComA); InterPro: IPR003830 Methanogenic archaea produce methane via the anaerobic reduction of acetate or single carbon compounds []	Back alignment and domain information

>PRK14024 phosphoribosyl isomerase A; Provisional	Back alignment and domain information

>PRK13396 3-deoxy-7-phosphoheptulonate synthase; Provisional	Back alignment and domain information

>PRK13111 trpA tryptophan synthase subunit alpha; Provisional	Back alignment and domain information

>PRK05904 coproporphyrinogen III oxidase; Provisional	Back alignment and domain information

>PRK07094 biotin synthase; Provisional	Back alignment and domain information

>cd04727 pdxS PdxS is a subunit of the pyridoxal 5'-phosphate (PLP) synthase, an important enzyme in deoxyxylulose 5-phosphate (DXP)-independent pathway for de novo biosynthesis of PLP, present in some eubacteria, in archaea, fungi, plants, plasmodia, and some metazoa	Back alignment and domain information

>PF07302 AroM: AroM protein; InterPro: IPR010843 This family consists of several bacterial and archaeal AroM proteins	Back alignment and domain information

>COG1244 Predicted Fe-S oxidoreductase [General function prediction only]	Back alignment and domain information

>cd00405 PRAI Phosphoribosylanthranilate isomerase (PRAI) catalyzes the fourth step of the tryptophan biosynthesis, the conversion of N-(5'- phosphoribosyl)-anthranilate (PRA) to 1-(o-carboxyphenylamino)- 1-deoxyribulose 5-phosphate (CdRP)	Back alignment and domain information

>TIGR03471 HpnJ hopanoid biosynthesis associated radical SAM protein HpnJ	Back alignment and domain information

>PRK05581 ribulose-phosphate 3-epimerase; Validated	Back alignment and domain information

>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional	Back alignment and domain information

>PRK06801 hypothetical protein; Provisional	Back alignment and domain information

>PRK13523 NADPH dehydrogenase NamA; Provisional	Back alignment and domain information

>PRK08673 3-deoxy-7-phosphoheptulonate synthase; Reviewed	Back alignment and domain information

>cd06556 ICL_KPHMT Members of the ICL/PEPM_KPHMT enzyme superfamily catalyze the formation and cleavage of either P-C or C-C bonds	Back alignment and domain information

>TIGR02321 Pphn_pyruv_hyd phosphonopyruvate hydrolase	Back alignment and domain information

>TIGR00736 nifR3_rel_arch TIM-barrel protein, putative	Back alignment and domain information

>cd02932 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN binding domain	Back alignment and domain information

>TIGR00078 nadC nicotinate-nucleotide pyrophosphorylase	Back alignment and domain information

>PRK08072 nicotinate-nucleotide pyrophosphorylase; Provisional	Back alignment and domain information

>TIGR01859 fruc_bis_ald_ fructose-1,6-bisphosphate aldolase, class II, various bacterial and amitochondriate protist	Back alignment and domain information

>cd00945 Aldolase_Class_I Class I aldolases	Back alignment and domain information

>TIGR03569 NeuB_NnaB N-acetylneuraminate synthase	Back alignment and domain information

>PRK08207 coproporphyrinogen III oxidase; Provisional	Back alignment and domain information

>PF01702 TGT: Queuine tRNA-ribosyltransferase; InterPro: IPR002616 This is a family of queuine, archaeosine and general tRNA-ribosyltransferases 2	Back alignment and domain information

>PF03102 NeuB: NeuB family; InterPro: IPR013132 NeuB is the prokaryotic N-acetylneuraminic acid synthase (Neu5Ac)	Back alignment and domain information

>PLN02623 pyruvate kinase	Back alignment and domain information

>PLN02424 ketopantoate hydroxymethyltransferase	Back alignment and domain information

>PRK07360 FO synthase subunit 2; Reviewed	Back alignment and domain information

>PRK07428 nicotinate-nucleotide pyrophosphorylase; Provisional	Back alignment and domain information

>TIGR00737 nifR3_yhdG putative TIM-barrel protein, nifR3 family	Back alignment and domain information

>PRK00208 thiG thiazole synthase; Reviewed	Back alignment and domain information

>PRK09250 fructose-bisphosphate aldolase; Provisional	Back alignment and domain information

>PF09370 TIM-br_sig_trns: TIM-barrel signal transduction protein; InterPro: IPR009215 Members of this family are predicted to have a TIM barrel fold, based on PSI-BLAST analysis (iteration 4) and on SCOP prediction (using SMART)	Back alignment and domain information

>PRK06852 aldolase; Validated	Back alignment and domain information

>TIGR03572 WbuZ glycosyl amidation-associated protein WbuZ	Back alignment and domain information

>cd03315 MLE_like Muconate lactonizing enzyme (MLE) like subgroup of the enolase superfamily	Back alignment and domain information

>cd04729 NanE N-acetylmannosamine-6-phosphate epimerase (NanE) converts N-acetylmannosamine-6-phosphate to N-acetylglucosamine-6-phosphate	Back alignment and domain information

>PRK00694 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase; Validated	Back alignment and domain information

>PRK09197 fructose-bisphosphate aldolase; Provisional	Back alignment and domain information

>PF01791 DeoC: DeoC/LacD family aldolase; InterPro: IPR002915 This family includes the enzyme deoxyribose-phosphate aldolase, which is involved in nucleotide metabolism	Back alignment and domain information

>PF04551 GcpE: GcpE protein; InterPro: IPR004588 This protein previously of unknown biochemical function is essential in Escherichia coli	Back alignment and domain information

>PRK12737 gatY tagatose-bisphosphate aldolase; Reviewed	Back alignment and domain information

>cd02803 OYE_like_FMN_family Old yellow enzyme (OYE)-like FMN binding domain	Back alignment and domain information

>PF04481 DUF561: Protein of unknown function (DUF561); InterPro: IPR007570 Protein in this entry are of unknown function and are found in cyanobacteria and the chloroplasts of algae	Back alignment and domain information

>cd01299 Met_dep_hydrolase_A Metallo-dependent hydrolases, subgroup A is part of the superfamily of metallo-dependent hydrolases, a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site	Back alignment and domain information

>TIGR02990 ectoine_eutA ectoine utilization protein EutA	Back alignment and domain information

>PRK09875 putative hydrolase; Provisional	Back alignment and domain information

>PRK07379 coproporphyrinogen III oxidase; Provisional	Back alignment and domain information

>KOG3111 consensus D-ribulose-5-phosphate 3-epimerase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PRK02048 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase; Provisional	Back alignment and domain information

>cd07937 DRE_TIM_PC_TC_5S Pyruvate carboxylase and Transcarboxylase 5S, carboxyltransferase domain	Back alignment and domain information

>TIGR00222 panB 3-methyl-2-oxobutanoate hydroxymethyltransferase	Back alignment and domain information

>TIGR01464 hemE uroporphyrinogen decarboxylase	Back alignment and domain information

>TIGR03821 AblA_like_1 lysine-2,3-aminomutase-related protein	Back alignment and domain information

>cd04747 OYE_like_5_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 5	Back alignment and domain information

>TIGR03849 arch_ComA phosphosulfolactate synthase	Back alignment and domain information

>TIGR03700 mena_SCO4494 putative menaquinone biosynthesis protein, SCO4494 family	Back alignment and domain information

>TIGR03234 OH-pyruv-isom hydroxypyruvate isomerase	Back alignment and domain information

>PRK07565 dihydroorotate dehydrogenase 2; Reviewed	Back alignment and domain information

>PRK07896 nicotinate-nucleotide pyrophosphorylase; Provisional	Back alignment and domain information

>PRK12738 kbaY tagatose-bisphosphate aldolase; Reviewed	Back alignment and domain information

>PRK05283 deoxyribose-phosphate aldolase; Provisional	Back alignment and domain information

>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase	Back alignment and domain information

>PRK05848 nicotinate-nucleotide pyrophosphorylase; Provisional	Back alignment and domain information

>COG0167 PyrD Dihydroorotate dehydrogenase [Nucleotide transport and metabolism]	Back alignment and domain information

>PRK01008 queuine tRNA-ribosyltransferase; Provisional	Back alignment and domain information

>PF04273 DUF442: Putative phosphatase (DUF442); InterPro: IPR005939 Although this domain is uncharacterised it seems likely that it performs a phosphatase function	Back alignment and domain information

>COG0274 DeoC Deoxyribose-phosphate aldolase [Nucleotide transport and metabolism]	Back alignment and domain information

>PRK06294 coproporphyrinogen III oxidase; Provisional	Back alignment and domain information

>cd04741 DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) class 1A FMN-binding domain	Back alignment and domain information

>PLN02495 oxidoreductase, acting on the CH-CH group of donors	Back alignment and domain information

>PRK05265 pyridoxine 5'-phosphate synthase; Provisional	Back alignment and domain information

>TIGR00559 pdxJ pyridoxine 5'-phosphate synthase	Back alignment and domain information

>cd00958 DhnA Class I fructose-1,6-bisphosphate (FBP) aldolases of the archaeal type (DhnA homologs) found in bacteria and archaea	Back alignment and domain information

>COG0502 BioB Biotin synthase and related enzymes [Coenzyme metabolism]	Back alignment and domain information

>cd00947 TBP_aldolase_IIB Tagatose-1,6-bisphosphate (TBP) aldolase and related Type B Class II aldolases	Back alignment and domain information

>PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed	Back alignment and domain information

>PRK11613 folP dihydropteroate synthase; Provisional	Back alignment and domain information

>PLN02389 biotin synthase	Back alignment and domain information

>cd04722 TIM_phosphate_binding TIM barrel proteins share a structurally conserved phosphate binding motif and in general share an eight beta/alpha closed barrel structure	Back alignment and domain information

>cd04733 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 2	Back alignment and domain information

>COG0036 Rpe Pentose-5-phosphate-3-epimerase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PRK09195 gatY tagatose-bisphosphate aldolase; Reviewed	Back alignment and domain information

>cd02940 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain	Back alignment and domain information

>PF04481 DUF561: Protein of unknown function (DUF561); InterPro: IPR007570 Protein in this entry are of unknown function and are found in cyanobacteria and the chloroplasts of algae	Back alignment and domain information

>PRK12581 oxaloacetate decarboxylase; Provisional	Back alignment and domain information

>cd06557 KPHMT-like Ketopantoate hydroxymethyltransferase (KPHMT) is the first enzyme in the pantothenate biosynthesis pathway	Back alignment and domain information

>PLN02433 uroporphyrinogen decarboxylase	Back alignment and domain information

>PF04476 DUF556: Protein of unknown function (DUF556); InterPro: IPR007565 The proteins in this entry are functionally uncharacterised	Back alignment and domain information

>cd04739 DHOD_like Dihydroorotate dehydrogenase (DHOD) like proteins	Back alignment and domain information

>PRK08185 hypothetical protein; Provisional	Back alignment and domain information

>PRK09358 adenosine deaminase; Provisional	Back alignment and domain information

>PRK05718 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional	Back alignment and domain information

>PRK13210 putative L-xylulose 5-phosphate 3-epimerase; Reviewed	Back alignment and domain information

>TIGR02493 PFLA pyruvate formate-lyase 1-activating enzyme	Back alignment and domain information

>TIGR01858 tag_bisphos_ald class II aldolase, tagatose bisphosphate family	Back alignment and domain information

>cd00953 KDG_aldolase KDG (2-keto-3-deoxygluconate) aldolases found in archaea	Back alignment and domain information

>PRK12857 fructose-1,6-bisphosphate aldolase; Reviewed	Back alignment and domain information

>COG1830 FbaB DhnA-type fructose-1,6-bisphosphate aldolase and related enzymes [Carbohydrate transport and metabolism]	Back alignment and domain information

>PRK05985 cytosine deaminase; Provisional	Back alignment and domain information

>cd03174 DRE_TIM_metallolyase DRE-TIM metallolyase superfamily	Back alignment and domain information

>PRK05742 nicotinate-nucleotide pyrophosphorylase; Provisional	Back alignment and domain information

>PRK06252 methylcobalamin:coenzyme M methyltransferase; Validated	Back alignment and domain information

>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase	Back alignment and domain information

>PLN02433 uroporphyrinogen decarboxylase	Back alignment and domain information

>TIGR00449 tgt_general tRNA-guanine transglycosylases, various specificities	Back alignment and domain information

>cd04730 NPD_like 2-Nitropropane dioxygenase (NPD), one of the nitroalkane oxidizing enzyme families, catalyzes oxidative denitrification of nitroalkanes to their corresponding carbonyl compounds and nitrites	Back alignment and domain information

>TIGR02666 moaA molybdenum cofactor biosynthesis protein A, bacterial	Back alignment and domain information

>TIGR00430 Q_tRNA_tgt tRNA-guanine transglycosylase, queuosine-34-forming	Back alignment and domain information

>TIGR00262 trpA tryptophan synthase, alpha subunit	Back alignment and domain information

>PRK08599 coproporphyrinogen III oxidase; Provisional	Back alignment and domain information

>PRK00311 panB 3-methyl-2-oxobutanoate hydroxymethyltransferase; Reviewed	Back alignment and domain information

>PRK14340 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional	Back alignment and domain information

>PRK09057 coproporphyrinogen III oxidase; Provisional	Back alignment and domain information

>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional	Back alignment and domain information

>PRK04180 pyridoxal biosynthesis lyase PdxS; Provisional	Back alignment and domain information

>PRK06256 biotin synthase; Validated	Back alignment and domain information

>PF02548 Pantoate_transf: Ketopantoate hydroxymethyltransferase; InterPro: IPR003700 The panB gene from Escherichia coli encodes the first enzyme of the pantothenate biosynthesis pathway, ketopantoate hydroxymethyltransferase (KPHMT) 2	Back alignment and domain information

>cd00717 URO-D Uroporphyrinogen decarboxylase (URO-D) is a dimeric cytosolic enzyme that decarboxylates the four acetate side chains of uroporphyrinogen III (uro-III) to create coproporphyrinogen III, without requiring any prosthetic groups or cofactors	Back alignment and domain information

>PRK15063 isocitrate lyase; Provisional	Back alignment and domain information

>cd02931 ER_like_FMN Enoate reductase (ER)-like FMN-binding domain	Back alignment and domain information

>PRK11858 aksA trans-homoaconitate synthase; Reviewed	Back alignment and domain information

>PLN02951 Molybderin biosynthesis protein CNX2	Back alignment and domain information

>PRK13758 anaerobic sulfatase-maturase; Provisional	Back alignment and domain information

>cd03309 CmuC_like CmuC_like	Back alignment and domain information

>TIGR01212 radical SAM protein, TIGR01212 family	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		442
3rmj_A		370	Crystal Structure Of Truncated Alpha-Isopropylmalat		1e-106
3eeg_A		325	Crystal Structure Of A 2-Isopropylmalate Synthase F		1e-86
3ewb_X		293	Crystal Structure Of N-Terminal Domain Of Putative		3e-67
3ivt_A		423	Homocitrate Synthase Lys4 Bound To 2-Og Length = 42		2e-32
3ivs_A		423	Homocitrate Synthase Lys4 Length = 423		1e-31
3ble_A		337	Crystal Structure Of The Catalytic Domain Of Licms		4e-26
2ztj_A		382	Crystal Structure Of Homocitrate Synthase From Ther		1e-22
3a9i_A		376	Crystal Structure Of Homocitrate Synthase From Ther		1e-22
3u6w_A		427	Truncated M. Tuberculosis Leua (1-425) Complexed Wi		7e-21
3hpx_A		425	Crystal Structure Of Mycobacterium Tuberculosis Leu		7e-21
3fig_A		646	Crystal Structure Of Leucine-bound Leua From Mycoba		1e-20
3hps_A		644	Crystal Structure Of Mycobacterium Tuberculosis Leu		1e-20
1sr9_A		644	Crystal Structure Of Leua From Mycobacterium Tuberc		2e-19
2cw6_A		298	Crystal Structure Of Human Hmg-Coa Lyase: Insights		1e-04
1ydo_A		307	Crystal Structure Of The Bacillis Subtilis Hmg-Coa		2e-04
3mp4_A		298	Crystal Structure Of Human Lyase R41m Mutant Length		5e-04

>pdb|3RMJ|A Chain A, Crystal Structure Of Truncated Alpha-Isopropylmalate Synthase From Neisseria Meningitidis Length = 370