Citrus Sinensis ID: 013619

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------44
MAVVAQLSPSSYTETTRLSSSQLSLSSTHLSSLRRRAFRPIIGPRNPTISCSVNQVQAPVAVEQDDPKSKTNDCYGVFCLTYDLKAEEETKSWKKMVNIAVSGAAGMIANHLLFKLAAGEVLGPDQPIALKLLGSERSLQALEGVAMELEDSLFPLLREVKIGINPYELFEDAEWALLIGAKPRGPGMERAGLLDINGQIFAEQGKALNAVASRNVKVIVVGNPCNTNALICLKNAPSIPAKNFHALTRLDENRAKCQLALKAGVFYDKVSNMTIWGNHSTTQVPDFLNARINGLPVKEIIKDHKWLEEGFTETIQKRGGLLIKKWGRSSAASTAVSIVDAMKSLVTPTPEGDWFSSGVYTNGNPYGIAEDIVFSMPCRSKGDGDYELVKDVIFDDYLRKRIAKTEQELLAEKKCVAHLTGEGIAFCDLPEDTMLPGEM
ccccccccccccccccccccccccccccccccccccccccccccccccEEcccccccccccccccccccccccEEEEEEEEccHHHHHHHHHHccccEEEEEcccHHHHHHHHHHHHccccccccccEEEEEEccccccccHHHHHHHHHHccccccccEEEEcccHHHcccccEEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEcccHHHHHHHHHHHccccccccEEEEHHHHHHHHHHHHHHHHcccccccEEEEEEccccccccccccccEEccEEccccccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccccEEEEEEEEccccccccccEEEEEEEEEccccEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccc
ccEEEEcccccccccccccccHHHHHcccccccHcccccccccccccEEEEEEccccccccccccccccccccccEEEEEEEEcccccccccccccEEEEEEccccHHHHHHHHHHHccccccccccEEEEEEccHHHHHHHHHHHHHHHccccccEEEEEEEccHHHHcccccEEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccEEEEccccHHHHHHHHHHccccccHHHEEEccHHHHHHHHHHHHHHHcccHHHEEccEEEEccccccEEEccccEEccEEHHHcccHHHHHHcHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcccccccEEEEEEccccccccccccEEEEEEEEEccccEEEEcccEccHHHHHHHHHHHHHHHHHHHHHHHHHcccccEccccccccccccc
mavvaqlspssytettrlsssqlslssTHLSSLRrrafrpiigprnptiscsvnqvqapvaveqddpksktndcygvfcltYDLKAEEETKSWKKMVNIAVSGAAGMIANHLLFKLaagevlgpdqpIALKLLGSERSLQALEGVAMELEDSLFPLLREvkiginpyelfeDAEWALLIgakprgpgmeraglldinGQIFAEQGKALNAVASRNVKVIVVgnpcntnaliclknapsipaknfhaltrLDENRAKCQLALKAgvfydkvsnmtiwgnhsttqvPDFLNARINGLPVKEIIKDHKWLEEGFTETIQKRGGLLIkkwgrssaaSTAVSIVDAMKslvtptpegdwfssgvytngnpygiaedivfsmpcrskgdgdyelvkDVIFDDYLRKRIAKTEQELLAEKKCVAHLtgegiafcdlpedtmlpgem
mavvaqlspssytettrlsssqlslssthlsSLRRRAFRPiigprnptiscsvNQVQAPVaveqddpksktndcYGVFCLTYDLKAEEETKSWKKMVNIAVSGAAGMIANHLLFKLAAGEVLGPDQPIALKLLGSERSLQALEGVAMELEDSLFPLLREVKIGINPYELFEDAEWALLIGAKPRGPGMERAGLLDINGQIFAEQGKALNAVASRNVKVIVVGNPCNTNALICLKNAPSIPAKNFHALTRLDENRAKCQLALKAGVFYDKVSNMTIWGNHSTTQVPDFLNARINGLPVKEIIKDHKWLEEGFTETIQKRGGLLIKKWGRSSAASTAVSIVDAMKSLVtptpegdwfssGVYTNGNPYGIAEDIVFSMPCRSKGDGDYELVKDVIFDDYLRKRIAKTEQELLAEKKCVAHLTgegiafcdlpedtmlpgem
MAVVAQLSPSSYtettrlsssqlslssthlsslrrrAFRPIIGPRNPTISCSVNQVQAPVAVEQDDPKSKTNDCYGVFCLTYDLKAEEETKSWKKMVNIAVSGAAGMIANHLLFKLAAGEVLGPDQPIALKLLGSERSLQALEGVAMELEDSLFPLLREVKIGINPYELFEDAEWALLIGAKPRGPGMERAGLLDINGQIFAEQGKALNAVASRNVKVIVVGNPCNTNALICLKNAPSIPAKNFHALTRLDENRAKCQLALKAGVFYDKVSNMTIWGNHSTTQVPDFLNARINGLPVKEIIKDHKWLEEGFTETIQKRGGLLIKKWGRSSAASTAVSIVDAMKSLVTPTPEGDWFSSGVYTNGNPYGIAEDIVFSMPCRSKGDGDYELVKDVIFDDYLRKRIAKTEQELLAEKKCVAHLTGEGIAFCDLPEDTMLPGEM
****************************************II******ISCSV******************NDCYGVFCLTYDLKAEEETKSWKKMVNIAVSGAAGMIANHLLFKLAAGEVLGPDQPIALKLLGSERSLQALEGVAMELEDSLFPLLREVKIGINPYELFEDAEWALLIGAKPRGPGMERAGLLDINGQIFAEQGKALNAVASRNVKVIVVGNPCNTNALICLKNAPSIPAKNFHALTRLDENRAKCQLALKAGVFYDKVSNMTIWGNHSTTQVPDFLNARINGLPVKEIIKDHKWLEEGFTETIQKRGGLLIKKWGRSSAASTAVSIVDAMKSLVTPTPEGDWFSSGVYTNGNPYGIAEDIVFSMPCRSKGDGDYELVKDVIFDDYLRKRIAKTEQELLAEKKCVAHLTGEGIAFCDL**********
***********************************************************************NDCYGVFCLTY**************VNIAVSGAAGMIANHLLFKLAAGEVLGPDQPIALKLLGSERSLQALEGVAMELEDSLFPLLREVKIGINPYELFEDAEWALLIGAKPRGPGMERAGLLDINGQIFAEQGKALNAVASRNVKVIVVGNPCNTNALICLKNAPSIPAKNFHALTRLDENRAKCQLALKAGVFYDKVSNMTIWGNHSTTQVPDFLNARINGLPVKEIIKDHKWLEEGFTETIQKRGGLLIKKWGRSSAASTAVSIVDAMKSLVTPTPEGDWFSSGVYTNGNPYGIAEDIVFSMPCRSKGDGDYELVKDVIFDDYLRKRIAKTEQELLAEKKCVAHLTGEGIAFCDLPEDT*LP***
*******************************SLRRRAFRPIIGPRNPTISCSVNQVQAP**********KTNDCYGVFCLTYDLKAEEETKSWKKMVNIAVSGAAGMIANHLLFKLAAGEVLGPDQPIALKLLGSERSLQALEGVAMELEDSLFPLLREVKIGINPYELFEDAEWALLIGAKPRGPGMERAGLLDINGQIFAEQGKALNAVASRNVKVIVVGNPCNTNALICLKNAPSIPAKNFHALTRLDENRAKCQLALKAGVFYDKVSNMTIWGNHSTTQVPDFLNARINGLPVKEIIKDHKWLEEGFTETIQKRGGLLIKKW********AVSIVDAMKSLVTPTPEGDWFSSGVYTNGNPYGIAEDIVFSMPCRSKGDGDYELVKDVIFDDYLRKRIAKTEQELLAEKKCVAHLTGEGIAFCDLPEDTMLPGEM
********************************************RNPTISCSVNQV***************NDCYGVFCLTYDLKAEEETKSWKKMVNIAVSGAAGMIANHLLFKLAAGEVLGPDQPIALKLLGSERSLQALEGVAMELEDSLFPLLREVKIGINPYELFEDAEWALLIGAKPRGPGMERAGLLDINGQIFAEQGKALNAVASRNVKVIVVGNPCNTNALICLKNAPSIPAKNFHALTRLDENRAKCQLALKAGVFYDKVSNMTIWGNHSTTQVPDFLNARINGLPVKEIIKDHKWLEEGFTETIQKRGGLLIKKWGRSSAA***VSIVDAMKSLVTPTPEGDWFSSGVYTNGNPYGIAEDIVFSMPCRSKGDGDYELVKDVIFDDYLRKRIAKTEQELLAEKKCVAHLTGEGIAFCDLPEDTML****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAVVAQLSPSSYTETTRLSSSQLSLSSTHLSSLRRRAFRPIIGPRNPTISCSVNQVQAPVAVEQDDPKSKTNDCYGVFCLTYDLKAEEETKSWKKMVNIAVSGAAGMIANHLLFKLAAGEVLGPDQPIALKLLGSERSLQALEGVAMELEDSLFPLLREVKIGINPYELFEDAEWALLIGAKPRGPGMERAGLLDINGQIFAEQGKALNAVASRNVKVIVVGNPCNTNALICLKNAPSIPAKNFHALTRLDENRAKCQLALKAGVFYDKVSNMTIWGNHSTTQVPDFLNARINGLPVKEIIKDHKWLEEGFTETIQKRGGLLIKKWGRSSAASTAVSIVDAMKSLVTPTPEGDWFSSGVYTNGNPYGIAEDIVFSMPCRSKGDGDYELVKDVIFDDYLRKRIAKTEQELLAEKKCVAHLTGEGIAFCDLPEDTMLPGEM
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query439 2.2.26 [Sep-21-2011]
O48902437 Malate dehydrogenase [NAD N/A no 0.968 0.972 0.841 0.0
P21528441 Malate dehydrogenase [NAD N/A no 0.954 0.950 0.847 0.0
Q05145441 Malate dehydrogenase [NAD N/A no 0.984 0.979 0.796 0.0
P46489453 Malate dehydrogenase [NAD N/A no 0.879 0.852 0.832 0.0
P17606429 Malate dehydrogenase [NAD N/A no 0.888 0.909 0.827 0.0
P37229432 Malate dehydrogenase [NAD N/A no 0.899 0.914 0.814 0.0
P15719432 Malate dehydrogenase [NAD N/A no 0.922 0.937 0.796 0.0
P52426435 Malate dehydrogenase [NAD N/A no 0.970 0.979 0.753 0.0
Q6MAA3330 Malate dehydrogenase OS=P yes no 0.735 0.978 0.538 1e-96
B2UKY5329 Malate dehydrogenase OS=A yes no 0.740 0.987 0.521 6e-91
>sp|O48902|MDHP_MEDSA Malate dehydrogenase [NADP], chloroplastic OS=Medicago sativa GN=MDH1 PE=2 SV=1 Back     alignment and function desciption
 Score =  741 bits (1912), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/429 (84%), Positives = 388/429 (90%), Gaps = 4/429 (0%)

Query: 13  TETTRLSSSQLSLSSTHLSSLRRRAFRPIIGPRNPTISCSV--NQVQAPVAVEQDDPKSK 70
           ++T   SSSQLS  S  L         P+   ++  ISCSV  NQVQAP AV+  DPKSK
Sbjct: 11  SKTQLHSSSQLSFLSRTLPRHHHCTLAPLHRTQHARISCSVAPNQVQAP-AVQTQDPKSK 69

Query: 71  TNDCYGVFCLTYDLKAEEETKSWKKMVNIAVSGAAGMIANHLLFKLAAGEVLGPDQPIAL 130
             DCYGVFCLTYDLKAEEETKSWKK++ IAVSGAAGMI+NHLLFKLA+GEV GP+QPIAL
Sbjct: 70  P-DCYGVFCLTYDLKAEEETKSWKKLITIAVSGAAGMISNHLLFKLASGEVFGPNQPIAL 128

Query: 131 KLLGSERSLQALEGVAMELEDSLFPLLREVKIGINPYELFEDAEWALLIGAKPRGPGMER 190
           KLLGSERSLQALEGVAMELEDSLFPLLREV I I+PYE+F+DAEWALLIGAKPRGPGMER
Sbjct: 129 KLLGSERSLQALEGVAMELEDSLFPLLREVVISIDPYEVFQDAEWALLIGAKPRGPGMER 188

Query: 191 AGLLDINGQIFAEQGKALNAVASRNVKVIVVGNPCNTNALICLKNAPSIPAKNFHALTRL 250
           A LLDINGQIFAEQGKALNAVASRNVKVIVVGNPCNTNALICLKNAP+IPAKNFHALTRL
Sbjct: 189 AALLDINGQIFAEQGKALNAVASRNVKVIVVGNPCNTNALICLKNAPNIPAKNFHALTRL 248

Query: 251 DENRAKCQLALKAGVFYDKVSNMTIWGNHSTTQVPDFLNARINGLPVKEIIKDHKWLEEG 310
           DENRAKCQLALKAGVFYDKVSNMTIWGNHSTTQVPDFLNARI+GLPVKE+IKDHKWLEE 
Sbjct: 249 DENRAKCQLALKAGVFYDKVSNMTIWGNHSTTQVPDFLNARIDGLPVKEVIKDHKWLEEE 308

Query: 311 FTETIQKRGGLLIKKWGRSSAASTAVSIVDAMKSLVTPTPEGDWFSSGVYTNGNPYGIAE 370
           FTE +QKRGG LI+KWGRSSAAST+VSIVDA++SL+ PTPEGDWFS+GVYT GNPYGIAE
Sbjct: 309 FTEKVQKRGGALIQKWGRSSAASTSVSIVDAIRSLIIPTPEGDWFSTGVYTTGNPYGIAE 368

Query: 371 DIVFSMPCRSKGDGDYELVKDVIFDDYLRKRIAKTEQELLAEKKCVAHLTGEGIAFCDLP 430
           DIVFSMPCRSKGDGDYELVKDVIFDDYLR+++AKTE ELLAEKKCVAHLTGEGIA CDLP
Sbjct: 369 DIVFSMPCRSKGDGDYELVKDVIFDDYLRQKLAKTEAELLAEKKCVAHLTGEGIAVCDLP 428

Query: 431 EDTMLPGEM 439
            DTMLPGEM
Sbjct: 429 GDTMLPGEM 437
The chloroplastic, NADP-dependent form is essential for the photosynthesis C4 cycle, which allows plants to circumvent the problem of photorespiration. In C4 plants, NADP-MDH activity acts to convert oxaloacetate to malate in chloroplasts of mesophyll cells for transport to the bundle sheath cells.
Medicago sativa (taxid: 3879)
EC: 1EC: .EC: 1EC: .EC: 1EC: .EC: 8EC: 2
>sp|P21528|MDHP_PEA Malate dehydrogenase [NADP], chloroplastic OS=Pisum sativum PE=1 SV=2 Back     alignment and function description
>sp|Q05145|MDHP_MESCR Malate dehydrogenase [NADP], chloroplastic OS=Mesembryanthemum crystallinum GN=MDH1 PE=2 SV=1 Back     alignment and function description
>sp|P46489|MDHP_FLABI Malate dehydrogenase [NADP], chloroplastic OS=Flaveria bidentis PE=1 SV=1 Back     alignment and function description
>sp|P17606|MDHP1_SORBI Malate dehydrogenase [NADP] 1, chloroplastic OS=Sorghum bicolor PE=1 SV=1 Back     alignment and function description
>sp|P37229|MDHP2_SORBI Malate dehydrogenase [NADP] 2, chloroplastic OS=Sorghum bicolor PE=1 SV=1 Back     alignment and function description
>sp|P15719|MDHP_MAIZE Malate dehydrogenase [NADP], chloroplastic OS=Zea mays PE=1 SV=1 Back     alignment and function description
>sp|P52426|MDHP_SPIOL Malate dehydrogenase [NADP], chloroplastic OS=Spinacia oleracea GN=MDH PE=1 SV=1 Back     alignment and function description
>sp|Q6MAA3|MDH_PARUW Malate dehydrogenase OS=Protochlamydia amoebophila (strain UWE25) GN=mdh PE=3 SV=1 Back     alignment and function description
>sp|B2UKY5|MDH_AKKM8 Malate dehydrogenase OS=Akkermansia muciniphila (strain ATCC BAA-835) GN=mdh PE=3 SV=1 Back     alignment and function description

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query439
TAIR|locus:2161188443 AT5G58330 [Arabidopsis thalian 0.897 0.889 0.853 3.7e-183
UNIPROTKB|P0A5J6329 mdh "Malate dehydrogenase" [My 0.731 0.975 0.498 2.6e-79
TIGR_CMR|CBU_1241328 CBU_1241 "malate dehydrogenase 0.735 0.984 0.486 1.5e-76
DICTYBASE|DDB_G0280255333 mdhC "malate dehydrogenase" [D 0.742 0.978 0.448 3e-69
ZFIN|ZDB-GENE-040204-1333 mdh1a "malate dehydrogenase 1a 0.717 0.945 0.456 4.9e-69
ZFIN|ZDB-GENE-030131-7655333 mdh1b "malate dehydrogenase 1b 0.735 0.969 0.448 1.7e-68
UNIPROTKB|Q5ZME2334 MDH1 "Malate dehydrogenase, cy 0.719 0.946 0.467 3.5e-68
DICTYBASE|DDB_G0292600348 mdhB "malate dehydrogenase" [D 0.738 0.931 0.437 1.9e-67
UNIPROTKB|P11708334 MDH1 "Malate dehydrogenase, cy 0.717 0.943 0.453 4e-67
UNIPROTKB|Q3T145334 MDH1 "Malate dehydrogenase, cy 0.719 0.946 0.458 6.5e-67
TAIR|locus:2161188 AT5G58330 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1777 (630.6 bits), Expect = 3.7e-183, P = 3.7e-183
 Identities = 338/396 (85%), Positives = 368/396 (92%)

Query:    46 NPTISCSVNQ-VQAPVAVEQDDPKSKTNDCYGVFCLTYDLKAEEETKSWKKMVNIAVSGA 104
             N  ISCSV+Q  QAPVAV+++       +CYGVFCLTYDLKAEEET+SWKK++NIAVSGA
Sbjct:    48 NSKISCSVSQNSQAPVAVQENGLVKTKKECYGVFCLTYDLKAEEETRSWKKLINIAVSGA 107

Query:   105 AGMIANHLLFKLAAGEVLGPDQPIALKLLGSERSLQALEGVAMELEDSLFPLLREVKIGI 164
             AGMI+NHLLFKLA+GEV GPDQPIALKLLGSERS+QALEGVAMELEDSLFPLLREV IG 
Sbjct:   108 AGMISNHLLFKLASGEVFGPDQPIALKLLGSERSIQALEGVAMELEDSLFPLLREVDIGT 167

Query:   165 NPYELFEDAEWALLIGAKPRGPGMERAGLLDINGQIFAEQGKALNAVASRNVKVIVVGNP 224
             +P E+F+D EWA+LIGAKPRGPGMERA LLDINGQIFAEQGKALN  AS NVKV+VVGNP
Sbjct:   168 DPNEVFQDVEWAILIGAKPRGPGMERADLLDINGQIFAEQGKALNKAASPNVKVLVVGNP 227

Query:   225 CNTNALICLKNAPSIPAKNFHALTRLDENRAKCQLALKAGVFYDKVSNMTIWGNHSTTQV 284
             CNTNALICLKNAP+IPAKNFHALTRLDENRAKCQLALKAGVFYDKVSNMTIWGNHSTTQV
Sbjct:   228 CNTNALICLKNAPNIPAKNFHALTRLDENRAKCQLALKAGVFYDKVSNMTIWGNHSTTQV 287

Query:   285 PDFLNARINGLPVKEIIKDHKWLEEGFTETIQKRGGLLIKKWGRSSAASTAVSIVDAMKS 344
             PDFLNARINGLPVKE+I DHKWLEEGFTE++QKRGGLLI+KWGRSSAASTAVSIVDA+KS
Sbjct:   288 PDFLNARINGLPVKEVITDHKWLEEGFTESVQKRGGLLIQKWGRSSAASTAVSIVDAIKS 347

Query:   345 LVTPTPEGDWFSSGVYTNGNPYGIAEDIVFSMPCRSKGDGDYELVKDVIFDDYLRKRIAK 404
             LVTPTPEGDWFS+GVYT+GNPYGI E +VFSMPCRSKGDGDYELVKDV  DDYLR+RIAK
Sbjct:   348 LVTPTPEGDWFSTGVYTDGNPYGIEEGLVFSMPCRSKGDGDYELVKDVEIDDYLRQRIAK 407

Query:   405 TEQELLAEKKCVAHLTGEGIAFCDL-PEDTMLPGEM 439
             +E ELLAEK+CVAHLTGEGIA+CDL P DTMLPGE+
Sbjct:   408 SEAELLAEKRCVAHLTGEGIAYCDLGPVDTMLPGEV 443
GO:0000166 "nucleotide binding" evidence=IEA
GO:0003824 "catalytic activity" evidence=IEA
GO:0005737 "cytoplasm" evidence=ISM
GO:0005975 "carbohydrate metabolic process" evidence=IEA
GO:0006108 "malate metabolic process" evidence=IEA
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0016615 "malate dehydrogenase activity" evidence=IEA;ISS
GO:0016616 "oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor" evidence=IEA
GO:0044262 "cellular carbohydrate metabolic process" evidence=IEA
GO:0046554 "malate dehydrogenase (NADP+) activity" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0009941 "chloroplast envelope" evidence=IDA
GO:0005739 "mitochondrion" evidence=IDA
GO:0009570 "chloroplast stroma" evidence=IDA
GO:0009579 "thylakoid" evidence=IDA
GO:0048046 "apoplast" evidence=IDA
GO:0000023 "maltose metabolic process" evidence=RCA
GO:0006364 "rRNA processing" evidence=RCA
GO:0009657 "plastid organization" evidence=RCA
GO:0010207 "photosystem II assembly" evidence=RCA
GO:0019252 "starch biosynthetic process" evidence=RCA
GO:0019761 "glucosinolate biosynthetic process" evidence=RCA
GO:0043085 "positive regulation of catalytic activity" evidence=RCA
UNIPROTKB|P0A5J6 mdh "Malate dehydrogenase" [Mycobacterium tuberculosis (taxid:1773)] Back     alignment and assigned GO terms
TIGR_CMR|CBU_1241 CBU_1241 "malate dehydrogenase" [Coxiella burnetii RSA 493 (taxid:227377)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0280255 mdhC "malate dehydrogenase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040204-1 mdh1a "malate dehydrogenase 1a, NAD (soluble)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-7655 mdh1b "malate dehydrogenase 1b, NAD (soluble)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZME2 MDH1 "Malate dehydrogenase, cytoplasmic" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0292600 mdhB "malate dehydrogenase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|P11708 MDH1 "Malate dehydrogenase, cytoplasmic" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q3T145 MDH1 "Malate dehydrogenase, cytoplasmic" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O48902MDHP_MEDSA1, ., 1, ., 1, ., 8, 20.84140.96810.9725N/Ano
P52426MDHP_SPIOL1, ., 1, ., 1, ., 8, 20.75390.97030.9793N/Ano
P46489MDHP_FLABI1, ., 1, ., 1, ., 8, 20.83290.87920.8520N/Ano
B2HRH5MDH_MYCMM1, ., 1, ., 1, ., 3, 70.51390.73120.9756yesno
P21528MDHP_PEA1, ., 1, ., 1, ., 8, 20.84770.95440.9501N/Ano
P37229MDHP2_SORBI1, ., 1, ., 1, ., 8, 20.81450.89970.9143N/Ano
Q05145MDHP_MESCR1, ., 1, ., 1, ., 8, 20.79680.98400.9795N/Ano
B2UKY5MDH_AKKM81, ., 1, ., 1, ., 3, 70.52140.74030.9878yesno
Q6MAA3MDH_PARUW1, ., 1, ., 1, ., 3, 70.53860.73570.9787yesno
P15719MDHP_MAIZE1, ., 1, ., 1, ., 8, 20.79660.92250.9375N/Ano
P17606MDHP1_SORBI1, ., 1, ., 1, ., 8, 20.82780.88830.9090N/Ano
A0PVV1MDH_MYCUA1, ., 1, ., 1, ., 3, 70.51390.73120.9756yesno
A0QCI6MDH_MYCA11, ., 1, ., 1, ., 3, 70.50460.73120.9756yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.1.10.998
4th Layer1.1.1.820.994

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query439
PLN00112444 PLN00112, PLN00112, malate dehydrogenase (NADP); P 0.0
TIGR01757387 TIGR01757, Malate-DH_plant, malate dehydrogenase, 0.0
cd01338322 cd01338, MDH_choloroplast_like, Chloroplast-like m 0.0
TIGR01759323 TIGR01759, MalateDH-SF1, malate dehydrogenase 0.0
PRK05442326 PRK05442, PRK05442, malate dehydrogenase; Provisio 1e-176
cd00704323 cd00704, MDH, Malate dehydrogenase 1e-175
cd01336325 cd01336, MDH_cytoplasmic_cytosolic, Cytoplasmic an 1e-142
TIGR01758324 TIGR01758, MDH_euk_cyt, malate dehydrogenase, NAD- 1e-109
PLN00135309 PLN00135, PLN00135, malate dehydrogenase 1e-88
cd00650263 cd00650, LDH_MDH_like, NAD-dependent, lactate dehy 4e-72
TIGR01756313 TIGR01756, LDH_protist, lactate dehydrogenase 3e-69
COG0039313 COG0039, Mdh, Malate/lactate dehydrogenases [Energ 2e-66
cd05295452 cd05295, MDH_like, Malate dehydrogenase-like 2e-60
pfam02866173 pfam02866, Ldh_1_C, lactate/malate dehydrogenase, 4e-53
pfam00056142 pfam00056, Ldh_1_N, lactate/malate dehydrogenase, 3e-43
PTZ00117319 PTZ00117, PTZ00117, malate dehydrogenase; Provisio 9e-13
cd05294309 cd05294, LDH-like_MDH_nadp, A lactate dehydrogenas 7e-12
cd01339300 cd01339, LDH-like_MDH, L-lactate dehydrogenase-lik 4e-11
PRK06223307 PRK06223, PRK06223, malate dehydrogenase; Reviewed 1e-10
TIGR01763305 TIGR01763, MalateDH_bact, malate dehydrogenase, NA 5e-08
cd00300300 cd00300, LDH_like, L-lactate dehydrogenase-like en 8e-07
cd05290307 cd05290, LDH_3, A subgroup of L-lactate dehydrogen 2e-06
TIGR01772312 TIGR01772, MDH_euk_gproteo, malate dehydrogenase, 9e-06
PTZ00325321 PTZ00325, PTZ00325, malate dehydrogenase; Provisio 9e-06
PRK05086312 PRK05086, PRK05086, malate dehydrogenase; Provisio 4e-04
cd05291306 cd05291, HicDH_like, L-2-hydroxyisocapronate dehyd 5e-04
TIGR01771299 TIGR01771, L-LDH-NAD, L-lactate dehydrogenase 0.002
cd01337310 cd01337, MDH_glyoxysomal_mitochondrial, Glyoxysoma 0.003
>gnl|CDD|215060 PLN00112, PLN00112, malate dehydrogenase (NADP); Provisional Back     alignment and domain information 
 Score =  855 bits (2210), Expect = 0.0
 Identities = 363/445 (81%), Positives = 393/445 (88%), Gaps = 8/445 (1%)

Query: 2   AVVAQLSPSSYTET-----TRLSSSQLSLSSTHLSSLRRRAFRPIIGPRNPTISCSVNQV 56
             VA+LS    T       +RL SSQL LS THLS+  RRA  P     N  ISCSVNQ 
Sbjct: 1   MAVAELSTPKVTSPFLNTSSRLRSSQLGLSRTHLSNHFRRALLPRRRATNARISCSVNQA 60

Query: 57  -QAPVAVEQDDPKSKTNDCYGVFCLTYDLKAEEETKSWKKMVNIAVSGAAGMIANHLLFK 115
            QAP AV++   K+K  +CYGVFCLTYDLKAEEETKSWKK++N+AVSGAAGMI+NHLLFK
Sbjct: 61  SQAPAAVQEKGVKTK-KECYGVFCLTYDLKAEEETKSWKKLINVAVSGAAGMISNHLLFK 119

Query: 116 LAAGEVLGPDQPIALKLLGSERSLQALEGVAMELEDSLFPLLREVKIGINPYELFEDAEW 175
           LA+GEV GPDQPIALKLLGSERS QALEGVAMELEDSL+PLLREV IGI+PYE+F+DAEW
Sbjct: 120 LASGEVFGPDQPIALKLLGSERSKQALEGVAMELEDSLYPLLREVSIGIDPYEVFQDAEW 179

Query: 176 ALLIGAKPRGPGMERAGLLDINGQIFAEQGKALNAVASRNVKVIVVGNPCNTNALICLKN 235
           ALLIGAKPRGPGMERA LLDINGQIFAEQGKALN VASRNVKVIVVGNPCNTNALICLKN
Sbjct: 180 ALLIGAKPRGPGMERADLLDINGQIFAEQGKALNEVASRNVKVIVVGNPCNTNALICLKN 239

Query: 236 APSIPAKNFHALTRLDENRAKCQLALKAGVFYDKVSNMTIWGNHSTTQVPDFLNARINGL 295
           AP+IPAKNFHALTRLDENRAKCQLALKAGVFYDKVSN+TIWGNHSTTQVPDFLNA+INGL
Sbjct: 240 APNIPAKNFHALTRLDENRAKCQLALKAGVFYDKVSNVTIWGNHSTTQVPDFLNAKINGL 299

Query: 296 PVKEIIKDHKWLEEGFTETIQKRGGLLIKKWGRSSAASTAVSIVDAMKSLVTPTPEGDWF 355
           PVKE+I DHKWLEE FT  +QKRGG+LIKKWGRSSAASTAVSI DA+KSLVTPTPEGDWF
Sbjct: 300 PVKEVITDHKWLEEEFTPKVQKRGGVLIKKWGRSSAASTAVSIADAIKSLVTPTPEGDWF 359

Query: 356 SSGVYTNGNPYGIAEDIVFSMPCRSKGDGDYELVKDVIFDDYLRKRIAKTEQELLAEKKC 415
           S+GVYT+GNPYGIAE +VFSMPCRSKGDGDYE+VKDV  DDYLR+RI K+E ELLAEK+C
Sbjct: 360 STGVYTDGNPYGIAEGLVFSMPCRSKGDGDYEIVKDVEIDDYLRERIKKSEAELLAEKRC 419

Query: 416 VAHLTGEGIAFCDL-PEDTMLPGEM 439
           VAHLTGEG AFCDL PEDTMLPGEM
Sbjct: 420 VAHLTGEGGAFCDLRPEDTMLPGEM 444

Length = 444
>gnl|CDD|130818 TIGR01757, Malate-DH_plant, malate dehydrogenase, NADP-dependent Back     alignment and domain information
>gnl|CDD|133423 cd01338, MDH_choloroplast_like, Chloroplast-like malate dehydrogenases Back     alignment and domain information
>gnl|CDD|130820 TIGR01759, MalateDH-SF1, malate dehydrogenase Back     alignment and domain information
>gnl|CDD|235468 PRK05442, PRK05442, malate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|133420 cd00704, MDH, Malate dehydrogenase Back     alignment and domain information
>gnl|CDD|133421 cd01336, MDH_cytoplasmic_cytosolic, Cytoplasmic and cytosolic Malate dehydrogenases Back     alignment and domain information
>gnl|CDD|130819 TIGR01758, MDH_euk_cyt, malate dehydrogenase, NAD-dependent Back     alignment and domain information
>gnl|CDD|177744 PLN00135, PLN00135, malate dehydrogenase Back     alignment and domain information
>gnl|CDD|133419 cd00650, LDH_MDH_like, NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family Back     alignment and domain information
>gnl|CDD|130817 TIGR01756, LDH_protist, lactate dehydrogenase Back     alignment and domain information
>gnl|CDD|223117 COG0039, Mdh, Malate/lactate dehydrogenases [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|133431 cd05295, MDH_like, Malate dehydrogenase-like Back     alignment and domain information
>gnl|CDD|202437 pfam02866, Ldh_1_C, lactate/malate dehydrogenase, alpha/beta C-terminal domain Back     alignment and domain information
>gnl|CDD|200963 pfam00056, Ldh_1_N, lactate/malate dehydrogenase, NAD binding domain Back     alignment and domain information
>gnl|CDD|173409 PTZ00117, PTZ00117, malate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|133430 cd05294, LDH-like_MDH_nadp, A lactate dehydrogenases-like structure with malate dehydrogenase enzymatic activity Back     alignment and domain information
>gnl|CDD|133424 cd01339, LDH-like_MDH, L-lactate dehydrogenase-like malate dehydrogenase proteins Back     alignment and domain information
>gnl|CDD|180477 PRK06223, PRK06223, malate dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|233562 TIGR01763, MalateDH_bact, malate dehydrogenase, NAD-dependent Back     alignment and domain information
>gnl|CDD|133418 cd00300, LDH_like, L-lactate dehydrogenase-like enzymes Back     alignment and domain information
>gnl|CDD|133426 cd05290, LDH_3, A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>gnl|CDD|130833 TIGR01772, MDH_euk_gproteo, malate dehydrogenase, NAD-dependent Back     alignment and domain information
>gnl|CDD|240360 PTZ00325, PTZ00325, malate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235340 PRK05086, PRK05086, malate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|133427 cd05291, HicDH_like, L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>gnl|CDD|233566 TIGR01771, L-LDH-NAD, L-lactate dehydrogenase Back     alignment and domain information
>gnl|CDD|133422 cd01337, MDH_glyoxysomal_mitochondrial, Glyoxysomal and mitochondrial malate dehydrogenases Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 439
PLN00112444 malate dehydrogenase (NADP); Provisional 100.0
TIGR01757387 Malate-DH_plant malate dehydrogenase, NADP-depende 100.0
PRK05442326 malate dehydrogenase; Provisional 100.0
COG0039313 Mdh Malate/lactate dehydrogenases [Energy producti 100.0
TIGR01759323 MalateDH-SF1 malate dehydrogenase. This model repr 100.0
cd05295452 MDH_like Malate dehydrogenase-like. These MDH-like 100.0
cd01338322 MDH_choloroplast_like Chloroplast-like malate dehy 100.0
cd05290307 LDH_3 A subgroup of L-lactate dehydrogenases. L-la 100.0
cd00704323 MDH Malate dehydrogenase. Malate dehydrogenase (MD 100.0
KOG1496332 consensus Malate dehydrogenase [Energy production 100.0
TIGR01758324 MDH_euk_cyt malate dehydrogenase, NAD-dependent. T 100.0
KOG1495332 consensus Lactate dehydrogenase [Energy production 100.0
PLN02602350 lactate dehydrogenase 100.0
TIGR01771299 L-LDH-NAD L-lactate dehydrogenase. This model repr 100.0
TIGR01756313 LDH_protist lactate dehydrogenase. This model repr 100.0
cd05293312 LDH_1 A subgroup of L-lactate dehydrogenases. L-la 100.0
PRK00066315 ldh L-lactate dehydrogenase; Reviewed 100.0
PLN00135309 malate dehydrogenase 100.0
cd01336325 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosoli 100.0
cd05291306 HicDH_like L-2-hydroxyisocapronate dehydrogenases 100.0
cd00300300 LDH_like L-lactate dehydrogenase-like enzymes. Mem 100.0
PTZ00117319 malate dehydrogenase; Provisional 100.0
cd05292308 LDH_2 A subgroup of L-lactate dehydrogenases. L-la 100.0
cd05294309 LDH-like_MDH_nadp A lactate dehydrogenases-like st 100.0
TIGR01763305 MalateDH_bact malate dehydrogenase, NAD-dependent. 100.0
PTZ00082321 L-lactate dehydrogenase; Provisional 100.0
cd01337310 MDH_glyoxysomal_mitochondrial Glyoxysomal and mito 100.0
TIGR01772312 MDH_euk_gproteo malate dehydrogenase, NAD-dependen 100.0
PRK06223307 malate dehydrogenase; Reviewed 100.0
cd01339300 LDH-like_MDH L-lactate dehydrogenase-like malate d 100.0
PTZ00325321 malate dehydrogenase; Provisional 100.0
PRK05086312 malate dehydrogenase; Provisional 100.0
PLN00106323 malate dehydrogenase 100.0
cd00650263 LDH_MDH_like NAD-dependent, lactate dehydrogenase- 100.0
KOG1494345 consensus NAD-dependent malate dehydrogenase [Ener 100.0
PF02866174 Ldh_1_C: lactate/malate dehydrogenase, alpha/beta 100.0
cd05197425 GH4_glycoside_hydrolases Glycoside Hydrases Family 100.0
PRK15076431 alpha-galactosidase; Provisional 100.0
PF00056141 Ldh_1_N: lactate/malate dehydrogenase, NAD binding 100.0
cd05296419 GH4_P_beta_glucosidase Glycoside Hydrolases Family 99.97
cd05298437 GH4_GlvA_pagL_like Glycoside Hydrolases Family 4; 99.96
cd05297423 GH4_alpha_glucosidase_galactosidase Glycoside Hydr 99.96
COG1486442 CelF Alpha-galactosidases/6-phospho-beta-glucosida 99.94
PF02056183 Glyco_hydro_4: Family 4 glycosyl hydrolase; InterP 99.74
PF0380796 F420_oxidored: NADP oxidoreductase coenzyme F420-d 98.05
TIGR01915219 npdG NADPH-dependent F420 reductase. This model re 97.99
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 97.85
PRK08293287 3-hydroxybutyryl-CoA dehydrogenase; Validated 97.83
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 97.81
COG2085211 Predicted dinucleotide-binding enzymes [General fu 97.76
PRK07819286 3-hydroxybutyryl-CoA dehydrogenase; Validated 97.76
PF03721185 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen 97.75
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 97.75
PRK06130311 3-hydroxybutyryl-CoA dehydrogenase; Validated 97.7
PRK07066321 3-hydroxybutyryl-CoA dehydrogenase; Validated 97.69
PRK06035291 3-hydroxyacyl-CoA dehydrogenase; Validated 97.67
PRK07530292 3-hydroxybutyryl-CoA dehydrogenase; Validated 97.66
COG1004414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en 97.63
PLN02545295 3-hydroxybutyryl-CoA dehydrogenase 97.59
PRK07680273 late competence protein ComER; Validated 97.52
PRK12439341 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 97.47
PRK12491272 pyrroline-5-carboxylate reductase; Reviewed 97.47
PRK09260288 3-hydroxybutyryl-CoA dehydrogenase; Validated 97.43
PF11975232 Glyco_hydro_4C: Family 4 glycosyl hydrolase C-term 97.4
COG0345266 ProC Pyrroline-5-carboxylate reductase [Amino acid 97.4
PRK00094325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr 97.38
COG1250307 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabo 97.34
PRK14620326 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 97.31
PLN02353 473 probable UDP-glucose 6-dehydrogenase 97.29
PRK07531 495 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe 97.28
TIGR03026411 NDP-sugDHase nucleotide sugar dehydrogenase. All o 97.23
PLN02688266 pyrroline-5-carboxylate reductase 97.2
PRK07679279 pyrroline-5-carboxylate reductase; Reviewed 97.18
PRK11730715 fadB multifunctional fatty acid oxidation complex 97.17
PRK08268 507 3-hydroxy-acyl-CoA dehydrogenase; Validated 97.16
PRK11154708 fadJ multifunctional fatty acid oxidation complex 97.13
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 97.12
TIGR03376342 glycerol3P_DH glycerol-3-phosphate dehydrogenase ( 97.09
TIGR02441737 fa_ox_alpha_mit fatty acid oxidation complex, alph 97.09
PTZ00345365 glycerol-3-phosphate dehydrogenase; Provisional 97.07
PRK07634245 pyrroline-5-carboxylate reductase; Reviewed 97.07
PF10727127 Rossmann-like: Rossmann-like domain; InterPro: IPR 97.06
PRK12921305 2-dehydropantoate 2-reductase; Provisional 97.05
PLN03209 576 translocon at the inner envelope of chloroplast su 97.03
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 97.03
PRK06522304 2-dehydropantoate 2-reductase; Reviewed 97.01
PRK14618328 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 97.01
TIGR02279 503 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa 97.01
TIGR02440699 FadJ fatty oxidation complex, alpha subunit FadJ. 97.0
TIGR02437714 FadB fatty oxidation complex, alpha subunit FadB. 96.99
PRK15057388 UDP-glucose 6-dehydrogenase; Provisional 96.98
PRK11880267 pyrroline-5-carboxylate reductase; Reviewed 96.97
PRK06928277 pyrroline-5-carboxylate reductase; Reviewed 96.95
PRK08655 437 prephenate dehydrogenase; Provisional 96.91
COG0240329 GpsA Glycerol-3-phosphate dehydrogenase [Energy pr 96.89
PLN02166436 dTDP-glucose 4,6-dehydratase 96.86
PLN02695370 GDP-D-mannose-3',5'-epimerase 96.83
COG0300265 DltE Short-chain dehydrogenases of various substra 96.81
PRK08229341 2-dehydropantoate 2-reductase; Provisional 96.79
PRK07417279 arogenate dehydrogenase; Reviewed 96.78
PRK15182425 Vi polysaccharide biosynthesis protein TviB; Provi 96.73
COG1748389 LYS9 Saccharopine dehydrogenase and related protei 96.71
PRK11064415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro 96.71
PRK12549284 shikimate 5-dehydrogenase; Reviewed 96.69
PTZ00431260 pyrroline carboxylate reductase; Provisional 96.68
PRK07502307 cyclohexadienyl dehydrogenase; Validated 96.63
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 96.61
KOG1502327 consensus Flavonol reductase/cinnamoyl-CoA reducta 96.56
PLN02427386 UDP-apiose/xylose synthase 96.49
PLN02206442 UDP-glucuronate decarboxylase 96.42
CHL00194317 ycf39 Ycf39; Provisional 96.39
TIGR03589324 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This 96.34
PF01118121 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi 96.3
KOG2304298 consensus 3-hydroxyacyl-CoA dehydrogenase [Lipid t 96.27
PLN02778298 3,5-epimerase/4-reductase 96.25
PRK14619308 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 96.22
PRK14982340 acyl-ACP reductase; Provisional 96.22
PF01073280 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/iso 96.19
COG2910211 Putative NADH-flavin reductase [General function p 96.16
PRK06476258 pyrroline-5-carboxylate reductase; Reviewed 96.13
PLN02650351 dihydroflavonol-4-reductase 96.13
PRK11908347 NAD-dependent epimerase/dehydratase family protein 96.12
PF02719293 Polysacc_synt_2: Polysaccharide biosynthesis prote 96.1
PRK15181348 Vi polysaccharide biosynthesis protein TviC; Provi 96.1
PLN00198338 anthocyanidin reductase; Provisional 96.06
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain 96.01
PRK05708305 2-dehydropantoate 2-reductase; Provisional 95.95
PLN02662322 cinnamyl-alcohol dehydrogenase family protein 95.93
COG1893307 ApbA Ketopantoate reductase [Coenzyme metabolism] 95.9
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 95.87
PRK10675338 UDP-galactose-4-epimerase; Provisional 95.87
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 95.86
PRK08507275 prephenate dehydrogenase; Validated 95.81
PLN02989325 cinnamyl-alcohol dehydrogenase family protein 95.79
KOG1205282 consensus Predicted dehydrogenase [Secondary metab 95.78
PLN02214342 cinnamoyl-CoA reductase 95.7
COG0287279 TyrA Prephenate dehydrogenase [Amino acid transpor 95.67
KOG2711372 consensus Glycerol-3-phosphate dehydrogenase/dihyd 95.66
PTZ00142 470 6-phosphogluconate dehydrogenase; Provisional 95.65
TIGR00872298 gnd_rel 6-phosphogluconate dehydrogenase (decarbox 95.62
TIGR01505291 tartro_sem_red 2-hydroxy-3-oxopropionate reductase 95.62
TIGR01777292 yfcH conserved hypothetical protein TIGR01777. Thi 95.58
PRK08267260 short chain dehydrogenase; Provisional 95.57
PRK10538248 malonic semialdehyde reductase; Provisional 95.56
PLN02896353 cinnamyl-alcohol dehydrogenase 95.52
PRK06545359 prephenate dehydrogenase; Validated 95.51
TIGR02371325 ala_DH_arch alanine dehydrogenase, Archaeoglobus f 95.51
TIGR03466328 HpnA hopanoid-associated sugar epimerase. The sequ 95.49
TIGR01745366 asd_gamma aspartate-semialdehyde dehydrogenase, ga 95.49
PRK07102243 short chain dehydrogenase; Provisional 95.47
PRK13304265 L-aspartate dehydrogenase; Reviewed 95.46
PLN02240352 UDP-glucose 4-epimerase 95.45
TIGR02622349 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member 95.41
PRK11559296 garR tartronate semialdehyde reductase; Provisiona 95.39
COG2084286 MmsB 3-hydroxyisobutyrate dehydrogenase and relate 95.37
PLN02256304 arogenate dehydrogenase 95.35
COG1086588 Predicted nucleoside-diphosphate sugar epimerases 95.3
PRK12746254 short chain dehydrogenase; Provisional 95.22
PRK12939250 short chain dehydrogenase; Provisional 95.2
TIGR03206250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr 95.19
PRK06598369 aspartate-semialdehyde dehydrogenase; Reviewed 95.18
PRK06194287 hypothetical protein; Provisional 95.16
PRK05866293 short chain dehydrogenase; Provisional 95.16
PRK08291330 ectoine utilization protein EutC; Validated 95.14
PRK08125660 bifunctional UDP-glucuronic acid decarboxylase/UDP 95.13
PRK13394262 3-hydroxybutyrate dehydrogenase; Provisional 95.12
PLN02583297 cinnamoyl-CoA reductase 95.11
PRK06196315 oxidoreductase; Provisional 95.06
cd05311226 NAD_bind_2_malic_enz NAD(P) binding domain of mali 95.05
COG4221246 Short-chain alcohol dehydrogenase of unknown speci 95.05
PRK09987299 dTDP-4-dehydrorhamnose reductase; Provisional 95.04
PRK06249313 2-dehydropantoate 2-reductase; Provisional 95.04
TIGR01035417 hemA glutamyl-tRNA reductase. This enzyme, togethe 95.02
PRK15461296 NADH-dependent gamma-hydroxybutyrate dehydrogenase 95.01
PRK07326237 short chain dehydrogenase; Provisional 94.98
PRK07231251 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 94.97
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 94.94
PLN02986322 cinnamyl-alcohol dehydrogenase family protein 94.93
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily o 94.93
cd00757228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 94.92
PLN02572442 UDP-sulfoquinovose synthase 94.92
PRK08618325 ornithine cyclodeaminase; Validated 94.92
PRK11150308 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Pro 94.92
PF02558151 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: 94.87
PRK06407301 ornithine cyclodeaminase; Provisional 94.86
PRK06728347 aspartate-semialdehyde dehydrogenase; Provisional 94.85
PRK12490299 6-phosphogluconate dehydrogenase-like protein; Rev 94.85
PRK07424406 bifunctional sterol desaturase/short chain dehydro 94.82
COG1712255 Predicted dinucleotide-utilizing enzyme [General f 94.8
PRK05650270 short chain dehydrogenase; Provisional 94.76
PRK06141314 ornithine cyclodeaminase; Validated 94.75
PLN02657390 3,8-divinyl protochlorophyllide a 8-vinyl reductas 94.74
PRK07825273 short chain dehydrogenase; Provisional 94.71
PLN00141251 Tic62-NAD(P)-related group II protein; Provisional 94.67
PRK12429258 3-hydroxybutyrate dehydrogenase; Provisional 94.65
TIGR02992326 ectoine_eutC ectoine utilization protein EutC. Mem 94.65
PRK07069251 short chain dehydrogenase; Validated 94.64
PRK07478254 short chain dehydrogenase; Provisional 94.63
PRK07024257 short chain dehydrogenase; Provisional 94.63
PRK08213259 gluconate 5-dehydrogenase; Provisional 94.63
PRK00258278 aroE shikimate 5-dehydrogenase; Reviewed 94.57
COG0569225 TrkA K+ transport systems, NAD-binding component [ 94.53
PRK08340259 glucose-1-dehydrogenase; Provisional 94.52
PRK08265261 short chain dehydrogenase; Provisional 94.49
PF02423313 OCD_Mu_crystall: Ornithine cyclodeaminase/mu-cryst 94.48
PRK12937245 short chain dehydrogenase; Provisional 94.46
PRK07814263 short chain dehydrogenase; Provisional 94.46
PRK08339263 short chain dehydrogenase; Provisional 94.45
PRK07523255 gluconate 5-dehydrogenase; Provisional 94.44
PRK05671336 aspartate-semialdehyde dehydrogenase; Reviewed 94.43
PRK07904253 short chain dehydrogenase; Provisional 94.43
PRK07340304 ornithine cyclodeaminase; Validated 94.42
PF01113124 DapB_N: Dihydrodipicolinate reductase, N-terminus; 94.41
PRK07806248 short chain dehydrogenase; Provisional 94.41
PRK08643256 acetoin reductase; Validated 94.4
PRK12825249 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 94.4
PRK09599301 6-phosphogluconate dehydrogenase-like protein; Rev 94.36
PRK07774250 short chain dehydrogenase; Provisional 94.36
PLN02383344 aspartate semialdehyde dehydrogenase 94.35
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 94.32
PLN02780320 ketoreductase/ oxidoreductase 94.31
PRK07832272 short chain dehydrogenase; Provisional 94.27
PRK07454241 short chain dehydrogenase; Provisional 94.26
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 94.26
PRK09186256 flagellin modification protein A; Provisional 94.25
PRK14806 735 bifunctional cyclohexadienyl dehydrogenase/ 3-phos 94.24
PRK07666239 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 94.2
COG0451314 WcaG Nucleoside-diphosphate-sugar epimerases [Cell 94.2
TIGR01181317 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase. This 94.19
PRK08085254 gluconate 5-dehydrogenase; Provisional 94.17
PRK07890258 short chain dehydrogenase; Provisional 94.16
TIGR01214287 rmlD dTDP-4-dehydrorhamnose reductase. This enzyme 94.16
PRK12827249 short chain dehydrogenase; Provisional 94.15
TIGR02415254 23BDH acetoin reductases. One member of this famil 94.14
PRK00045423 hemA glutamyl-tRNA reductase; Reviewed 94.14
PRK06180277 short chain dehydrogenase; Provisional 94.14
TIGR00873 467 gnd 6-phosphogluconate dehydrogenase, decarboxylat 94.14
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 94.13
PRK06197306 short chain dehydrogenase; Provisional 94.07
PRK13940414 glutamyl-tRNA reductase; Provisional 94.06
PRK12480330 D-lactate dehydrogenase; Provisional 94.01
PLN00203519 glutamyl-tRNA reductase 94.01
PF01370236 Epimerase: NAD dependent epimerase/dehydratase fam 93.95
PRK06198260 short chain dehydrogenase; Provisional 93.94
PRK06124256 gluconate 5-dehydrogenase; Provisional 93.94
PLN02712 667 arogenate dehydrogenase 93.94
PRK05565247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 93.93
PRK08945247 putative oxoacyl-(acyl carrier protein) reductase; 93.92
PRK05717255 oxidoreductase; Validated 93.89
PRK06139330 short chain dehydrogenase; Provisional 93.86
PRK06823315 ornithine cyclodeaminase; Validated 93.85
PRK07589346 ornithine cyclodeaminase; Validated 93.85
PRK07453322 protochlorophyllide oxidoreductase; Validated 93.82
PRK06181263 short chain dehydrogenase; Provisional 93.81
PRK08040336 putative semialdehyde dehydrogenase; Provisional 93.78
PRK12826251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 93.77
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 93.76
PRK12384259 sorbitol-6-phosphate dehydrogenase; Provisional 93.76
PRK08644212 thiamine biosynthesis protein ThiF; Provisional 93.75
PLN02350 493 phosphogluconate dehydrogenase (decarboxylating) 93.74
PRK06138252 short chain dehydrogenase; Provisional 93.72
PRK07109334 short chain dehydrogenase; Provisional 93.72
cd01483143 E1_enzyme_family Superfamily of activating enzymes 93.68
TIGR01809282 Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO 93.67
PRK09072263 short chain dehydrogenase; Provisional 93.67
PRK06199379 ornithine cyclodeaminase; Validated 93.66
PRK12936245 3-ketoacyl-(acyl-carrier-protein) reductase NodG; 93.65
PRK12829264 short chain dehydrogenase; Provisional 93.65
PRK11199374 tyrA bifunctional chorismate mutase/prephenate deh 93.64
PLN02712667 arogenate dehydrogenase 93.6
PRK06172253 short chain dehydrogenase; Provisional 93.59
PRK05876275 short chain dehydrogenase; Provisional 93.57
PF03435386 Saccharop_dh: Saccharopine dehydrogenase ; InterPr 93.57
PRK05867253 short chain dehydrogenase; Provisional 93.53
PRK06182273 short chain dehydrogenase; Validated 93.5
cd01485198 E1-1_like Ubiquitin activating enzyme (E1), repeat 93.49
KOG0409327 consensus Predicted dehydrogenase [General functio 93.49
COG0677436 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenas 93.48
PRK06949258 short chain dehydrogenase; Provisional 93.47
PRK14874334 aspartate-semialdehyde dehydrogenase; Provisional 93.47
KOG1429350 consensus dTDP-glucose 4-6-dehydratase/UDP-glucuro 93.46
PRK07067257 sorbitol dehydrogenase; Provisional 93.46
PRK09291257 short chain dehydrogenase; Provisional 93.46
PLN02253280 xanthoxin dehydrogenase 93.46
PRK08703239 short chain dehydrogenase; Provisional 93.45
PRK07201 657 short chain dehydrogenase; Provisional 93.41
PRK09242257 tropinone reductase; Provisional 93.4
PRK06482276 short chain dehydrogenase; Provisional 93.4
PRK05884223 short chain dehydrogenase; Provisional 93.39
COG1090297 Predicted nucleoside-diphosphate sugar epimerase [ 93.39
PLN02260668 probable rhamnose biosynthetic enzyme 93.36
PLN02968381 Probable N-acetyl-gamma-glutamyl-phosphate reducta 93.36
PRK08300302 acetaldehyde dehydrogenase; Validated 93.35
PRK08063250 enoyl-(acyl carrier protein) reductase; Provisiona 93.35
PRK07677252 short chain dehydrogenase; Provisional 93.35
COG0373414 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] 93.27
COG0136334 Asd Aspartate-semialdehyde dehydrogenase [Amino ac 93.27
PRK05993277 short chain dehydrogenase; Provisional 93.23
PRK06128300 oxidoreductase; Provisional 93.22
PRK05855582 short chain dehydrogenase; Validated 93.18
PRK08219227 short chain dehydrogenase; Provisional 93.17
TIGR01472343 gmd GDP-mannose 4,6-dehydratase. Excluded from thi 93.17
PRK13302271 putative L-aspartate dehydrogenase; Provisional 93.13
PRK00048257 dihydrodipicolinate reductase; Provisional 93.08
PLN02686367 cinnamoyl-CoA reductase 93.05
PRK06101240 short chain dehydrogenase; Provisional 93.05
PRK07035252 short chain dehydrogenase; Provisional 93.04
PRK05557248 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 93.0
PRK06940275 short chain dehydrogenase; Provisional 93.0
PRK12747252 short chain dehydrogenase; Provisional 92.96
cd05312279 NAD_bind_1_malic_enz NAD(P) binding domain of mali 92.9
PRK07063260 short chain dehydrogenase; Provisional 92.88
PRK08324681 short chain dehydrogenase; Validated 92.88
PRK05479330 ketol-acid reductoisomerase; Provisional 92.83
PRK12828239 short chain dehydrogenase; Provisional 92.82
TIGR00507270 aroE shikimate 5-dehydrogenase. This model finds p 92.78
PRK07074257 short chain dehydrogenase; Provisional 92.77
PRK06125259 short chain dehydrogenase; Provisional 92.75
PRK05865 854 hypothetical protein; Provisional 92.74
smart00859122 Semialdhyde_dh Semialdehyde dehydrogenase, NAD bin 92.71
PRK09135249 pteridine reductase; Provisional 92.71
PRK08263275 short chain dehydrogenase; Provisional 92.7
PRK05875276 short chain dehydrogenase; Provisional 92.69
PRK06718202 precorrin-2 dehydrogenase; Reviewed 92.67
PRK12744257 short chain dehydrogenase; Provisional 92.62
PRK08277278 D-mannonate oxidoreductase; Provisional 92.6
PRK08251248 short chain dehydrogenase; Provisional 92.59
PLN02653340 GDP-mannose 4,6-dehydratase 92.56
PRK10084352 dTDP-glucose 4,6 dehydratase; Provisional 92.54
KOG1430361 consensus C-3 sterol dehydrogenase/3-beta-hydroxys 92.51
PRK06924251 short chain dehydrogenase; Provisional 92.49
PRK07985294 oxidoreductase; Provisional 92.48
PRK07097265 gluconate 5-dehydrogenase; Provisional 92.47
PRK06153393 hypothetical protein; Provisional 92.45
TIGR03325262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro 92.43
PRK05599246 hypothetical protein; Provisional 92.39
PRK08642253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 92.37
PRK07062265 short chain dehydrogenase; Provisional 92.36
PRK06500249 short chain dehydrogenase; Provisional 92.33
cd01491286 Ube1_repeat1 Ubiquitin activating enzyme (E1), rep 92.31
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 92.3
PRK06057255 short chain dehydrogenase; Provisional 92.23
PRK08664349 aspartate-semialdehyde dehydrogenase; Reviewed 92.22
PRK06046326 alanine dehydrogenase; Validated 92.19
TIGR01963255 PHB_DH 3-hydroxybutyrate dehydrogenase. This model 92.16
PRK07576264 short chain dehydrogenase; Provisional 92.12
PF04321286 RmlD_sub_bind: RmlD substrate binding domain; Inte 92.08
TIGR01832248 kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod 92.08
TIGR01724341 hmd_rel H2-forming N(5),N(10)-methenyltetrahydrome 92.06
PRK15059292 tartronate semialdehyde reductase; Provisional 92.04
PRK12823260 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat 92.0
TIGR00465314 ilvC ketol-acid reductoisomerase. This is the seco 91.97
PRK06200263 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog 91.96
PLN02260 668 probable rhamnose biosynthetic enzyme 91.93
PRK12935247 acetoacetyl-CoA reductase; Provisional 91.92
PRK06179270 short chain dehydrogenase; Provisional 91.91
COG2423330 Predicted ornithine cyclodeaminase, mu-crystallin 91.9
PRK12743256 oxidoreductase; Provisional 91.88
PRK05786238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 91.87
PRK09134258 short chain dehydrogenase; Provisional 91.86
cd01492197 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit 91.85
PRK10217355 dTDP-glucose 4,6-dehydratase; Provisional 91.85
COG0289266 DapB Dihydrodipicolinate reductase [Amino acid tra 91.85
PF00185158 OTCace: Aspartate/ornithine carbamoyltransferase, 91.84
PRK14027283 quinate/shikimate dehydrogenase; Provisional 91.84
PRK08416260 7-alpha-hydroxysteroid dehydrogenase; Provisional 91.8
PRK06901322 aspartate-semialdehyde dehydrogenase; Provisional 91.8
PRK12475338 thiamine/molybdopterin biosynthesis MoeB-like prot 91.8
PRK12320 699 hypothetical protein; Provisional 91.79
PRK06947248 glucose-1-dehydrogenase; Provisional 91.76
PRK08217253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 91.76
PRK13243333 glyoxylate reductase; Reviewed 91.75
PRK08862227 short chain dehydrogenase; Provisional 91.74
TIGR02197314 heptose_epim ADP-L-glycero-D-manno-heptose-6-epime 91.71
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 91.7
PRK06701290 short chain dehydrogenase; Provisional 91.67
COG1091281 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelo 91.62
PRK06935258 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 91.61
PRK06113255 7-alpha-hydroxysteroid dehydrogenase; Validated 91.61
PRK06077252 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 91.5
PRK05872296 short chain dehydrogenase; Provisional 91.47
PRK08818370 prephenate dehydrogenase; Provisional 91.42
PF01408120 GFO_IDH_MocA: Oxidoreductase family, NAD-binding R 91.41
PRK08589272 short chain dehydrogenase; Validated 91.37
PRK06914280 short chain dehydrogenase; Provisional 91.32
PRK07201657 short chain dehydrogenase; Provisional 91.28
PRK12742237 oxidoreductase; Provisional 91.26
PRK00436343 argC N-acetyl-gamma-glutamyl-phosphate reductase; 91.26
PF03949255 Malic_M: Malic enzyme, NAD binding domain; InterPr 91.23
PRK05597355 molybdopterin biosynthesis protein MoeB; Validated 91.2
TIGR01296339 asd_B aspartate-semialdehyde dehydrogenase (peptid 91.16
PRK08936261 glucose-1-dehydrogenase; Provisional 91.12
PRK08628258 short chain dehydrogenase; Provisional 91.12
PRK07688339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 91.09
TIGR01746367 Thioester-redct thioester reductase domain. It has 91.08
TIGR01179328 galE UDP-glucose-4-epimerase. This enzyme intercon 91.08
PRK05690245 molybdopterin biosynthesis protein MoeB; Provision 91.04
PRK07060245 short chain dehydrogenase; Provisional 91.02
PRK14106 450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 90.94
COG0078310 ArgF Ornithine carbamoyltransferase [Amino acid tr 90.92
PRK12557342 H(2)-dependent methylenetetrahydromethanopterin de 90.91
PRK08264238 short chain dehydrogenase; Validated 90.87
PRK12749288 quinate/shikimate dehydrogenase; Reviewed 90.84
PRK15469312 ghrA bifunctional glyoxylate/hydroxypyruvate reduc 90.84
TIGR02355240 moeB molybdopterin synthase sulfurylase MoeB. This 90.82
PRK08278273 short chain dehydrogenase; Provisional 90.76
PRK11863313 N-acetyl-gamma-glutamyl-phosphate reductase; Provi 90.59
PRK07775274 short chain dehydrogenase; Provisional 90.59
PRK07574385 formate dehydrogenase; Provisional 90.52
TIGR01692288 HIBADH 3-hydroxyisobutyrate dehydrogenase. This en 90.49
COG0169283 AroE Shikimate 5-dehydrogenase [Amino acid transpo 90.42
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 90.4
PRK08762376 molybdopterin biosynthesis protein MoeB; Validated 90.32
PRK08605332 D-lactate dehydrogenase; Validated 90.28
PRK15116268 sulfur acceptor protein CsdL; Provisional 90.17
PRK08306296 dipicolinate synthase subunit A; Reviewed 89.95
TIGR01850346 argC N-acetyl-gamma-glutamyl-phosphate reductase, 89.93
PRK08226263 short chain dehydrogenase; Provisional 89.92
cd00762254 NAD_bind_malic_enz NAD(P) binding domain of malic 89.91
PRK12938246 acetyacetyl-CoA reductase; Provisional 89.82
PRK05693274 short chain dehydrogenase; Provisional 89.61
TIGR01829242 AcAcCoA_reduct acetoacetyl-CoA reductase. (R)-3-hy 89.52
PRK07831262 short chain dehydrogenase; Provisional 89.52
PRK06114254 short chain dehydrogenase; Provisional 89.47
cd00755231 YgdL_like Family of activating enzymes (E1) of ubi 89.44
PRK04207341 glyceraldehyde-3-phosphate dehydrogenase; Provisio 89.29
PRK08269314 3-hydroxybutyryl-CoA dehydrogenase; Validated 89.26
PRK05600370 thiamine biosynthesis protein ThiF; Validated 89.25
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 89.23
PRK13303265 L-aspartate dehydrogenase; Provisional 89.2
KOG1014312 consensus 17 beta-hydroxysteroid dehydrogenase typ 89.19
PRK13301267 putative L-aspartate dehydrogenase; Provisional 89.17
PRK05854313 short chain dehydrogenase; Provisional 89.12
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 89.0
PF00106167 adh_short: short chain dehydrogenase alcohol dehyd 88.92
PRK12367245 short chain dehydrogenase; Provisional 88.89
TIGR02632676 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alc 88.84
PRK08223287 hypothetical protein; Validated 88.83
PLN02928347 oxidoreductase family protein 88.83
PLN03129581 NADP-dependent malic enzyme; Provisional 88.82
PRK12824245 acetoacetyl-CoA reductase; Provisional 88.81
PRK15438378 erythronate-4-phosphate dehydrogenase PdxB; Provis 88.75
KOG1201300 consensus Hydroxysteroid 17-beta dehydrogenase 11 88.63
TIGR01289314 LPOR light-dependent protochlorophyllide reductase 88.55
PRK01710 458 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 88.38
PRK07856252 short chain dehydrogenase; Provisional 88.38
COG0002349 ArgC Acetylglutamate semialdehyde dehydrogenase [A 88.32
PRK00257381 erythronate-4-phosphate dehydrogenase; Validated 88.24
COG3967245 DltE Short-chain dehydrogenase involved in D-alani 88.17
PRK05476425 S-adenosyl-L-homocysteine hydrolase; Provisional 88.02
KOG2666 481 consensus UDP-glucose/GDP-mannose dehydrogenase [C 87.62
PRK06484 520 short chain dehydrogenase; Validated 87.49
PLN03139386 formate dehydrogenase; Provisional 87.46
cd01489312 Uba2_SUMO Ubiquitin activating enzyme (E1) subunit 87.43
PRK07877 722 hypothetical protein; Provisional 87.4
PRK06484520 short chain dehydrogenase; Validated 87.38
PRK12548289 shikimate 5-dehydrogenase; Provisional 87.17
TIGR01831239 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductas 87.11
TIGR00978341 asd_EA aspartate-semialdehyde dehydrogenase (non-p 87.01
TIGR03693 637 ocin_ThiF_like putative thiazole-containing bacter 86.9
PRK09310477 aroDE bifunctional 3-dehydroquinate dehydratase/sh 86.86
TIGR00670301 asp_carb_tr aspartate carbamoyltransferase. Ornith 86.74
COG4007340 Predicted dehydrogenase related to H2-forming N5,N 86.72
PRK09330384 cell division protein FtsZ; Validated 86.7
PRK06463255 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 86.52
PLN02819 1042 lysine-ketoglutarate reductase/saccharopine dehydr 86.47
PLN02996 491 fatty acyl-CoA reductase 86.33
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 86.26
PRK08177225 short chain dehydrogenase; Provisional 86.06
TIGR00936406 ahcY adenosylhomocysteinase. This enzyme hydrolyze 86.03
PRK07578199 short chain dehydrogenase; Provisional 85.98
PTZ00317559 NADP-dependent malic enzyme; Provisional 85.91
PRK12550272 shikimate 5-dehydrogenase; Reviewed 85.84
PLN02494477 adenosylhomocysteinase 85.83
PRK07878392 molybdopterin biosynthesis-like protein MoeZ; Vali 85.75
KOG1203411 consensus Predicted dehydrogenase [Carbohydrate tr 85.67
COG5322351 Predicted dehydrogenase [General function predicti 85.65
cd01484234 E1-2_like Ubiquitin activating enzyme (E1), repeat 85.57
PRK07411390 hypothetical protein; Validated 85.55
PTZ00075476 Adenosylhomocysteinase; Provisional 85.42
PRK14192283 bifunctional 5,10-methylene-tetrahydrofolate dehyd 85.28
TIGR01830239 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) re 85.28
PRK08993253 2-deoxy-D-gluconate 3-dehydrogenase; Validated 85.28
PRK08303305 short chain dehydrogenase; Provisional 85.13
PRK06841255 short chain dehydrogenase; Provisional 85.1
PRK09730247 putative NAD(P)-binding oxidoreductase; Provisiona 85.09
TIGR00036266 dapB dihydrodipicolinate reductase. 85.09
PRK09496 453 trkA potassium transporter peripheral membrane com 85.05
COG1052324 LdhA Lactate dehydrogenase and related dehydrogena 85.04
TIGR01851310 argC_other N-acetyl-gamma-glutamyl-phosphate reduc 84.95
PRK06523260 short chain dehydrogenase; Provisional 84.94
PRK07889256 enoyl-(acyl carrier protein) reductase; Provisiona 84.92
PRK12481251 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 84.79
PLN02306386 hydroxypyruvate reductase 84.71
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 84.69
PRK07792306 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 84.63
PRK13535336 erythrose 4-phosphate dehydrogenase; Provisional 84.57
PRK07791286 short chain dehydrogenase; Provisional 84.5
cd01488291 Uba3_RUB Ubiquitin activating enzyme (E1) subunit 84.38
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 84.36
>PLN00112 malate dehydrogenase (NADP); Provisional Back     alignment and domain information 
Probab=100.00  E-value=2.4e-108  Score=848.58  Aligned_cols=435  Identities=83%  Similarity=1.291  Sum_probs=410.6

Q ss_pred             eeeecCCC-----ccccceeccccccccccccCccccccCCCCCCCCCCeeEEEeccc-ccccccccCCCCCCCCCccee
Q 013619            4 VAQLSPSS-----YTETTRLSSSQLSLSSTHLSSLRRRAFRPIIGPRNPTISCSVNQV-QAPVAVEQDDPKSKTNDCYGV   77 (439)
Q Consensus         4 ~~~~~~~~-----~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~gv   77 (439)
                      ||+++++.     .+++++++++|+++++++++.|+|+.|+|++|.++++|+|||+++ |+|+++++++++.| +|||||
T Consensus         3 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~   81 (444)
T PLN00112          3 VAELSTPKVTSPFLNTSSRLRSSQLGLSRTHLSNHFRRALLPRRRATNARISCSVNQASQAPAAVQEKGVKTK-KECYGV   81 (444)
T ss_pred             chhccccccccccccchhhccccccccccccccccccccccccccccccceeeccccccCCCccccccccccC-CCceEE
Confidence            56666553     568889999999999999999999999999999999999999999 88888888887666 999999


Q ss_pred             eEEeecccchHHHhhccCCCEEEEEcCCCchHHHHHHHHHhcCCCCCCCceEEEecccccchhhHHHHHHHHhcccCCCC
Q 013619           78 FCLTYDLKAEEETKSWKKMVNIAVSGAAGMIANHLLFKLAAGEVLGPDQPIALKLLGSERSLQALEGVAMELEDSLFPLL  157 (439)
Q Consensus        78 ~~~~~~~~~~~~~~~~~~~~KI~IIGA~G~VG~~la~~L~~~~l~~~~~~I~L~l~~~d~~~e~l~g~a~DL~~~~~~~~  157 (439)
                      ||++||+.+|++.+.|+++.||+||||+|+||+++++.|+.+++++.|+.|.++|+++|+++++++|++|||+|+++++.
T Consensus        82 ~~~~~~~~~~~~~~~~~~~~KV~IIGAaG~VG~~~A~~L~~~~v~g~~~~i~~eLvliD~~~~~a~G~amDL~daa~~~~  161 (444)
T PLN00112         82 FCLTYDLKAEEETKSWKKLINVAVSGAAGMISNHLLFKLASGEVFGPDQPIALKLLGSERSKQALEGVAMELEDSLYPLL  161 (444)
T ss_pred             EEEEEecccchhhhcCCCCeEEEEECCCcHHHHHHHHHHHhcccccCCCCcccEEEEEcCCcchhHHHHHHHHHhhhhhc
Confidence            99999999999999999999999999779999999999999999998788877777789999999999999999987776


Q ss_pred             ccEEEecCcccccCCCcEEEEeCCcCCCCCCchhhhHHHHHHHHHHHHHHHHhhcCCCeEEEEeCCchhHHHHHHHHHCC
Q 013619          158 REVKIGINPYELFEDAEWALLIGAKPRGPGMERAGLLDINGQIFAEQGKALNAVASRNVKVIVVGNPCNTNALICLKNAP  237 (439)
Q Consensus       158 ~~v~i~~~~~eal~dADiVIitag~~~kpg~~r~~ll~~N~~ii~~i~~~i~~~a~p~aivIvvtNPvd~~t~i~~k~s~  237 (439)
                      .++++++++|++++|||+||+++|.|++|||+|.|++..|++||+++++.|+++++|+++||++|||||+||++++++++
T Consensus       162 ~~v~i~~~~ye~~kdaDiVVitAG~prkpG~tR~dLl~~N~~I~k~i~~~I~~~a~p~~ivIVVsNPvDv~t~v~~k~sg  241 (444)
T PLN00112        162 REVSIGIDPYEVFQDAEWALLIGAKPRGPGMERADLLDINGQIFAEQGKALNEVASRNVKVIVVGNPCNTNALICLKNAP  241 (444)
T ss_pred             CceEEecCCHHHhCcCCEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHhcCCCeEEEEcCCcHHHHHHHHHHHcC
Confidence            67888899999999999999999999999999999999999999999999999547999999999999999999999997


Q ss_pred             CCCCCceeccccchHHHHHHHHHHHhCCCcccceeeEEEeccCCcceeccccceecCcchhhhhhhccccHHHHHHHHHH
Q 013619          238 SIPAKNFHALTRLDENRAKCQLALKAGVFYDKVSNMTIWGNHSTTQVPDFLNARINGLPVKEIIKDHKWLEEGFTETIQK  317 (439)
Q Consensus       238 ~~p~kvig~gt~LDs~R~~~~lA~~lgv~~~~V~~~~V~GeHGdt~Vp~~S~~~I~G~pi~~~i~~~~~~~~ei~~~v~~  317 (439)
                      .+|+|+||+||.||++||+++||+++||++++|++++||||||++|||+||+++|+|+|+.+++.+.+|+.++|.+++++
T Consensus       242 ~~~~rViGtgT~LDsaR~r~~LA~~l~V~~~~V~~~~V~GeHGdsqvp~wS~a~V~G~pl~e~i~~~~~~~~ei~~~v~~  321 (444)
T PLN00112        242 NIPAKNFHALTRLDENRAKCQLALKAGVFYDKVSNVTIWGNHSTTQVPDFLNAKINGLPVKEVITDHKWLEEEFTPKVQK  321 (444)
T ss_pred             CCCcceEEeeccHHHHHHHHHHHHHhCcCHHHcccceEEecCCCceeeccceeEECCccHHHhhccccchHHHHHHHHHH
Confidence            66669999999999999999999999999999987789999999999999999999999999988777888999999999


Q ss_pred             hHHHHHHhcCCccHHHHHHHHHHHHHHhhcCCCCCcEEEEeeeeCCCccCCCCceEEEEEEEEcCCCceEeecCCCCCHH
Q 013619          318 RGGLLIKKWGRSSAASTAVSIVDAMKSLVTPTPEGDWFSSGVYTNGNPYGIAEDIVFSMPCRSKGDGDYELVKDVIFDDY  397 (439)
Q Consensus       318 ~~~~Ii~~kG~s~~~s~A~~i~~aI~~il~~~d~~~v~~~sv~~~G~~yGip~dv~~svPv~ig~~Gv~~iv~~~~L~~~  397 (439)
                      +|++|+++||+++|+++|.+++++|++|+.|+|+++|+|+|++++|++||+++|++||+||++|++|+++++++++|+++
T Consensus       322 ~g~~Ii~~kG~t~~~s~a~ai~~~I~ail~~~d~~~vlpvsv~l~G~~YGi~~dv~~SvPvvig~~Gv~~Iv~el~L~~~  401 (444)
T PLN00112        322 RGGVLIKKWGRSSAASTAVSIADAIKSLVTPTPEGDWFSTGVYTDGNPYGIAEGLVFSMPCRSKGDGDYEIVKDVEIDDY  401 (444)
T ss_pred             HHHHHHhccCchhHHHHHHHHHHHHHHHHcCCCCCeEEEEEEEeCCcccCCCCCeEEEeEEEEeCCeeEEECCCCCCCHH
Confidence            99999999999999899999999999999888999999999999994499989999999999999999999966999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHhhccCcccccC-CCCCCCCCCC
Q 013619          398 LRKRIAKTEQELLAEKKCVAHLTGEGIAFCDL-PEDTMLPGEM  439 (439)
Q Consensus       398 E~~~l~~sa~~l~~~~~~v~~~~~~~~~~~~~-~~~~~~~~~~  439 (439)
                      |+++|++|+++|.+|++++.|++|+..+.|++ |+||||||||
T Consensus       402 E~~~l~~Sa~~L~~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~  444 (444)
T PLN00112        402 LRERIKKSEAELLAEKRCVAHLTGEGGAFCDLRPEDTMLPGEM  444 (444)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHhhhccccCCCCccccCCCCC
Confidence            99999999999999999999999999999999 8999999998

>TIGR01757 Malate-DH_plant malate dehydrogenase, NADP-dependent Back     alignment and domain information
>PRK05442 malate dehydrogenase; Provisional Back     alignment and domain information
>COG0039 Mdh Malate/lactate dehydrogenases [Energy production and conversion] Back     alignment and domain information
>TIGR01759 MalateDH-SF1 malate dehydrogenase Back     alignment and domain information
>cd05295 MDH_like Malate dehydrogenase-like Back     alignment and domain information
>cd01338 MDH_choloroplast_like Chloroplast-like malate dehydrogenases Back     alignment and domain information
>cd05290 LDH_3 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>cd00704 MDH Malate dehydrogenase Back     alignment and domain information
>KOG1496 consensus Malate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>TIGR01758 MDH_euk_cyt malate dehydrogenase, NAD-dependent Back     alignment and domain information
>KOG1495 consensus Lactate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PLN02602 lactate dehydrogenase Back     alignment and domain information
>TIGR01771 L-LDH-NAD L-lactate dehydrogenase Back     alignment and domain information
>TIGR01756 LDH_protist lactate dehydrogenase Back     alignment and domain information
>cd05293 LDH_1 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PRK00066 ldh L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>PLN00135 malate dehydrogenase Back     alignment and domain information
>cd01336 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosolic Malate dehydrogenases Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>cd00300 LDH_like L-lactate dehydrogenase-like enzymes Back     alignment and domain information
>PTZ00117 malate dehydrogenase; Provisional Back     alignment and domain information
>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>cd05294 LDH-like_MDH_nadp A lactate dehydrogenases-like structure with malate dehydrogenase enzymatic activity Back     alignment and domain information
>TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PTZ00082 L-lactate dehydrogenase; Provisional Back     alignment and domain information
>cd01337 MDH_glyoxysomal_mitochondrial Glyoxysomal and mitochondrial malate dehydrogenases Back     alignment and domain information
>TIGR01772 MDH_euk_gproteo malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PRK06223 malate dehydrogenase; Reviewed Back     alignment and domain information
>cd01339 LDH-like_MDH L-lactate dehydrogenase-like malate dehydrogenase proteins Back     alignment and domain information
>PTZ00325 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK05086 malate dehydrogenase; Provisional Back     alignment and domain information
>PLN00106 malate dehydrogenase Back     alignment and domain information
>cd00650 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family Back     alignment and domain information
>KOG1494 consensus NAD-dependent malate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PF02866 Ldh_1_C: lactate/malate dehydrogenase, alpha/beta C-terminal domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR022383 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] Back     alignment and domain information
>cd05197 GH4_glycoside_hydrolases Glycoside Hydrases Family 4 Back     alignment and domain information
>PRK15076 alpha-galactosidase; Provisional Back     alignment and domain information
>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] Back     alignment and domain information
>cd05296 GH4_P_beta_glucosidase Glycoside Hydrolases Family 4; Phospho-beta-glucosidase Back     alignment and domain information
>cd05298 GH4_GlvA_pagL_like Glycoside Hydrolases Family 4; GlvA- and pagL-like glycosidases Back     alignment and domain information
>cd05297 GH4_alpha_glucosidase_galactosidase Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases Back     alignment and domain information
>COG1486 CelF Alpha-galactosidases/6-phospho-beta-glucosidases, family 4 of glycosyl hydrolases [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF02056 Glyco_hydro_4: Family 4 glycosyl hydrolase; InterPro: IPR001088 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain Back     alignment and domain information
>TIGR01915 npdG NADPH-dependent F420 reductase Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>COG2085 Predicted dinucleotide-binding enzymes [General function prediction only] Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN02545 3-hydroxybutyryl-CoA dehydrogenase Back     alignment and domain information
>PRK07680 late competence protein ComER; Validated Back     alignment and domain information
>PRK12439 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK12491 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PF11975 Glyco_hydro_4C: Family 4 glycosyl hydrolase C-terminal domain; InterPro: IPR022616 This domain is found primarily in bacterial family 4 glycosyl hydrolases Back     alignment and domain information
>COG0345 ProC Pyrroline-5-carboxylate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>COG1250 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabolism] Back     alignment and domain information
>PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PLN02353 probable UDP-glucose 6-dehydrogenase Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>PLN02688 pyrroline-5-carboxylate reductase Back     alignment and domain information
>PRK07679 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>PRK08268 3-hydroxy-acyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>TIGR03376 glycerol3P_DH glycerol-3-phosphate dehydrogenase (NAD(+)) Back     alignment and domain information
>TIGR02441 fa_ox_alpha_mit fatty acid oxidation complex, alpha subunit, mitochondrial Back     alignment and domain information
>PTZ00345 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK07634 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins Back     alignment and domain information
>PRK12921 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information
>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC Back     alignment and domain information
>TIGR02440 FadJ fatty oxidation complex, alpha subunit FadJ Back     alignment and domain information
>TIGR02437 FadB fatty oxidation complex, alpha subunit FadB Back     alignment and domain information
>PRK15057 UDP-glucose 6-dehydrogenase; Provisional Back     alignment and domain information
>PRK11880 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK06928 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK08655 prephenate dehydrogenase; Provisional Back     alignment and domain information
>COG0240 GpsA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PLN02166 dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>PLN02695 GDP-D-mannose-3',5'-epimerase Back     alignment and domain information
>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>PRK08229 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK07417 arogenate dehydrogenase; Reviewed Back     alignment and domain information
>PRK15182 Vi polysaccharide biosynthesis protein TviB; Provisional Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PTZ00431 pyrroline carboxylate reductase; Provisional Back     alignment and domain information
>PRK07502 cyclohexadienyl dehydrogenase; Validated Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>KOG1502 consensus Flavonol reductase/cinnamoyl-CoA reductase [Defense mechanisms] Back     alignment and domain information
>PLN02427 UDP-apiose/xylose synthase Back     alignment and domain information
>PLN02206 UDP-glucuronate decarboxylase Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase Back     alignment and domain information
>PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate Back     alignment and domain information
>KOG2304 consensus 3-hydroxyacyl-CoA dehydrogenase [Lipid transport and metabolism] Back     alignment and domain information
>PLN02778 3,5-epimerase/4-reductase Back     alignment and domain information
>PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK14982 acyl-ACP reductase; Provisional Back     alignment and domain information
>PF01073 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/isomerase family; InterPro: IPR002225 The enzyme 3 beta-hydroxysteroid dehydrogenase/5-ene-4-ene isomerase (3 beta-HSD) catalyses the oxidation and isomerisation of 5-ene-3 beta-hydroxypregnene and 5-ene-hydroxyandrostene steroid precursors into the corresponding 4-ene-ketosteroids necessary for the formation of all classes of steroid hormones Back     alignment and domain information
>COG2910 Putative NADH-flavin reductase [General function prediction only] Back     alignment and domain information
>PRK06476 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PLN02650 dihydroflavonol-4-reductase Back     alignment and domain information
>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional Back     alignment and domain information
>PF02719 Polysacc_synt_2: Polysaccharide biosynthesis protein; InterPro: IPR003869 This domain is found in diverse bacterial polysaccharide biosynthesis proteins including the CapD protein from Staphylococcus aureus [], the WalL protein, mannosyl-transferase [], and several putative epimerases Back     alignment and domain information
>PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional Back     alignment and domain information
>PLN00198 anthocyanidin reductase; Provisional Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>PRK05708 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PLN02662 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>COG1893 ApbA Ketopantoate reductase [Coenzyme metabolism] Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>PRK10675 UDP-galactose-4-epimerase; Provisional Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>PRK08507 prephenate dehydrogenase; Validated Back     alignment and domain information
>PLN02989 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>KOG1205 consensus Predicted dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02214 cinnamoyl-CoA reductase Back     alignment and domain information
>COG0287 TyrA Prephenate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2711 consensus Glycerol-3-phosphate dehydrogenase/dihydroxyacetone 3-phosphate reductase [Energy production and conversion] Back     alignment and domain information
>PTZ00142 6-phosphogluconate dehydrogenase; Provisional Back     alignment and domain information
>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase Back     alignment and domain information
>TIGR01777 yfcH conserved hypothetical protein TIGR01777 Back     alignment and domain information
>PRK08267 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK10538 malonic semialdehyde reductase; Provisional Back     alignment and domain information
>PLN02896 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>PRK06545 prephenate dehydrogenase; Validated Back     alignment and domain information
>TIGR02371 ala_DH_arch alanine dehydrogenase, Archaeoglobus fulgidus type Back     alignment and domain information
>TIGR03466 HpnA hopanoid-associated sugar epimerase Back     alignment and domain information
>TIGR01745 asd_gamma aspartate-semialdehyde dehydrogenase, gamma-proteobacterial Back     alignment and domain information
>PRK07102 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK13304 L-aspartate dehydrogenase; Reviewed Back     alignment and domain information
>PLN02240 UDP-glucose 4-epimerase Back     alignment and domain information
>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase Back     alignment and domain information
>PRK11559 garR tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>COG2084 MmsB 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism] Back     alignment and domain information
>PLN02256 arogenate dehydrogenase Back     alignment and domain information
>COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK12746 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>PRK06598 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PRK06194 hypothetical protein; Provisional Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08291 ectoine utilization protein EutC; Validated Back     alignment and domain information
>PRK08125 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PLN02583 cinnamoyl-CoA reductase Back     alignment and domain information
>PRK06196 oxidoreductase; Provisional Back     alignment and domain information
>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>COG4221 Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] Back     alignment and domain information
>PRK09987 dTDP-4-dehydrorhamnose reductase; Provisional Back     alignment and domain information
>PRK06249 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>TIGR01035 hemA glutamyl-tRNA reductase Back     alignment and domain information
>PRK15461 NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>PLN02986 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>cd01487 E1_ThiF_like E1_ThiF_like Back     alignment and domain information
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA Back     alignment and domain information
>PLN02572 UDP-sulfoquinovose synthase Back     alignment and domain information
>PRK08618 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK11150 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Provisional Back     alignment and domain information
>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 Back     alignment and domain information
>PRK06407 ornithine cyclodeaminase; Provisional Back     alignment and domain information
>PRK06728 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated Back     alignment and domain information
>COG1712 Predicted dinucleotide-utilizing enzyme [General function prediction only] Back     alignment and domain information
>PRK05650 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06141 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>PRK07825 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>TIGR02992 ectoine_eutC ectoine utilization protein EutC Back     alignment and domain information
>PRK07069 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07478 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07024 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08213 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK08340 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK08265 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF02423 OCD_Mu_crystall: Ornithine cyclodeaminase/mu-crystallin family; InterPro: IPR003462 This entry represents the bacterial ornithine cyclodeaminase enzyme family, which catalyse the deamination of ornithine to proline [] Back     alignment and domain information
>PRK12937 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07814 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08339 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK05671 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PRK07904 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07340 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] Back     alignment and domain information
>PRK07806 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08643 acetoin reductase; Validated Back     alignment and domain information
>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02383 aspartate semialdehyde dehydrogenase Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PLN02780 ketoreductase/ oxidoreductase Back     alignment and domain information
>PRK07832 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07454 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>PRK09186 flagellin modification protein A; Provisional Back     alignment and domain information
>PRK14806 bifunctional cyclohexadienyl dehydrogenase/ 3-phosphoshikimate 1-carboxyvinyltransferase; Provisional Back     alignment and domain information
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>COG0451 WcaG Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>PRK08085 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK07890 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01214 rmlD dTDP-4-dehydrorhamnose reductase Back     alignment and domain information
>PRK12827 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02415 23BDH acetoin reductases Back     alignment and domain information
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>PRK06180 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR00873 gnd 6-phosphogluconate dehydrogenase, decarboxylating Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>PRK06197 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK13940 glutamyl-tRNA reductase; Provisional Back     alignment and domain information
>PRK12480 D-lactate dehydrogenase; Provisional Back     alignment and domain information
>PLN00203 glutamyl-tRNA reductase Back     alignment and domain information
>PF01370 Epimerase: NAD dependent epimerase/dehydratase family; InterPro: IPR001509 This family of proteins utilise NAD as a cofactor Back     alignment and domain information
>PRK06198 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06124 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK05717 oxidoreductase; Validated Back     alignment and domain information
>PRK06139 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06823 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK07589 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK07453 protochlorophyllide oxidoreductase; Validated Back     alignment and domain information
>PRK06181 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08040 putative semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>PLN02350 phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK06138 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07109 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type Back     alignment and domain information
>PRK09072 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06199 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed Back     alignment and domain information
>PRK12829 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>PRK06172 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05876 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06182 short chain dehydrogenase; Validated Back     alignment and domain information
>cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like Back     alignment and domain information
>KOG0409 consensus Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>COG0677 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK06949 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK14874 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>KOG1429 consensus dTDP-glucose 4-6-dehydratase/UDP-glucuronic acid decarboxylase [Carbohydrate transport and metabolism; Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PRK07067 sorbitol dehydrogenase; Provisional Back     alignment and domain information
>PRK09291 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02253 xanthoxin dehydrogenase Back     alignment and domain information
>PRK08703 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09242 tropinone reductase; Provisional Back     alignment and domain information
>PRK06482 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05884 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG1090 Predicted nucleoside-diphosphate sugar epimerase [General function prediction only] Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>PLN02968 Probable N-acetyl-gamma-glutamyl-phosphate reductase Back     alignment and domain information
>PRK08300 acetaldehyde dehydrogenase; Validated Back     alignment and domain information
>PRK08063 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07677 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] Back     alignment and domain information
>COG0136 Asd Aspartate-semialdehyde dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05993 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06128 oxidoreductase; Provisional Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK08219 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01472 gmd GDP-mannose 4,6-dehydratase Back     alignment and domain information
>PRK13302 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK00048 dihydrodipicolinate reductase; Provisional Back     alignment and domain information
>PLN02686 cinnamoyl-CoA reductase Back     alignment and domain information
>PRK06101 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07035 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK06940 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12747 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd05312 NAD_bind_1_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 1 Back     alignment and domain information
>PRK07063 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08324 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK05479 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>PRK12828 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR00507 aroE shikimate 5-dehydrogenase Back     alignment and domain information
>PRK07074 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06125 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05865 hypothetical protein; Provisional Back     alignment and domain information
>smart00859 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain Back     alignment and domain information
>PRK09135 pteridine reductase; Provisional Back     alignment and domain information
>PRK08263 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05875 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>PRK12744 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08277 D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>PRK08251 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02653 GDP-mannose 4,6-dehydratase Back     alignment and domain information
>PRK10084 dTDP-glucose 4,6 dehydratase; Provisional Back     alignment and domain information
>KOG1430 consensus C-3 sterol dehydrogenase/3-beta-hydroxysteroid dehydrogenase and related dehydrogenases [Lipid transport and metabolism; Amino acid transport and metabolism] Back     alignment and domain information
>PRK06924 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07985 oxidoreductase; Provisional Back     alignment and domain information
>PRK07097 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK06153 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Back     alignment and domain information
>PRK05599 hypothetical protein; Provisional Back     alignment and domain information
>PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07062 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06500 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd01491 Ube1_repeat1 Ubiquitin activating enzyme (E1), repeat 1 Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>PRK06057 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08664 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PRK06046 alanine dehydrogenase; Validated Back     alignment and domain information
>TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase Back     alignment and domain information
>PRK07576 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF04321 RmlD_sub_bind: RmlD substrate binding domain; InterPro: IPR005913 dTDP-4-dehydrorhamnose reductase (1 Back     alignment and domain information
>TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>TIGR01724 hmd_rel H2-forming N(5),N(10)-methenyltetrahydromethanopterin dehydrogenase-related protein Back     alignment and domain information
>PRK15059 tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>TIGR00465 ilvC ketol-acid reductoisomerase Back     alignment and domain information
>PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>PRK12935 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK06179 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG2423 Predicted ornithine cyclodeaminase, mu-crystallin homolog [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12743 oxidoreductase; Provisional Back     alignment and domain information
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK09134 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 Back     alignment and domain information
>PRK10217 dTDP-glucose 4,6-dehydratase; Provisional Back     alignment and domain information
>COG0289 DapB Dihydrodipicolinate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>PF00185 OTCace: Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain; InterPro: IPR006131 This family contains two related enzymes: Aspartate carbamoyltransferase (2 Back     alignment and domain information
>PRK14027 quinate/shikimate dehydrogenase; Provisional Back     alignment and domain information
>PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PRK06901 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>PRK12320 hypothetical protein; Provisional Back     alignment and domain information
>PRK06947 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>PRK08862 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02197 heptose_epim ADP-L-glycero-D-manno-heptose-6-epimerase Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>PRK06701 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG1091 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated Back     alignment and domain information
>PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK05872 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08818 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PF01408 GFO_IDH_MocA: Oxidoreductase family, NAD-binding Rossmann fold; InterPro: IPR000683 This group of enzymes utilise NADP or NAD, and is known as the GFO/IDH/MOCA family in UniProtKB/Swiss-Prot Back     alignment and domain information
>PRK08589 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06914 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12742 oxidoreductase; Provisional Back     alignment and domain information
>PRK00436 argC N-acetyl-gamma-glutamyl-phosphate reductase; Validated Back     alignment and domain information
>PF03949 Malic_M: Malic enzyme, NAD binding domain; InterPro: IPR012302 Malic enzymes (malate oxidoreductases) catalyse the oxidative decarboxylation of malate to form pyruvate [], a reaction important in a number of metabolic pathways - e Back     alignment and domain information
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>TIGR01296 asd_B aspartate-semialdehyde dehydrogenase (peptidoglycan organisms) Back     alignment and domain information
>PRK08936 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK08628 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>TIGR01746 Thioester-redct thioester reductase domain Back     alignment and domain information
>TIGR01179 galE UDP-glucose-4-epimerase Back     alignment and domain information
>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>PRK07060 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG0078 ArgF Ornithine carbamoyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12557 H(2)-dependent methylenetetrahydromethanopterin dehydrogenase-related protein; Provisional Back     alignment and domain information
>PRK08264 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK12749 quinate/shikimate dehydrogenase; Reviewed Back     alignment and domain information
>PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional Back     alignment and domain information
>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>PRK08278 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK11863 N-acetyl-gamma-glutamyl-phosphate reductase; Provisional Back     alignment and domain information
>PRK07775 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07574 formate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01692 HIBADH 3-hydroxyisobutyrate dehydrogenase Back     alignment and domain information
>COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK08605 D-lactate dehydrogenase; Validated Back     alignment and domain information
>PRK15116 sulfur acceptor protein CsdL; Provisional Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>TIGR01850 argC N-acetyl-gamma-glutamyl-phosphate reductase, common form Back     alignment and domain information
>PRK08226 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd00762 NAD_bind_malic_enz NAD(P) binding domain of malic enzyme Back     alignment and domain information
>PRK12938 acetyacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK05693 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01829 AcAcCoA_reduct acetoacetyl-CoA reductase Back     alignment and domain information
>PRK07831 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06114 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd00755 YgdL_like Family of activating enzymes (E1) of ubiquitin-like proteins related to the E Back     alignment and domain information
>PRK04207 glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK08269 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK05600 thiamine biosynthesis protein ThiF; Validated Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>PRK13303 L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>KOG1014 consensus 17 beta-hydroxysteroid dehydrogenase type 3, HSD17B3 [Lipid transport and metabolism] Back     alignment and domain information
>PRK13301 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK05854 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases Back     alignment and domain information
>PRK12367 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase Back     alignment and domain information
>PRK08223 hypothetical protein; Validated Back     alignment and domain information
>PLN02928 oxidoreductase family protein Back     alignment and domain information
>PLN03129 NADP-dependent malic enzyme; Provisional Back     alignment and domain information
>PRK12824 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK15438 erythronate-4-phosphate dehydrogenase PdxB; Provisional Back     alignment and domain information
>KOG1201 consensus Hydroxysteroid 17-beta dehydrogenase 11 [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR01289 LPOR light-dependent protochlorophyllide reductase Back     alignment and domain information
>PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK07856 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0002 ArgC Acetylglutamate semialdehyde dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK00257 erythronate-4-phosphate dehydrogenase; Validated Back     alignment and domain information
>COG3967 DltE Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>KOG2666 consensus UDP-glucose/GDP-mannose dehydrogenase [Carbohydrate transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PLN03139 formate dehydrogenase; Provisional Back     alignment and domain information
>cd01489 Uba2_SUMO Ubiquitin activating enzyme (E1) subunit UBA2 Back     alignment and domain information
>PRK07877 hypothetical protein; Provisional Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>TIGR01831 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductase, putative Back     alignment and domain information
>TIGR00978 asd_EA aspartate-semialdehyde dehydrogenase (non-peptidoglycan organisms) Back     alignment and domain information
>TIGR03693 ocin_ThiF_like putative thiazole-containing bacteriocin maturation protein Back     alignment and domain information
>PRK09310 aroDE bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase protein; Reviewed Back     alignment and domain information
>TIGR00670 asp_carb_tr aspartate carbamoyltransferase Back     alignment and domain information
>COG4007 Predicted dehydrogenase related to H2-forming N5,N10-methylenetetrahydromethanopterin dehydrogenase [General function prediction only] Back     alignment and domain information
>PRK09330 cell division protein FtsZ; Validated Back     alignment and domain information
>PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase Back     alignment and domain information
>PLN02996 fatty acyl-CoA reductase Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>PRK08177 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR00936 ahcY adenosylhomocysteinase Back     alignment and domain information
>PRK07578 short chain dehydrogenase; Provisional Back     alignment and domain information
>PTZ00317 NADP-dependent malic enzyme; Provisional Back     alignment and domain information
>PRK12550 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PLN02494 adenosylhomocysteinase Back     alignment and domain information
>PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated Back     alignment and domain information
>KOG1203 consensus Predicted dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG5322 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>cd01484 E1-2_like Ubiquitin activating enzyme (E1), repeat 2-like Back     alignment and domain information
>PRK07411 hypothetical protein; Validated Back     alignment and domain information
>PTZ00075 Adenosylhomocysteinase; Provisional Back     alignment and domain information
>PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR01830 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) reductase Back     alignment and domain information
>PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated Back     alignment and domain information
>PRK08303 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06841 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09730 putative NAD(P)-binding oxidoreductase; Provisional Back     alignment and domain information
>TIGR00036 dapB dihydrodipicolinate reductase Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>TIGR01851 argC_other N-acetyl-gamma-glutamyl-phosphate reductase, uncommon form Back     alignment and domain information
>PRK06523 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07889 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PLN02306 hydroxypyruvate reductase Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK13535 erythrose 4-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK07791 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd01488 Uba3_RUB Ubiquitin activating enzyme (E1) subunit UBA3 Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query439
1civ_A385 Chloroplast Nadp-Dependent Malate Dehydrogenase Fro 0.0
7mdh_A375 Structural Basis For Light Acitvation Of A Chloropl 0.0
1wze_A327 Structural Basis For Alteration Of Cofactor Specifi 4e-87
1iz9_A327 Crystal Structure Of Malate Dehydrogenase From Ther 3e-83
1bmd_A327 Determinants Of Protein Thermostability Observed In 4e-83
1bdm_A327 The Structure At 1.8 Angstroms Resolution Of A Sing 2e-82
1b8p_A329 Malate Dehydrogenase From Aquaspirillum Arcticum Le 2e-76
4mdh_A334 Refined Crystal Structure Of Cytoplasmic Malate Deh 5e-72
5mdh_A333 Crystal Structure Of Ternary Complex Of Porcine Cyt 5e-72
3d5t_A331 Crystal Structure Of Malate Dehydrogenase From Burk 1e-71
4h7p_A345 Crystal Structure Of A Putative Cytosolic Malate De 1e-66
3fi9_A343 Crystal Structure Of Malate Dehydrogenase From Porp 1e-15
1hyg_A313 Crystal Structure Of Mj0490 Gene Product, The Famil 3e-13
1a5z_A319 Lactate Dehydrogenase From Thermotoga Maritima (tml 1e-10
2hjr_A328 Crystal Structure Of Cryptosporidium Parvum Malate 2e-08
1gv0_A310 Structural Basis For Thermophilic Protein Stability 3e-08
2d4a_A308 Structure Of The Malate Dehydrogenase From Aeropyru 7e-08
3nep_X314 1.55a Resolution Structure Of Malate Dehydrogenase 1e-07
1guy_A309 Structural Basis For Thermophilic Protein Stability 1e-06
1uxh_A309 Large Improvement In The Thermal Stability Of A Tet 2e-06
1ur5_A309 Stabilization Of A Tetrameric Malate Dehydrogenase 2e-06
1uxi_A309 Large Improvement In The Thermal Stability Of A Tet 2e-06
1y6j_A318 L-Lactate Dehydrogenase From Clostridium Thermocell 2e-06
3gvh_A324 Crystal Structure Of LactateMALATE DEHYDROGENASE FR 2e-06
1gv1_A310 Structural Basis For Thermophilic Protein Stability 7e-06
1guz_A310 Structural Basis For Thermophilic Protein Stability 2e-05
3czm_A326 T. Gondii Bradyzoite-Specific Ldh (Ldh2) In Complex 2e-05
3p7m_A321 Structure Of Putative Lactate Dehydrogenase From Fr 2e-05
1sov_A328 Toxoplasma Gondii Bradyzoite-specific Ldh (ldh2) Ap 2e-05
4e0b_A313 2.17 Angstrom Resolution Crystal Structure Of Malat 7e-05
1pzg_A331 T.Gondii Ldh1 Complexed With Apad And Sulfate At 1. 1e-04
1pze_A331 T.gondii Ldh1 Apo Form Length = 331 2e-04
3om9_A329 T. Gondii Bradyzoite-Specific Ldh (Ldh1) In Complex 2e-04
3vku_A326 Penta Mutant Of Lactobacillus Casei Lactate Dehydro 4e-04
1i10_A331 Human Muscle L-Lactate Dehydrogenase M Chain, Terna 5e-04
4ajp_A337 Human Ldha In Complex With 2-((4-(4-((3-((2-Methyl- 5e-04
>pdb|1CIV|A Chain A, Chloroplast Nadp-Dependent Malate Dehydrogenase From Flaveria Bidentis Length = 385 Back     alignment and structure 
Iteration: 1

 Score =  689 bits (1779), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/388 (84%), Positives = 359/388 (92%), Gaps = 6/388 (1%)
Query: 52  SVNQVQAPVAVEQDDPKSKTNDCYGVFCLTYDLKAEEETKSWKKMVNIAVSGAAGMIANH 111
           S +Q+QAP+      P  +  +C+GVFCLTYDLKAEEETKSWKK++N+AVSGAAGMI+NH
Sbjct: 4   SSDQIQAPL------PAKQKPECFGVFCLTYDLKAEEETKSWKKIINVAVSGAAGMISNH 57
Query: 112 LLFKLAAGEVLGPDQPIALKLLGSERSLQALEGVAMELEDSLFPLLREVKIGINPYELFE 171
           LLFKLA+GEV GPDQPI+LKLLGSERS  ALEGVAMELEDSL+PLLR+V IGI+PYE+F+
Sbjct: 58  LLFKLASGEVFGPDQPISLKLLGSERSFAALEGVAMELEDSLYPLLRQVSIGIDPYEIFQ 117
Query: 172 DAEWALLIGAKPRGPGMERAGLLDINGQIFAEQGKALNAVASRNVKVIVVGNPCNTNALI 231
           DAEWALLIGAKPRGPGMERA LLDINGQIFAEQGKALNAVAS NVKV+VVGNPCNTNALI
Sbjct: 118 DAEWALLIGAKPRGPGMERADLLDINGQIFAEQGKALNAVASPNVKVMVVGNPCNTNALI 177
Query: 232 CLKNAPSIPAKNFHALTRLDENRAKCQLALKAGVFYDKVSNMTIWGNHSTTQVPDFLNAR 291
           CLKNAP+IP KNFHALTRLDENRAKCQLALKAGVFYDKVSN+TIWGNHSTTQVPDFLNA+
Sbjct: 178 CLKNAPNIPPKNFHALTRLDENRAKCQLALKAGVFYDKVSNVTIWGNHSTTQVPDFLNAK 237
Query: 292 INGLPVKEIIKDHKWLEEGFTETIQKRGGLLIKKWGRSSAASTAVSIVDAMKSLVTPTPE 351
           I+G+PV E+I+D KWLE+ FT  +Q RGG+LIKKWGRSSAASTAVSIVDA++SLVTPTPE
Sbjct: 238 IHGIPVTEVIRDRKWLEDEFTNMVQTRGGVLIKKWGRSSAASTAVSIVDAIRSLVTPTPE 297
Query: 352 GDWFSSGVYTNGNPYGIAEDIVFSMPCRSKGDGDYELVKDVIFDDYLRKRIAKTEQELLA 411
           GDWFS+GVYTNGNPYGIAEDIVFSMPCRSKGDGDYE VKDVIFDDYL K+I K+E ELLA
Sbjct: 298 GDWFSTGVYTNGNPYGIAEDIVFSMPCRSKGDGDYEFVKDVIFDDYLSKKIKKSEDELLA 357
Query: 412 EKKCVAHLTGEGIAFCDLPEDTMLPGEM 439
           EKKCVAHLTGEGIA CDLPEDTMLPGEM
Sbjct: 358 EKKCVAHLTGEGIAVCDLPEDTMLPGEM 385
>pdb|7MDH|A Chain A, Structural Basis For Light Acitvation Of A Chloroplast Enzyme. The Structure Of Sorghum Nadp-Malate Dehydrogenase In Its Oxidized Form Length = 375 Back     alignment and structure
>pdb|1WZE|A Chain A, Structural Basis For Alteration Of Cofactor Specificity Of Malate Dehydrogenase From Thermus Flavus Length = 327 Back     alignment and structure
>pdb|1IZ9|A Chain A, Crystal Structure Of Malate Dehydrogenase From Thermus Thermophilus Hb8 Length = 327 Back     alignment and structure
>pdb|1BMD|A Chain A, Determinants Of Protein Thermostability Observed In The 1.9 Angstroms Crystal Structure Of Malate Dehydrogenase From The Thermophilic Bacterium Thermus Flavus Length = 327 Back     alignment and structure
>pdb|1BDM|A Chain A, The Structure At 1.8 Angstroms Resolution Of A Single Site Mutant (T189i) Of Malate Dehydrogenase From Thermus Flavus With Increased Enzymatic Activity Length = 327 Back     alignment and structure
>pdb|1B8P|A Chain A, Malate Dehydrogenase From Aquaspirillum Arcticum Length = 329 Back     alignment and structure
>pdb|4MDH|A Chain A, Refined Crystal Structure Of Cytoplasmic Malate Dehydrogenase At 2.5-Angstroms Resolution Length = 334 Back     alignment and structure
>pdb|5MDH|A Chain A, Crystal Structure Of Ternary Complex Of Porcine Cytoplasmic Malate Dehydrogenase Alpha-Ketomalonate And Tnad At 2.4 Angstroms Resolution Length = 333 Back     alignment and structure
>pdb|3D5T|A Chain A, Crystal Structure Of Malate Dehydrogenase From Burkholderia Pseudomallei Length = 331 Back     alignment and structure
>pdb|4H7P|A Chain A, Crystal Structure Of A Putative Cytosolic Malate Dehydrogenase From Leishmania Major Friedlin Length = 345 Back     alignment and structure
>pdb|3FI9|A Chain A, Crystal Structure Of Malate Dehydrogenase From Porphyromonas Gingivalis Length = 343 Back     alignment and structure
>pdb|1HYG|A Chain A, Crystal Structure Of Mj0490 Gene Product, The Family Of LactateMALATE DEHYDROGENASE Length = 313 Back     alignment and structure
>pdb|1A5Z|A Chain A, Lactate Dehydrogenase From Thermotoga Maritima (tmldh) Length = 319 Back     alignment and structure
>pdb|2HJR|A Chain A, Crystal Structure Of Cryptosporidium Parvum Malate Dehydrogenase Length = 328 Back     alignment and structure
>pdb|1GV0|A Chain A, Structural Basis For Thermophilic Protein Stability: Structures Of Thermophilic And Mesophilic Malate Dehydrogenases Length = 310 Back     alignment and structure
>pdb|2D4A|A Chain A, Structure Of The Malate Dehydrogenase From Aeropyrum Pernix Length = 308 Back     alignment and structure
>pdb|3NEP|X Chain X, 1.55a Resolution Structure Of Malate Dehydrogenase From Salinibacter Ruber Length = 314 Back     alignment and structure
>pdb|1GUY|A Chain A, Structural Basis For Thermophilic Protein Stability: Structures Of Thermophilic And Mesophilic Malate Dehydrogenases Length = 309 Back     alignment and structure
>pdb|1UXH|A Chain A, Large Improvement In The Thermal Stability Of A Tetrameric Malate Dehydrogenase By Single Point Mutations At The Dimer-Dimer Interface Length = 309 Back     alignment and structure
>pdb|1UR5|A Chain A, Stabilization Of A Tetrameric Malate Dehydrogenase By Introduction Of A Disulfide Bridge At The DimerDIMER Interface Length = 309 Back     alignment and structure
>pdb|1UXI|A Chain A, Large Improvement In The Thermal Stability Of A Tetrameric Malate Dehydrogenase By Single Point Mutations At The Dimer-Dimer Interface Length = 309 Back     alignment and structure
>pdb|1Y6J|A Chain A, L-Lactate Dehydrogenase From Clostridium Thermocellum Cth-1135 Length = 318 Back     alignment and structure
>pdb|3GVH|A Chain A, Crystal Structure Of LactateMALATE DEHYDROGENASE FROM Brucella Melitensis Length = 324 Back     alignment and structure
>pdb|1GV1|A Chain A, Structural Basis For Thermophilic Protein Stability: Structures Of Thermophilic And Mesophilic Malate Dehydrogenases Length = 310 Back     alignment and structure
>pdb|1GUZ|A Chain A, Structural Basis For Thermophilic Protein Stability: Structures Of Thermophilic And Mesophilic Malate Dehydrogenases Length = 310 Back     alignment and structure
>pdb|3CZM|A Chain A, T. Gondii Bradyzoite-Specific Ldh (Ldh2) In Complex With Nad And Oxq Length = 326 Back     alignment and structure
>pdb|3P7M|A Chain A, Structure Of Putative Lactate Dehydrogenase From Francisella Tularensis Subsp. Tularensis Schu S4 Length = 321 Back     alignment and structure
>pdb|1SOV|A Chain A, Toxoplasma Gondii Bradyzoite-specific Ldh (ldh2) Apo Form Length = 328 Back     alignment and structure
>pdb|4E0B|A Chain A, 2.17 Angstrom Resolution Crystal Structure Of Malate Dehydrogenase From Vibrio Vulnificus Cmcp6 Length = 313 Back     alignment and structure
>pdb|1PZG|A Chain A, T.Gondii Ldh1 Complexed With Apad And Sulfate At 1.6 Angstroms Length = 331 Back     alignment and structure
>pdb|1PZE|A Chain A, T.gondii Ldh1 Apo Form Length = 331 Back     alignment and structure
>pdb|3OM9|A Chain A, T. Gondii Bradyzoite-Specific Ldh (Ldh1) In Complex With Nad And Oxq Length = 329 Back     alignment and structure
>pdb|3VKU|A Chain A, Penta Mutant Of Lactobacillus Casei Lactate Dehydrogenase Length = 326 Back     alignment and structure
>pdb|1I10|A Chain A, Human Muscle L-Lactate Dehydrogenase M Chain, Ternary Complex With Nadh And Oxamate Length = 331 Back     alignment and structure
>pdb|4AJP|A Chain A, Human Ldha In Complex With 2-((4-(4-((3-((2-Methyl-1,3- Benzothiazol-6yl)amino)-3-Oxo-Propyl)amino)-4-Oxo-Butyl) Phenyl)methyl)propanedioic Acid Length = 337 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query439
7mdh_A375 Protein (malate dehydrogenase); chloroplastic mala 0.0
1b8p_A329 Protein (malate dehydrogenase); oxidoreductase; 1. 1e-155
1y7t_A327 Malate dehydrogenase; NAD-dependent-MDH-NADPH comp 1e-154
5mdh_A333 Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH 1e-150
3fi9_A343 Malate dehydrogenase; structural genomics, oxidore 5e-95
3p7m_A321 Malate dehydrogenase; putative dehydrogenase, enzy 5e-14
1guz_A310 Malate dehydrogenase; oxidoreductase, tricarboxyli 4e-13
1ur5_A309 Malate dehydrogenase; oxidoreductase, tricarboxyli 4e-13
2hjr_A328 Malate dehydrogenase; malaria, structural genomics 4e-13
3tl2_A315 Malate dehydrogenase; center for structural genomi 5e-13
1hye_A313 L-lactate/malate dehydrogenase; nucleotide binding 5e-13
2d4a_B308 Malate dehydrogenase; archaea, hyperthermophIle, o 1e-12
3nep_X314 Malate dehydrogenase; halophIle, molecular adpatat 2e-12
3gvi_A324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 2e-12
1mld_A314 Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D 6e-12
2ewd_A317 Lactate dehydrogenase,; protein-substrate_cofactor 1e-11
2zqz_A326 L-LDH, L-lactate dehydrogenase; oxidoreductase, ro 2e-11
1a5z_A319 L-lactate dehydrogenase; oxidoreductase, glycolysi 3e-11
3ldh_A330 Lactate dehydrogenase; oxidoreductase, CHOH donor, 3e-11
4aj2_A331 L-lactate dehydrogenase A chain; oxidoreductase-in 3e-11
2v6b_A304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 5e-11
1smk_A326 Malate dehydrogenase, glyoxysomal; tricarboxylic c 7e-11
2xxj_A310 L-LDH, L-lactate dehydrogenase; oxidoreductase, hy 9e-11
3pqe_A326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 1e-10
3hhp_A312 Malate dehydrogenase; MDH, citric acid cycle, TCA 2e-10
1pzg_A331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 2e-10
1ldn_A316 L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA 3e-10
1t2d_A322 LDH-P, L-lactate dehydrogenase; ternary complex, o 4e-10
1o6z_A303 MDH, malate dehydrogenase; halophilic, ION-binding 5e-10
3d0o_A317 L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly 5e-10
1ez4_A318 Lactate dehydrogenase; rossmann fold, oxidoreducta 1e-09
1y6j_A318 L-lactate dehydrogenase; southeast collaboratory f 1e-09
2i6t_A303 Ubiquitin-conjugating enzyme E2-like isoform A; L- 1e-09
1lld_A319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 5e-09
1hyh_A309 L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 2e-07
1oju_A294 MDH, malate dehydrogenase; hyperthermophilic, oxid 5e-07
>7mdh_A Protein (malate dehydrogenase); chloroplastic malate dehydrogenase (NADP+), activated by LIG chloroplastic malate dehydrogenase; 2.40A {Sorghum bicolor} SCOP: c.2.1.5 d.162.1.1 PDB: 1civ_A* Length = 375 Back     alignment and structure
 Score =  525 bits (1353), Expect = 0.0
 Identities = 316/374 (84%), Positives = 345/374 (92%)

Query: 66  DPKSKTNDCYGVFCLTYDLKAEEETKSWKKMVNIAVSGAAGMIANHLLFKLAAGEVLGPD 125
           +  +   DC+GVFC TYDLKAE++TKSWKK+VNIAVSGAAGMI+NHLLFKLA+GEV G D
Sbjct: 2   EAPATRKDCFGVFCTTYDLKAEDKTKSWKKLVNIAVSGAAGMISNHLLFKLASGEVFGQD 61

Query: 126 QPIALKLLGSERSLQALEGVAMELEDSLFPLLREVKIGINPYELFEDAEWALLIGAKPRG 185
           QPIALKLLGSERS QALEGVAMELEDSL+PLLREV IGI+PYE+FED +WALLIGAKPRG
Sbjct: 62  QPIALKLLGSERSFQALEGVAMELEDSLYPLLREVSIGIDPYEVFEDVDWALLIGAKPRG 121

Query: 186 PGMERAGLLDINGQIFAEQGKALNAVASRNVKVIVVGNPCNTNALICLKNAPSIPAKNFH 245
           PGMERA LLDINGQIFA+QGKALNAVAS+NVKV+VVGNPCNTNALICLKNAP IPAKNFH
Sbjct: 122 PGMERAALLDINGQIFADQGKALNAVASKNVKVLVVGNPCNTNALICLKNAPDIPAKNFH 181

Query: 246 ALTRLDENRAKCQLALKAGVFYDKVSNMTIWGNHSTTQVPDFLNARINGLPVKEIIKDHK 305
           ALTRLDENRAKCQLALKAGVFYDKVSN+TIWGNHSTTQVPDFLNA+I+G PVKE+IK  K
Sbjct: 182 ALTRLDENRAKCQLALKAGVFYDKVSNVTIWGNHSTTQVPDFLNAKIDGRPVKEVIKRTK 241

Query: 306 WLEEGFTETIQKRGGLLIKKWGRSSAASTAVSIVDAMKSLVTPTPEGDWFSSGVYTNGNP 365
           WLEE FT T+QKRGG LI+KWGRSSAASTAVSI DA+KSLVTPTPEGDWFS+GVYT GNP
Sbjct: 242 WLEEEFTITVQKRGGALIQKWGRSSAASTAVSIADAIKSLVTPTPEGDWFSTGVYTTGNP 301

Query: 366 YGIAEDIVFSMPCRSKGDGDYELVKDVIFDDYLRKRIAKTEQELLAEKKCVAHLTGEGIA 425
           YGIAEDIVFSMPCRSKGDGDYEL  DV  DD+L +RI K+E ELLAEKKCVAHLTGEG A
Sbjct: 302 YGIAEDIVFSMPCRSKGDGDYELATDVSNDDFLWERIKKSEAELLAEKKCVAHLTGEGNA 361

Query: 426 FCDLPEDTMLPGEM 439
           +CD+PEDTMLPGE+
Sbjct: 362 YCDVPEDTMLPGEV 375
>1b8p_A Protein (malate dehydrogenase); oxidoreductase; 1.90A {Aquaspirillum arcticum} SCOP: c.2.1.5 d.162.1.1 PDB: 1b8u_A* 1b8v_A* 3d5t_A Length = 329 Back     alignment and structure
>1y7t_A Malate dehydrogenase; NAD-dependent-MDH-NADPH complex, oxidoreductase; HET: NDP; 1.65A {Thermus thermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1iz9_A* 2cvq_A* 1bmd_A* 1bdm_A* 1wze_A* 1wzi_A* Length = 327 Back     alignment and structure
>5mdh_A Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH(D)); HET: NAD; 2.40A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 4mdh_A* Length = 333 Back     alignment and structure
>3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} Length = 343 Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Length = 321 Back     alignment and structure
>1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* Length = 310 Back     alignment and structure
>1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* Length = 309 Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Length = 328 Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Length = 315 Back     alignment and structure
>1hye_A L-lactate/malate dehydrogenase; nucleotide binding domain, oxidoreductase; HET: NAP; 1.90A {Methanocaldococcus jannaschii} SCOP: c.2.1.5 d.162.1.1 PDB: 1hyg_A* Length = 313 Back     alignment and structure
>2d4a_B Malate dehydrogenase; archaea, hyperthermophIle, oxidoreductase; 2.87A {Aeropyrum pernix} Length = 308 Back     alignment and structure
>3nep_X Malate dehydrogenase; halophIle, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle; 1.55A {Salinibacter ruber} Length = 314 Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Length = 324 Back     alignment and structure
>1mld_A Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D)); HET: CIT; 1.83A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 2dfd_A* Length = 314 Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Length = 317 Back     alignment and structure
>2zqz_A L-LDH, L-lactate dehydrogenase; oxidoreductase, rossmann fold, cytoplasm, glycolysis, NAD, phosphoprotein; 2.50A {Lactobacillus casei} PDB: 2zqy_A 3vkv_A* 1llc_A* Length = 326 Back     alignment and structure
>1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 Length = 319 Back     alignment and structure
>3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 Length = 330 Back     alignment and structure
>4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... Length = 331 Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Length = 304 Back     alignment and structure
>1smk_A Malate dehydrogenase, glyoxysomal; tricarboxylic cycle, glyoxysome, NAD, glyoxylate bypass, oxidoreductase; HET: CIT; 2.50A {Citrullus lanatus} PDB: 1sev_A Length = 326 Back     alignment and structure
>2xxj_A L-LDH, L-lactate dehydrogenase; oxidoreductase, hyperthermophIle; HET: NAD; 1.964A {Thermus thermophilus} PDB: 2xxb_A* 3zzn_A* 2v7p_A* 2e37_A* 2v6m_A* 2xxe_A 4a73_A Length = 310 Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Length = 326 Back     alignment and structure
>3hhp_A Malate dehydrogenase; MDH, citric acid cycle, TCA cycle, NAD, oxidoreductase, tricarboxylic acid cycle; 1.45A {Escherichia coli k-12} PDB: 2pwz_A 2cmd_A* 1emd_A* 1ib6_A* 1ie3_A* 4e0b_A* Length = 312 Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Length = 331 Back     alignment and structure
>1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* Length = 316 Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Length = 322 Back     alignment and structure
>1o6z_A MDH, malate dehydrogenase; halophilic, ION-binding, protein-solvent interaction, oxidoreductase; HET: NAD; 1.95A {Haloarcula marismortui} SCOP: c.2.1.5 d.162.1.1 PDB: 1gt2_A* 2x0r_A* 2j5k_A 2j5q_A 2j5r_A 1d3a_A 1hlp_A* 2hlp_A Length = 303 Back     alignment and structure
>3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* Length = 317 Back     alignment and structure
>1ez4_A Lactate dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.30A {Lactobacillus pentosus} SCOP: c.2.1.5 d.162.1.1 Length = 318 Back     alignment and structure
>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Length = 318 Back     alignment and structure
>2i6t_A Ubiquitin-conjugating enzyme E2-like isoform A; L-lactate dehydrogenase, oxidoreductase, ubiquitin-protein L unknown function; 2.10A {Homo sapiens} PDB: 3dl2_A Length = 303 Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Length = 319 Back     alignment and structure
>1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 Length = 309 Back     alignment and structure
>1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ojs_A* 2x0i_A* 2x0j_A* Length = 294 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query439
7mdh_A375 Protein (malate dehydrogenase); chloroplastic mala 100.0
5mdh_A333 Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH 100.0
4h7p_A345 Malate dehydrogenase; ssgcid, structural G seattle 100.0
3vku_A326 L-LDH, L-lactate dehydrogenase; rossmann fold, NAD 100.0
3pqe_A326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 100.0
4aj2_A331 L-lactate dehydrogenase A chain; oxidoreductase-in 100.0
3nep_X314 Malate dehydrogenase; halophIle, molecular adpatat 100.0
2x0j_A294 Malate dehydrogenase; oxidoreductase, hyperthermop 100.0
1ez4_A318 Lactate dehydrogenase; rossmann fold, oxidoreducta 100.0
3p7m_A321 Malate dehydrogenase; putative dehydrogenase, enzy 100.0
1oju_A294 MDH, malate dehydrogenase; hyperthermophilic, oxid 100.0
2zqz_A326 L-LDH, L-lactate dehydrogenase; oxidoreductase, ro 100.0
3tl2_A315 Malate dehydrogenase; center for structural genomi 100.0
3fi9_A343 Malate dehydrogenase; structural genomics, oxidore 100.0
3gvi_A324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 100.0
2xxj_A310 L-LDH, L-lactate dehydrogenase; oxidoreductase, hy 100.0
1b8p_A329 Protein (malate dehydrogenase); oxidoreductase; 1. 100.0
3d0o_A317 L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly 100.0
1y6j_A318 L-lactate dehydrogenase; southeast collaboratory f 100.0
2d4a_B308 Malate dehydrogenase; archaea, hyperthermophIle, o 100.0
1ldn_A316 L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA 100.0
1o6z_A303 MDH, malate dehydrogenase; halophilic, ION-binding 100.0
3ldh_A330 Lactate dehydrogenase; oxidoreductase, CHOH donor, 100.0
3hhp_A312 Malate dehydrogenase; MDH, citric acid cycle, TCA 100.0
1ur5_A309 Malate dehydrogenase; oxidoreductase, tricarboxyli 100.0
1t2d_A322 LDH-P, L-lactate dehydrogenase; ternary complex, o 100.0
1hye_A313 L-lactate/malate dehydrogenase; nucleotide binding 100.0
1pzg_A331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 100.0
2hjr_A328 Malate dehydrogenase; malaria, structural genomics 100.0
2v6b_A304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 100.0
1guz_A310 Malate dehydrogenase; oxidoreductase, tricarboxyli 100.0
2i6t_A303 Ubiquitin-conjugating enzyme E2-like isoform A; L- 100.0
1a5z_A319 L-lactate dehydrogenase; oxidoreductase, glycolysi 100.0
1mld_A314 Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D 100.0
1y7t_A327 Malate dehydrogenase; NAD-dependent-MDH-NADPH comp 100.0
1smk_A326 Malate dehydrogenase, glyoxysomal; tricarboxylic c 100.0
2ewd_A317 Lactate dehydrogenase,; protein-substrate_cofactor 100.0
1hyh_A309 L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 100.0
1lld_A319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 100.0
1up7_A417 6-phospho-beta-glucosidase; hydrolase, family4 hyd 100.0
1s6y_A450 6-phospho-beta-glucosidase; hydrolase, structural 100.0
1u8x_X472 Maltose-6'-phosphate glucosidase; structural genom 100.0
3fef_A450 Putative glucosidase LPLD; gulosidase, structural 100.0
1obb_A480 Maltase, alpha-glucosidase; glycosidase, sulfinic 100.0
3u95_A477 Glycoside hydrolase, family 4; hydrolysis, cytosol 99.98
3g79_A 478 NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; 98.1
3k96_A356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 97.98
1f0y_A302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 97.9
3gg2_A 450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 97.85
3pid_A432 UDP-glucose 6-dehydrogenase; rossmann fold, oxidor 97.83
3tri_A280 Pyrroline-5-carboxylate reductase; amino acid bios 97.83
2o3j_A 481 UDP-glucose 6-dehydrogenase; structural genomics, 97.82
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 97.79
1mv8_A436 GMD, GDP-mannose 6-dehydrogenase; rossman fold, do 97.77
1dlj_A402 UDP-glucose dehydrogenase; rossmann fold, ternary 97.76
3gt0_A247 Pyrroline-5-carboxylate reductase; structural geno 97.71
3ado_A319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 97.66
2q3e_A 467 UDP-glucose 6-dehydrogenase; hexamer, structural g 97.66
4huj_A220 Uncharacterized protein; PSI-biology, nysgrc, stru 97.64
1zcj_A463 Peroxisomal bifunctional enzyme; peroxisomal multi 97.61
2dpo_A319 L-gulonate 3-dehydrogenase; structural genomics, N 97.61
2izz_A322 Pyrroline-5-carboxylate reductase 1; amino-acid bi 97.58
2y0c_A 478 BCEC, UDP-glucose dehydrogenase; oxidoreductase, c 97.57
3k6j_A460 Protein F01G10.3, confirmed by transcript evidenc; 97.56
3d1l_A266 Putative NADP oxidoreductase BF3122; structural ge 97.55
2h78_A302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 97.53
1yj8_A375 Glycerol-3-phosphate dehydrogenase; SGPP, structur 97.51
2wtb_A725 MFP2, fatty acid multifunctional protein (ATMFP2); 97.5
3mog_A 483 Probable 3-hydroxybutyryl-COA dehydrogenase; struc 97.49
4dll_A320 2-hydroxy-3-oxopropionate reductase; structural ge 97.48
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 97.45
2g5c_A281 Prephenate dehydrogenase; TYRA, oxidoreductase; HE 97.39
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 97.39
3ggo_A314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 97.36
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 97.36
2ew2_A316 2-dehydropantoate 2-reductase, putative; alpha-str 97.36
3b1f_A290 Putative prephenate dehydrogenase; enzyme, 4-hydro 97.35
3doj_A310 AT3G25530, dehydrogenase-like protein; gamma-hydro 97.35
3dtt_A245 NADP oxidoreductase; structural genomics, joint ce 97.35
1x0v_A354 GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase 97.34
4fgw_A391 Glycerol-3-phosphate dehydrogenase [NAD(+)] 1; oxi 97.33
2cvz_A289 Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; 97.32
3qsg_A312 NAD-binding phosphogluconate dehydrogenase-like P; 97.32
3ruf_A351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 97.32
3cky_A301 2-hydroxymethyl glutarate dehydrogenase; rossmann 97.3
4a7p_A446 UDP-glucose dehydrogenase; oxidoreductase, carbohy 97.3
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 97.29
3pef_A287 6-phosphogluconate dehydrogenase, NAD-binding; gam 97.28
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 97.27
1evy_A366 Glycerol-3-phosphate dehydrogenase; rossmann fold, 97.26
3pdu_A287 3-hydroxyisobutyrate dehydrogenase family protein; 97.25
3hwr_A318 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A 97.24
3g0o_A303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 97.23
4id9_A347 Short-chain dehydrogenase/reductase; putative dehy 97.22
3qha_A296 Putative oxidoreductase; seattle structural genomi 97.2
3vtf_A444 UDP-glucose 6-dehydrogenase; two discrete alpha/be 97.19
2f1k_A279 Prephenate dehydrogenase; tyrosine synthesis, X-RA 97.14
2rcy_A262 Pyrroline carboxylate reductase; malaria, structur 97.13
3m2p_A311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 97.12
1txg_A335 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid 97.1
3oh8_A516 Nucleoside-diphosphate sugar epimerase (SULA FAMI; 97.07
1vpd_A299 Tartronate semialdehyde reductase; structural geno 97.07
1y1p_A342 ARII, aldehyde reductase II; rossmann fold, short 97.07
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 97.07
3c24_A286 Putative oxidoreductase; YP_511008.1, structural g 97.06
1bg6_A359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 97.06
1z82_A335 Glycerol-3-phosphate dehydrogenase; TM0378, struct 97.05
2qyt_A317 2-dehydropantoate 2-reductase; APC81190, porphyrom 97.04
1wdk_A715 Fatty oxidation complex alpha subunit; alpha2BETA2 97.04
1ks9_A291 KPA reductase;, 2-dehydropantoate 2-reductase; PAN 97.03
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 97.01
4ezb_A317 Uncharacterized conserved protein; structural geno 97.0
2uyy_A316 N-PAC protein; long-chain dehydrogenase, cytokine; 96.99
3zwc_A742 Peroxisomal bifunctional enzyme; beta oxidation pa 96.99
2zyd_A 480 6-phosphogluconate dehydrogenase, decarboxylating; 96.95
1pgj_A 478 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; o 96.93
1yb4_A295 Tartronic semialdehyde reductase; structural genom 96.92
2x4g_A342 Nucleoside-diphosphate-sugar epimerase; isomerase; 96.91
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 96.9
3ghy_A335 Ketopantoate reductase protein; oxidoreductase, NA 96.87
3l6d_A306 Putative oxidoreductase; structural genomics, prot 96.86
4e21_A358 6-phosphogluconate dehydrogenase (decarboxylating; 96.81
3ehe_A313 UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, 96.81
1zej_A293 HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural 96.8
2c29_D337 Dihydroflavonol 4-reductase; flavonoids, short deh 96.8
3enk_A341 UDP-glucose 4-epimerase; seattle structural genomi 96.79
4b4o_A298 Epimerase family protein SDR39U1; isomerase; HET: 96.77
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 96.72
2iz1_A 474 6-phosphogluconate dehydrogenase, decarboxylating; 96.7
2gn4_A344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 96.64
1yqg_A263 Pyrroline-5-carboxylate reductase; structural geno 96.63
3ego_A307 Probable 2-dehydropantoate 2-reductase; structural 96.62
4gwg_A 484 6-phosphogluconate dehydrogenase, decarboxylating; 96.62
3rft_A267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 96.6
1wma_A276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 96.56
3nzo_A399 UDP-N-acetylglucosamine 4,6-dehydratase; structura 96.55
3c7a_A404 Octopine dehydrogenase; L) stereospecific opine de 96.54
3i83_A320 2-dehydropantoate 2-reductase; structural genomics 96.52
2ahr_A259 Putative pyrroline carboxylate reductase; pyrrolin 96.51
2a35_A215 Hypothetical protein PA4017; alpha-beta-alpha sand 96.51
2pgd_A 482 6-phosphogluconate dehydrogenase; oxidoreductase ( 96.49
1orr_A347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 96.48
3g17_A294 Similar to 2-dehydropantoate 2-reductase; structur 96.45
3hn2_A312 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str 96.42
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 96.42
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 96.42
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 96.4
1xq6_A253 Unknown protein; structural genomics, protein stru 96.37
3sxp_A362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 96.36
1xg5_A279 ARPG836; short chain dehydrogenase, human, SGC, st 96.36
2pzm_A330 Putative nucleotide sugar epimerase/ dehydratase; 96.34
3ko8_A312 NAD-dependent epimerase/dehydratase; isomerase, UD 96.34
1np3_A338 Ketol-acid reductoisomerase; A DEEP figure-OF-eigh 96.31
3f9i_A249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 96.3
3m1a_A281 Putative dehydrogenase; short, PSI, MCSG, structur 96.29
2b69_A343 UDP-glucuronate decarboxylase 1; UDP-glucoronic ac 96.26
2p4q_A 497 6-phosphogluconate dehydrogenase, decarboxylating; 96.26
1fmc_A255 7 alpha-hydroxysteroid dehydrogenase; short-chain 96.26
4e6p_A259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 96.25
3i1j_A247 Oxidoreductase, short chain dehydrogenase/reducta; 96.25
1lss_A140 TRK system potassium uptake protein TRKA homolog; 96.21
2pv7_A298 T-protein [includes: chorismate mutase (EC 5.4.99 96.2
2x6t_A357 ADP-L-glycero-D-manno-heptose-6-epimerase; isomera 96.19
3slg_A372 PBGP3 protein; structural genomics, seattle struct 96.18
1eq2_A310 ADP-L-glycero-D-mannoheptose 6-epimerase; N-termin 96.09
3awd_A260 GOX2181, putative polyol dehydrogenase; oxidoreduc 96.09
2ph3_A245 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 96.08
1yb1_A272 17-beta-hydroxysteroid dehydrogenase type XI; shor 96.06
2rh8_A338 Anthocyanidin reductase; flavonoids, rossmann fold 96.06
3tjr_A301 Short chain dehydrogenase; structural genomics, se 96.05
2hun_A336 336AA long hypothetical DTDP-glucose 4,6-dehydrat; 96.05
2cfc_A250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 96.04
1iy8_A267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 96.04
1sb8_A352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 96.02
4egf_A266 L-xylulose reductase; structural genomics, ssgcid, 95.99
2c5a_A379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 95.99
3ojo_A431 CAP5O; rossmann fold, complex with cofactor NAD an 95.98
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 95.98
2yut_A207 Putative short-chain oxidoreductase; alpha and bet 95.97
2gf2_A296 Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct 95.96
2hq1_A247 Glucose/ribitol dehydrogenase; CTH-1438, structura 95.95
3svt_A281 Short-chain type dehydrogenase/reductase; ssgcid, 95.93
1e6u_A321 GDP-fucose synthetase; epimerase/reductase, SDR, R 95.92
4f6c_A427 AUSA reductase domain protein; thioester reductase 95.92
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 95.92
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 95.91
4dqv_A478 Probable peptide synthetase NRP (peptide synthase; 95.9
1oc2_A348 DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos 95.9
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 95.9
3pk0_A262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 95.89
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 95.88
3l77_A235 Short-chain alcohol dehydrogenase; oxidoreductase; 95.88
1nff_A260 Putative oxidoreductase RV2002; directed evolution 95.87
3f1l_A252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 95.87
2c07_A285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 95.86
2i99_A312 MU-crystallin homolog; thyroid hormine binding pro 95.86
1zk4_A251 R-specific alcohol dehydrogenase; short chain redu 95.86
2pk3_A321 GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor 95.85
2bd0_A244 Sepiapterin reductase; oxidoreductase; HET: NAP BI 95.85
2pnf_A248 3-oxoacyl-[acyl-carrier-protein] reductase; short 95.85
3obb_A300 Probable 3-hydroxyisobutyrate dehydrogenase; struc 95.84
3v8b_A283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 95.83
3ktd_A341 Prephenate dehydrogenase; structural genomics, joi 95.82
3tfo_A264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 95.8
1xq1_A266 Putative tropinone reducatse; structural genomics, 95.79
4dqx_A277 Probable oxidoreductase protein; structural genomi 95.79
2ehd_A234 Oxidoreductase, oxidoreductase, short-chain dehydr 95.78
2uvd_A246 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k 95.76
1i24_A404 Sulfolipid biosynthesis protein SQD1; SDR, short-c 95.74
2z1m_A345 GDP-D-mannose dehydratase; short-chain dehydrogena 95.74
2wm3_A299 NMRA-like family domain containing protein 1; unkn 95.74
1geg_A256 Acetoin reductase; SDR family, oxidoreductase; HET 95.73
4egb_A346 DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce 95.73
3imf_A257 Short chain dehydrogenase; structural genomics, in 95.73
2jah_A247 Clavulanic acid dehydrogenase; short-chain dehydro 95.71
2ydy_A315 Methionine adenosyltransferase 2 subunit beta; oxi 95.71
2ae2_A260 Protein (tropinone reductase-II); oxidoreductase, 95.7
3cxt_A291 Dehydrogenase with different specificities; rossma 95.68
3st7_A369 Capsular polysaccharide synthesis enzyme CAP5F; ro 95.68
1zem_A262 Xylitol dehydrogenase; rossmann fold, dinucleotide 95.67
3gaf_A256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 95.66
1hdc_A254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 95.64
2wsb_A254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 95.64
3rwb_A247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 95.64
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 95.61
1gee_A261 Glucose 1-dehydrogenase; short-chain dehydrogenase 95.61
3vps_A321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 95.6
2gdz_A267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 95.59
3ay3_A267 NAD-dependent epimerase/dehydratase; glucuronic ac 95.59
3ak4_A263 NADH-dependent quinuclidinone reductase; SDR, (R)- 95.58
1w6u_A302 2,4-dienoyl-COA reductase, mitochondrial precursor 95.57
4b8w_A319 GDP-L-fucose synthase; oxidoreductase; HET: NAP GD 95.57
3ai3_A263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 95.56
3ftp_A270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 95.55
3ius_A286 Uncharacterized conserved protein; APC63810, silic 95.55
3c85_A183 Putative glutathione-regulated potassium-efflux S 95.55
1ae1_A273 Tropinone reductase-I; oxidoreductase, tropane alk 95.55
2o23_A265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 95.54
3guy_A230 Short-chain dehydrogenase/reductase SDR; structura 95.54
2zat_A260 Dehydrogenase/reductase SDR family member 4; alpha 95.53
3n74_A261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 95.52
3oid_A258 Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa 95.52
1x7d_A350 Ornithine cyclodeaminase; binds NAD+, binds L-orni 95.52
3t4x_A267 Oxidoreductase, short chain dehydrogenase/reducta; 95.5
1rkx_A357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 95.5
4gbj_A297 6-phosphogluconate dehydrogenase NAD-binding; stru 95.49
3sju_A279 Keto reductase; short-chain dehydrogenase, oxidore 95.49
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 95.49
3rih_A293 Short chain dehydrogenase or reductase; structural 95.47
4dpl_A359 Malonyl-COA/succinyl-COA reductase; dinucleotide b 95.46
4dpk_A359 Malonyl-COA/succinyl-COA reductase; dinucleotide b 95.46
1x1t_A260 D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S 95.46
2q1w_A333 Putative nucleotide sugar epimerase/ dehydratase; 95.45
1hxh_A253 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b 95.45
3sx2_A278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 95.44
2z1n_A260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 95.44
3a28_C258 L-2.3-butanediol dehydrogenase; chiral substrate r 95.43
3grp_A266 3-oxoacyl-(acyl carrierprotein) reductase; structu 95.43
2hk9_A275 Shikimate dehydrogenase; shikimate pathway, drug d 95.43
3uve_A286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 95.43
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 95.41
3pgx_A280 Carveol dehydrogenase; structural genomics, seattl 95.41
1vl8_A267 Gluconate 5-dehydrogenase; TM0441, structural geno 95.4
1rpn_A335 GDP-mannose 4,6-dehydratase; short-chain dehydroge 95.4
3v2h_A281 D-beta-hydroxybutyrate dehydrogenase; structural g 95.39
2c20_A330 UDP-glucose 4-epimerase; carbohydrate metabolism, 95.38
4dry_A281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 95.37
3pwk_A366 Aspartate-semialdehyde dehydrogenase; NADP binding 95.36
2bll_A345 Protein YFBG; decarboxylase, short chain dehydroge 95.35
4imr_A275 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor 95.33
2q2v_A255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 95.33
3e48_A289 Putative nucleoside-diphosphate-sugar epimerase; a 95.33
3o26_A311 Salutaridine reductase; short chain dehydrogenase/ 95.31
3nyw_A250 Putative oxidoreductase; fatty acid synthesis,3-ox 95.31
3tzq_B271 Short-chain type dehydrogenase/reductase; ssgcid, 95.31
3tox_A280 Short chain dehydrogenase; structural genomics, PS 95.31
3op4_A248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 95.31
3pxx_A287 Carveol dehydrogenase; structural genomics, seattl 95.3
1ek6_A348 UDP-galactose 4-epimerase; short-chain dehydrogena 95.3
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 95.3
1cyd_A244 Carbonyl reductase; short-chain dehydrogenase, oxi 95.28
1ja9_A274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 95.28
3abi_A365 Putative uncharacterized protein PH1688; L-lysine 95.28
4dyv_A272 Short-chain dehydrogenase/reductase SDR; structura 95.28
1i36_A264 Conserved hypothetical protein MTH1747; NADP bindi 95.27
3asu_A248 Short-chain dehydrogenase/reductase SDR; SDR famil 95.26
2pd6_A264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 95.23
2i76_A276 Hypothetical protein; NADP, dehydrogenase, TM1727, 95.23
4fc7_A277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 95.22
4ibo_A271 Gluconate dehydrogenase; enzyme function initiativ 95.21
1qyd_A313 Pinoresinol-lariciresinol reductase; NADPH-depende 95.2
1r6d_A337 TDP-glucose-4,6-dehydratase; rossmann fold, short- 95.2
1e7w_A291 Pteridine reductase; dihydrofolate reductase, shor 95.19
3euw_A344 MYO-inositol dehydrogenase; protein structure init 95.16
4f6l_B508 AUSA reductase domain protein; thioester reductase 95.15
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 95.15
2bgk_A278 Rhizome secoisolariciresinol dehydrogenase; oxidor 95.11
1spx_A278 Short-chain reductase family member (5L265); paral 95.1
2q1s_A377 Putative nucleotide sugar epimerase/ dehydratase; 95.1
4eso_A255 Putative oxidoreductase; NADP, structural genomics 95.09
1vl0_A292 DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s 95.08
3ezl_A256 Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA 95.06
1h5q_A265 NADP-dependent mannitol dehydrogenase; oxidoreduct 95.04
2rhc_B277 Actinorhodin polyketide ketoreductase; oxidoreduct 95.03
1edo_A244 Beta-keto acyl carrier protein reductase; nucleoti 95.03
3gvc_A277 Oxidoreductase, probable short-chain type dehydrog 95.03
3l6e_A235 Oxidoreductase, short-chain dehydrogenase/reducta; 95.0
3tsc_A277 Putative oxidoreductase; structural genomics, seat 94.99
1db3_A372 GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lya 94.98
3osu_A246 3-oxoacyl-[acyl-carrier-protein] reductase; struct 94.97
2jl1_A287 Triphenylmethane reductase; oxidoreductase, biorem 94.95
4e3z_A272 Putative oxidoreductase protein; PSI-biology, stru 94.95
2dkn_A255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 94.94
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 94.94
4ina_A405 Saccharopine dehydrogenase; structural genomics, P 94.93
2b4q_A276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 94.91
3dr3_A337 N-acetyl-gamma-glutamyl-phosphate reductase; csgid 94.9
3rku_A287 Oxidoreductase YMR226C; substrate fingerprint, sho 94.89
3d3w_A244 L-xylulose reductase; uronate cycle, short-chain d 94.86
3s55_A281 Putative short-chain dehydrogenase/reductase; stru 94.86
3ucx_A264 Short chain dehydrogenase; ssgcid, seattle structu 94.86
2gas_A307 Isoflavone reductase; NADPH-dependent reductase, o 94.84
3tz6_A344 Aspartate-semialdehyde dehydrogenase; asadh, ASD, 94.84
2a4k_A263 3-oxoacyl-[acyl carrier protein] reductase; reduct 94.84
1zmo_A244 Halohydrin dehalogenase; haloalcohol dehalogenase, 94.83
1gy8_A397 UDP-galactose 4-epimerase; oxidoreductase; HET: NA 94.83
3sc6_A287 DTDP-4-dehydrorhamnose reductase; RFBD, structural 94.83
3ctm_A279 Carbonyl reductase; alcohol dehydrogenase, short-c 94.83
1zmt_A254 Haloalcohol dehalogenase HHEC; halohydrin dehaloge 94.83
1omo_A322 Alanine dehydrogenase; two-domain, beta-sandwich-d 94.82
3t7c_A299 Carveol dehydrogenase; structural genomics, seattl 94.81
1qyc_A308 Phenylcoumaran benzylic ether reductase PT1; NADPH 94.78
4iiu_A267 3-oxoacyl-[acyl-carrier protein] reductase; struct 94.77
2nm0_A253 Probable 3-oxacyl-(acyl-carrier-protein) reductas; 94.75
2p4h_X322 Vestitone reductase; NADPH-dependent reductase, is 94.75
1n2s_A299 DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold 94.74
1id1_A153 Putative potassium channel protein; RCK domain, E. 94.73
2qhx_A328 Pteridine reductase 1; oxidoreductase, short-chain 94.73
3gk3_A269 Acetoacetyl-COA reductase; acetoacetyl-CO reductas 94.71
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 94.7
1xhl_A297 Short-chain dehydrogenase/reductase family member 94.69
2nwq_A272 Probable short-chain dehydrogenase; oxidoreductase 94.67
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 94.64
3u9l_A324 3-oxoacyl-[acyl-carrier-protein] reductase; struct 94.63
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 94.62
3i6i_A346 Putative leucoanthocyanidin reductase 1; rossmann 94.62
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 94.62
4iin_A271 3-ketoacyl-acyl carrier protein reductase (FABG); 94.59
3r3s_A294 Oxidoreductase; structural genomics, csgid, center 94.57
3u5t_A267 3-oxoacyl-[acyl-carrier-protein] reductase; struct 94.57
2ep5_A350 350AA long hypothetical aspartate-semialdehyde deh 94.57
3lf2_A265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 94.56
1mxh_A276 Pteridine reductase 2; SDR topology, protein-subst 94.56
3uf0_A273 Short-chain dehydrogenase/reductase SDR; gluconate 94.55
3ijr_A291 Oxidoreductase, short chain dehydrogenase/reducta; 94.55
3v2g_A271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 94.54
3l9w_A413 Glutathione-regulated potassium-efflux system Pro 94.51
1xkq_A280 Short-chain reductase family member (5D234); parra 94.51
2ew8_A249 (S)-1-phenylethanol dehydrogenase; transferase; 2. 94.5
3c1o_A321 Eugenol synthase; phenylpropene, PIP reductase, sh 94.48
1udb_A338 Epimerase, UDP-galactose-4-epimerase; isomerase; H 94.48
3hsk_A381 Aspartate-semialdehyde dehydrogenase; candida albi 94.47
3q2i_A354 Dehydrogenase; rossmann fold, UDP-sugar binding, N 94.43
3jyo_A283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 94.41
1yxm_A303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 94.4
1z45_A 699 GAL10 bifunctional protein; epimerase, mutarotase, 94.38
3tpc_A257 Short chain alcohol dehydrogenase-related dehydro; 94.38
4dmm_A269 3-oxoacyl-[acyl-carrier-protein] reductase; rossma 94.37
3afn_B258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 94.37
2d5c_A263 AROE, shikimate 5-dehydrogenase; substrate, dimer, 94.37
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 94.37
3ppi_A281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 94.36
2d1y_A256 Hypothetical protein TT0321; strucrtural genomics, 94.36
3oec_A317 Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; 94.28
3ioy_A319 Short-chain dehydrogenase/reductase SDR; structura 94.23
1fjh_A257 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc 94.19
1uls_A245 Putative 3-oxoacyl-acyl carrier protein reductase; 94.18
3edm_A259 Short chain dehydrogenase; structural genomics, ox 94.18
1xu9_A286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 94.16
1sny_A267 Sniffer CG10964-PA; alpha and beta protein, rossma 94.16
3ba1_A333 HPPR, hydroxyphenylpyruvate reductase; two domain 94.16
2nqt_A352 N-acetyl-gamma-glutamyl-phosphate reductase; apopr 94.12
2hrz_A342 AGR_C_4963P, nucleoside-diphosphate-sugar epimeras 94.1
3oig_A266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 94.08
3ksu_A262 3-oxoacyl-acyl carrier protein reductase; structur 94.08
2ag5_A246 DHRS6, dehydrogenase/reductase (SDR family) member 94.07
2x9g_A288 PTR1, pteridine reductase; short chain dehydrogena 94.04
3e9m_A330 Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, 94.02
2r00_A336 Aspartate-semialdehyde dehydrogenase; conformation 94.01
3rd5_A291 Mypaa.01249.C; ssgcid, structural genomics, seattl 94.0
3hdj_A313 Probable ornithine cyclodeaminase; APC62486, borde 93.98
4da9_A280 Short-chain dehydrogenase/reductase; structural ge 93.94
1t4b_A367 Aspartate-semialdehyde dehydrogenase; asadh, HOSR, 93.94
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 93.91
2ggs_A273 273AA long hypothetical DTDP-4-dehydrorhamnose red 93.91
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 93.91
4had_A350 Probable oxidoreductase protein; structural genomi 93.89
3orf_A251 Dihydropteridine reductase; alpha-beta-alpha sandw 93.89
4f3y_A272 DHPR, dihydrodipicolinate reductase; structural ge 93.86
1g0o_A283 Trihydroxynaphthalene reductase; protein-NADPH-act 93.85
3d7l_A202 LIN1944 protein; APC89317, structural genomics, PS 93.84
3dii_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 93.84
1ydw_A362 AX110P-like protein; structural genomics, protein 93.82
2ozp_A345 N-acetyl-gamma-glutamyl-phosphate reductase; amino 93.81
2zcu_A286 Uncharacterized oxidoreductase YTFG; alpha-beta sa 93.74
2yy7_A312 L-threonine dehydrogenase; thermolabIle, flavobact 93.73
4g81_D255 Putative hexonate dehydrogenase; enzyme function i 93.73
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 93.71
1o5i_A249 3-oxoacyl-(acyl carrier protein) reductase; TM1169 93.69
1tlt_A319 Putative oxidoreductase (virulence factor MVIM HO; 93.67
2r6j_A318 Eugenol synthase 1; phenylpropene, PIP reductase, 93.65
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 93.65
2hjs_A340 USG-1 protein homolog; aspartate-semialdehyde dehy 93.64
1xgk_A352 Nitrogen metabolite repression regulator NMRA; ros 93.64
1sby_A254 Alcohol dehydrogenase; ternary complex, NAD, trifl 93.63
3gem_A260 Short chain dehydrogenase; structural genomics, AP 93.62
3ek2_A271 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 93.61
3is3_A270 17BETA-hydroxysteroid dehydrogenase; short chain d 93.59
3tum_A269 Shikimate dehydrogenase family protein; rossmann-f 93.59
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 93.58
2ho3_A325 Oxidoreductase, GFO/IDH/MOCA family; streptococcus 93.58
3db2_A354 Putative NADPH-dependent oxidoreductase; two domai 93.58
1vkn_A351 N-acetyl-gamma-glutamyl-phosphate reductase; TM178 93.53
3pzr_A370 Aspartate-semialdehyde dehydrogenase; NADP, oxidor 93.52
1qsg_A265 Enoyl-[acyl-carrier-protein] reductase; enoyl redu 93.52
1kew_A361 RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fo 93.5
1dih_A273 Dihydrodipicolinate reductase; oxidoreductase; HET 93.47
1yde_A270 Retinal dehydrogenase/reductase 3; oxidoreductase, 93.43
2v6g_A364 Progesterone 5-beta-reductase; tyrosine-dependent 93.43
3e9n_A245 Putative short-chain dehydrogenase/reductase; stru 93.37
1y81_A138 Conserved hypothetical protein; hyperthermophIle, 93.37
3dfu_A232 Uncharacterized protein from 6-phosphogluconate de 93.36
3uuw_A308 Putative oxidoreductase with NAD(P)-binding rossm 93.34
3ezy_A344 Dehydrogenase; structural genomics, unknown functi 93.28
3icc_A255 Putative 3-oxoacyl-(acyl carrier protein) reducta; 93.28
1nvt_A287 Shikimate 5'-dehydrogenase; structural genomics, P 93.27
1n7h_A381 GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, 93.21
2yjz_A201 Metalloreductase steap4; oxidoreductase, metabolic 92.32
3u62_A253 Shikimate dehydrogenase; shikimate pathway, oxidor 93.15
1z7e_A660 Protein aRNA; rossmann fold, OB-like fold, hydrola 93.12
2gcg_A330 Glyoxylate reductase/hydroxypyruvate reductase; NA 93.09
2qq5_A260 DHRS1, dehydrogenase/reductase SDR family member 1 93.08
2w2k_A348 D-mandelate dehydrogenase; 2-hydroxyacid dehydroge 93.07
3kvo_A346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 93.07
1dhr_A241 Dihydropteridine reductase; oxidoreductase(acting 93.01
3p19_A266 BFPVVD8, putative blue fluorescent protein; rossma 93.0
1t2a_A375 GDP-mannose 4,6 dehydratase; structural genomics c 93.0
3kzv_A254 Uncharacterized oxidoreductase YIR035C; cytoplasmi 92.96
3e03_A274 Short chain dehydrogenase; structural genomics, PS 92.95
1yo6_A250 Putative carbonyl reductase sniffer; tyrosine-depe 92.93
3cea_A346 MYO-inositol 2-dehydrogenase; NP_786804.1, oxidore 92.89
3evn_A329 Oxidoreductase, GFO/IDH/MOCA family; structural ge 92.88
3rc1_A350 Sugar 3-ketoreductase; sugar biosynthesis, TDP bin 92.86
3i4f_A264 3-oxoacyl-[acyl-carrier protein] reductase; struct 92.85
3qlj_A322 Short chain dehydrogenase; structural genomics, se 92.84
3ec7_A357 Putative dehydrogenase; alpha-beta, structural gen 92.75
4hkt_A331 Inositol 2-dehydrogenase; structural genomics, nys 92.73
4dgs_A340 Dehydrogenase; structural genomics, PSI-biology, N 92.64
3pwz_A272 Shikimate dehydrogenase 3; alpha-beta, oxidoreduct 92.63
2dbq_A334 Glyoxylate reductase; D-3-phosphoglycerate dehydro 92.63
1gz6_A319 Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MF 92.61
1gpj_A404 Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro 92.61
2wyu_A261 Enoyl-[acyl carrier protein] reductase; oxidoreduc 92.59
4gqa_A412 NAD binding oxidoreductase; structural genomics, P 92.55
3sc4_A285 Short chain dehydrogenase (A0QTM2 homolog); ssgcid 92.55
3ijp_A288 DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, 92.55
2pd4_A275 Enoyl-[acyl-carrier-protein] reductase [NADH]; ant 92.5
1nvm_B312 Acetaldehyde dehydrogenase (acylating), 4-hydroxy- 92.48
3h9u_A436 Adenosylhomocysteinase; NAD CO-factor complex, str 92.45
3o8q_A281 Shikimate 5-dehydrogenase I alpha; structural geno 92.43
2p5y_A311 UDP-glucose 4-epimerase; TTHA0591, structural geno 92.33
3t4e_A312 Quinate/shikimate dehydrogenase; structural genomi 92.28
3mz0_A344 Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; 92.2
3grk_A293 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 92.19
1xea_A323 Oxidoreductase, GFO/IDH/MOCA family; structural ge 92.16
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 92.13
3c1a_A315 Putative oxidoreductase; ZP_00056571.1, oxidoreduc 92.11
3k31_A296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 92.09
3jtm_A351 Formate dehydrogenase, mitochondrial; mitochondrio 92.07
3zv4_A281 CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox 92.07
1ooe_A236 Dihydropteridine reductase; structural genomics, P 92.03
1zud_1251 Adenylyltransferase THIF; thiamin, thiazole, prote 92.01
2p91_A285 Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD 91.99
3gvx_A290 Glycerate dehydrogenase related protein; NYSGXRC, 91.99
3gdg_A267 Probable NADP-dependent mannitol dehydrogenase; ro 91.91
2ekp_A239 2-deoxy-D-gluconate 3-dehydrogenase; structural ge 91.91
3uw3_A377 Aspartate-semialdehyde dehydrogenase; structural g 91.9
2dtx_A264 Glucose 1-dehydrogenase related protein; rossmann 91.86
3fr7_A 525 Putative ketol-acid reductoisomerase (OS05G057370 91.83
4g65_A 461 TRK system potassium uptake protein TRKA; structur 91.83
1oaa_A259 Sepiapterin reductase; tetrahydrobiopterin, oxidor 91.77
3u3x_A361 Oxidoreductase; structural genomics, PSI-biology, 91.63
3ajr_A317 NDP-sugar epimerase; L-threonine dehydrogenase, L- 91.53
4fs3_A256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 91.51
3vtz_A269 Glucose 1-dehydrogenase; rossmann fold, oxidoreduc 91.51
3oml_A 613 GH14720P, peroxisomal multifunctional enzyme type 91.48
2fr1_A486 Erythromycin synthase, eryai; short chain dehydrog 91.44
4fgs_A273 Probable dehydrogenase protein; PSI-biology, nysgr 91.35
2z2v_A365 Hypothetical protein PH1688; L-lysine dehydrogenas 91.34
1xyg_A359 Putative N-acetyl-gamma-glutamyl-phosphate reduct; 91.3
>7mdh_A Protein (malate dehydrogenase); chloroplastic malate dehydrogenase (NADP+), activated by LIG chloroplastic malate dehydrogenase; 2.40A {Sorghum bicolor} SCOP: c.2.1.5 d.162.1.1 PDB: 1civ_A* Back     alignment and structure
Probab=100.00  E-value=2.5e-93  Score=725.50  Aligned_cols=373  Identities=85%  Similarity=1.342  Sum_probs=338.4

Q ss_pred             CCCCCCCcceeeEEeecccchHHHhhccCCCEEEEEcCCCchHHHHHHHHHhcCCCCCCCceEEEecccccchhhHHHHH
Q 013619           67 PKSKTNDCYGVFCLTYDLKAEEETKSWKKMVNIAVSGAAGMIANHLLFKLAAGEVLGPDQPIALKLLGSERSLQALEGVA  146 (439)
Q Consensus        67 ~~~~~~~~~gv~~~~~~~~~~~~~~~~~~~~KI~IIGA~G~VG~~la~~L~~~~l~~~~~~I~L~l~~~d~~~e~l~g~a  146 (439)
                      ++.+..+||||||++|++++|.+.++|++++||+||||+|+||+++++.|+.+++++++++|.|+|+|+|.++++++|++
T Consensus         3 ~~~~~~~~~~~~~~~~~~~~e~~~~~~~~~~KV~ViGAaG~VG~~la~~l~~~~l~~e~~~l~L~d~d~~~~~~~~~G~a   82 (375)
T 7mdh_A            3 APATRKDCFGVFCTTYDLKAEDKTKSWKKLVNIAVSGAAGMISNHLLFKLASGEVFGQDQPIALKLLGSERSFQALEGVA   82 (375)
T ss_dssp             ------CCCGGGCC------------CCCCEEEEEETTTSHHHHHHHHHHHHTTTTCTTCCEEEEEECCGGGHHHHHHHH
T ss_pred             CccccccceeEEEEEeechhhhhHhhCCCCCEEEEECCCChHHHHHHHHHHcCCcCCCCceeEEEecCccchhhhhHHHH
Confidence            34556899999999999999999999999999999998899999999999999999988899999999999999999999


Q ss_pred             HHHhcccCCCCccEEEecCcccccCCCcEEEEeCCcCCCCCCchhhhHHHHHHHHHHHHHHHHhhcCCCeEEEEeCCchh
Q 013619          147 MELEDSLFPLLREVKIGINPYELFEDAEWALLIGAKPRGPGMERAGLLDINGQIFAEQGKALNAVASRNVKVIVVGNPCN  226 (439)
Q Consensus       147 ~DL~~~~~~~~~~v~i~~~~~eal~dADiVIitag~~~kpg~~r~~ll~~N~~ii~~i~~~i~~~a~p~aivIvvtNPvd  226 (439)
                      |||+|+++++..++++++++|++++|||+||++||.||||||+|.|++..|++|++++++.|+++++|+++||++|||+|
T Consensus        83 mDL~h~~~p~~~~v~i~~~~y~~~~daDvVVitag~prkpG~tR~DLl~~N~~I~k~i~~~i~~~a~p~~ivlVvsNPvD  162 (375)
T 7mdh_A           83 MELEDSLYPLLREVSIGIDPYEVFEDVDWALLIGAKPRGPGMERAALLDINGQIFADQGKALNAVASKNVKVLVVGNPCN  162 (375)
T ss_dssp             HHHHTTTCTTEEEEEEESCHHHHTTTCSEEEECCCCCCCTTCCHHHHHHHHHHHHHHHHHHHHHHSCTTCEEEECSSSHH
T ss_pred             HhHHhhhhhhcCCcEEecCCHHHhCCCCEEEEcCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHhcCCCeEEEEecCchh
Confidence            99999987777788899999999999999999999999999999999999999999999999998679999999999999


Q ss_pred             HHHHHHHHHCCCCCCCceeccccchHHHHHHHHHHHhCCCcccceeeEEEeccCCcceeccccceecCcchhhhhhhccc
Q 013619          227 TNALICLKNAPSIPAKNFHALTRLDENRAKCQLALKAGVFYDKVSNMTIWGNHSTTQVPDFLNARINGLPVKEIIKDHKW  306 (439)
Q Consensus       227 ~~t~i~~k~s~~~p~kvig~gt~LDs~R~~~~lA~~lgv~~~~V~~~~V~GeHGdt~Vp~~S~~~I~G~pi~~~i~~~~~  306 (439)
                      +||++++|+++++|+|+||+||.||++||+++||+++|++|++|++++||||||++|||+||+++|+|+|+.+++.+++|
T Consensus       163 ~~t~ia~k~sg~~~~rvig~gT~LDsaR~r~~lA~~lgv~~~~V~~v~V~GeHgdt~vp~~S~a~V~G~pl~~~~~~~~~  242 (375)
T 7mdh_A          163 TNALICLKNAPDIPAKNFHALTRLDENRAKCQLALKAGVFYDKVSNVTIWGNHSTTQVPDFLNAKIDGRPVKEVIKRTKW  242 (375)
T ss_dssp             HHHHHHHHTCTTSCGGGEEECCHHHHHHHHHHHHHHTTSCGGGEECCEEEBCSSTTCEEECSSCEETTEEGGGTCCCHHH
T ss_pred             HHHHHHHHHcCCCCccEEEeeehHHHHHHHHHHHHHhCcChhhcccceEEecCCCceeeeeecccCCCEEhhHhccchhh
Confidence            99999999998888899999999999999999999999999999987899999999999999999999999999877778


Q ss_pred             cHHHHHHHHHHhHHHHHHhcCCccHHHHHHHHHHHHHHhhcCCCCCcEEEEeeeeCCCccCCCCceEEEEEEEEcCCCce
Q 013619          307 LEEGFTETIQKRGGLLIKKWGRSSAASTAVSIVDAMKSLVTPTPEGDWFSSGVYTNGNPYGIAEDIVFSMPCRSKGDGDY  386 (439)
Q Consensus       307 ~~~ei~~~v~~~~~~Ii~~kG~s~~~s~A~~i~~aI~~il~~~d~~~v~~~sv~~~G~~yGip~dv~~svPv~ig~~Gv~  386 (439)
                      ..+++.++++++|++|++.||.++|+++|.+++++|++|+.|+|+++|+|+|++++|++||+|+|+|||+||++|++|++
T Consensus       243 ~~~~i~~~v~~~g~eII~~kG~ts~a~aa~~i~~~i~~~l~g~d~~~v~~vs~~~~G~~YGi~~dv~~s~P~vlg~~Gv~  322 (375)
T 7mdh_A          243 LEEEFTITVQKRGGALIQKWGRSSAASTAVSIADAIKSLVTPTPEGDWFSTGVYTTGNPYGIAEDIVFSMPCRSKGDGDY  322 (375)
T ss_dssp             HHHHHHHHHHTHHHHHHHHTSSCCHHHHHHHHHHHHHHHHSCCCTTCCEEEEEECTTCSSCCCSSSEEEEEEECCSSSCC
T ss_pred             HHHHHHHHHHHHHHHHHHhcCCCchHHHHHHHHHHHHHHhcCCCCCeEEEEEEEeCCccCCCCCceEEEEEEEEcCCeeE
Confidence            88899999999999999999999998899999999999998889999999999999955999999999999999999999


Q ss_pred             EeecCCCCCHHHHHHHHHHHHHHHHHHHHHHHhhccCcccccCCCCCCCCCCC
Q 013619          387 ELVKDVIFDDYLRKRIAKTEQELLAEKKCVAHLTGEGIAFCDLPEDTMLPGEM  439 (439)
Q Consensus       387 ~iv~~~~L~~~E~~~l~~sa~~l~~~~~~v~~~~~~~~~~~~~~~~~~~~~~~  439 (439)
                      +++++++|+++|+++|++|+++|+++++.|.||++++.++|++|+|||+|||.
T Consensus       323 ~iv~~l~L~~~E~~~l~~Sa~~L~~e~~~~~~~~~~~~~~~~~~~~~~~~~~~  375 (375)
T 7mdh_A          323 ELATDVSNDDFLWERIKKSEAELLAEKKCVAHLTGEGNAYCDVPEDTMLPGEV  375 (375)
T ss_dssp             EECCCCCCCHHHHHHHHHHHHHHHHHHHHTHHHHTSSSCCCCCCSTTCC----
T ss_pred             EecCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHhhccccccCCCcccCCCCC
Confidence            99966999999999999999999999999999999999999999999999984
>5mdh_A Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH(D)); HET: NAD; 2.40A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 4mdh_A* Back     alignment and structure
>4h7p_A Malate dehydrogenase; ssgcid, structural G seattle structural genomics center for infectious disease, oxidoreductase; 1.30A {Leishmania major} Back     alignment and structure
>3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Back     alignment and structure
>4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... Back     alignment and structure
>3nep_X Malate dehydrogenase; halophIle, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle; 1.55A {Salinibacter ruber} Back     alignment and structure
>2x0j_A Malate dehydrogenase; oxidoreductase, hyperthermophilic, tricarboxylic acid cycle; HET: ENA; 2.79A {Archaeoglobus fulgidus dsm 4304} PDB: 2x0i_A* Back     alignment and structure
>1ez4_A Lactate dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.30A {Lactobacillus pentosus} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Back     alignment and structure
>1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A* Back     alignment and structure
>2zqz_A L-LDH, L-lactate dehydrogenase; oxidoreductase, rossmann fold, cytoplasm, glycolysis, NAD, phosphoprotein; 2.50A {Lactobacillus casei} PDB: 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>2xxj_A L-LDH, L-lactate dehydrogenase; oxidoreductase, hyperthermophIle; HET: NAD; 1.964A {Thermus thermophilus} PDB: 2xxb_A* 3zzn_A* 2v7p_A* 2e37_A* 2v6m_A* 2xxe_A 4a73_A Back     alignment and structure
>1b8p_A Protein (malate dehydrogenase); oxidoreductase; 1.90A {Aquaspirillum arcticum} SCOP: c.2.1.5 d.162.1.1 PDB: 1b8u_A* 1b8v_A* 3d5t_A Back     alignment and structure
>3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* Back     alignment and structure
>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>2d4a_B Malate dehydrogenase; archaea, hyperthermophIle, oxidoreductase; 2.87A {Aeropyrum pernix} Back     alignment and structure
>1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* Back     alignment and structure
>1o6z_A MDH, malate dehydrogenase; halophilic, ION-binding, protein-solvent interaction, oxidoreductase; HET: NAD; 1.95A {Haloarcula marismortui} SCOP: c.2.1.5 d.162.1.1 PDB: 1gt2_A* 2x0r_A* 2j5k_A 2j5q_A 2j5r_A 1d3a_A 1hlp_A* 2hlp_A Back     alignment and structure
>3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 Back     alignment and structure
>3hhp_A Malate dehydrogenase; MDH, citric acid cycle, TCA cycle, NAD, oxidoreductase, tricarboxylic acid cycle; 1.45A {Escherichia coli k-12} PDB: 2pwz_A 2cmd_A* 1emd_A* 1ib6_A* 1ie3_A* 4e0b_A* Back     alignment and structure
>1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>1hye_A L-lactate/malate dehydrogenase; nucleotide binding domain, oxidoreductase; HET: NAP; 1.90A {Methanocaldococcus jannaschii} SCOP: c.2.1.5 d.162.1.1 PDB: 1hyg_A* Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* Back     alignment and structure
>2i6t_A Ubiquitin-conjugating enzyme E2-like isoform A; L-lactate dehydrogenase, oxidoreductase, ubiquitin-protein L unknown function; 2.10A {Homo sapiens} PDB: 3dl2_A Back     alignment and structure
>1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>1mld_A Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D)); HET: CIT; 1.83A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 2dfd_A* Back     alignment and structure
>1y7t_A Malate dehydrogenase; NAD-dependent-MDH-NADPH complex, oxidoreductase; HET: NDP; 1.65A {Thermus thermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1iz9_A* 2cvq_A* 1bmd_A* 1bdm_A* 1wze_A* 1wzi_A* Back     alignment and structure
>1smk_A Malate dehydrogenase, glyoxysomal; tricarboxylic cycle, glyoxysome, NAD, glyoxylate bypass, oxidoreductase; HET: CIT; 2.50A {Citrullus lanatus} PDB: 1sev_A Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>1up7_A 6-phospho-beta-glucosidase; hydrolase, family4 hydrolase, Na dependent; HET: G6P NAD; 2.4A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.2 PDB: 1up6_A* 1up4_A Back     alignment and structure
>1s6y_A 6-phospho-beta-glucosidase; hydrolase, structural genomics, PSI, protein structure initi midwest center for structural genomics; 2.31A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>1u8x_X Maltose-6'-phosphate glucosidase; structural genomics, PSI, protein structure initiative, MCSG glucosidase, NAD-dependent; HET: G6P NAD; 2.05A {Bacillus subtilis} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>3fef_A Putative glucosidase LPLD; gulosidase, structural genomics, unknown function, glycosidase, hydrolase, manganese, metal-binding, NAD, PSI- 2; 2.20A {Bacillus subtilis} Back     alignment and structure
>1obb_A Maltase, alpha-glucosidase; glycosidase, sulfinic acid, NAD+, maltose, hydrolase; HET: MAL NAD; 1.90A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>3u95_A Glycoside hydrolase, family 4; hydrolysis, cytosol; 2.00A {Thermotoga neapolitana} PDB: 1vjt_A* Back     alignment and structure
>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* Back     alignment and structure
>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} Back     alignment and structure
>2o3j_A UDP-glucose 6-dehydrogenase; structural genomics, PSI-2, prote structure initiative, NEW YORK SGX research center for STRU genomics; 1.88A {Caenorhabditis elegans} Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* Back     alignment and structure
>1dlj_A UDP-glucose dehydrogenase; rossmann fold, ternary complex, crystallographic dimer, oxidoreductase; HET: NAI UGA; 1.80A {Streptococcus pyogenes} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1dli_A* Back     alignment and structure
>3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} Back     alignment and structure
>2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* Back     alignment and structure
>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Back     alignment and structure
>1yj8_A Glycerol-3-phosphate dehydrogenase; SGPP, structural genomics, PSI; 2.85A {Plasmodium falciparum} Back     alignment and structure
>2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>1x0v_A GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic; two independent domains, GXGXXG motif, oxidoreductase; 2.30A {Homo sapiens} PDB: 1x0x_A* 1wpq_A* 2pla_A* Back     alignment and structure
>4fgw_A Glycerol-3-phosphate dehydrogenase [NAD(+)] 1; oxidoreductase; 2.45A {Saccharomyces cerevisiae} Back     alignment and structure
>2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Back     alignment and structure
>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum} Back     alignment and structure
>2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 Back     alignment and structure
>3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} Back     alignment and structure
>2qyt_A 2-dehydropantoate 2-reductase; APC81190, porphyromonas gingi W83, structural genomics, PSI-2; HET: MSE; 2.15A {Porphyromonas gingivalis} Back     alignment and structure
>1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A* Back     alignment and structure
>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>3zwc_A Peroxisomal bifunctional enzyme; beta oxidation pathway, oxidoreductase, lipid metabolism, LY isomerase, peroxisome, fatty acid metabolism; HET: NAD HSC; 2.30A {Rattus norvegicus} PDB: 3zw9_A* 3zw8_A* 3zwa_A* 3zwb_A* 2x58_A* Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Back     alignment and structure
>1pgj_A 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; oxidoreductase, CHOH(D)-NADP+(B); 2.82A {Trypanosoma brucei} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0 Back     alignment and structure
>1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A* Back     alignment and structure
>3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} Back     alignment and structure
>4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Back     alignment and structure
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Back     alignment and structure
>3c7a_A Octopine dehydrogenase; L) stereospecific opine dehydrogenas, oxidorecutase, oxidoreductase; HET: NAD; 2.10A {Pecten maximus} PDB: 3c7c_B* 3c7d_B* 3iqd_B* Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A Back     alignment and structure
>2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Back     alignment and structure
>3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Back     alignment and structure
>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* Back     alignment and structure
>1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6 Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Back     alignment and structure
>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* Back     alignment and structure
>2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>1eq2_A ADP-L-glycero-D-mannoheptose 6-epimerase; N-terminal domain rossmann fold, C-terminal mixed alpha/beta domain; HET: NAP ADQ; 2.00A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>3ojo_A CAP5O; rossmann fold, complex with cofactor NAD and EU(PDC)3, oxidi conformation, oxidoreductase; HET: NAD PDC; 2.50A {Staphylococcus aureus} PDB: 3ojl_A* Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} Back     alignment and structure
>2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A* Back     alignment and structure
>4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Back     alignment and structure
>2i99_A MU-crystallin homolog; thyroid hormine binding protein, oxidoreductase; HET: NDP; 2.60A {Homo sapiens} Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Back     alignment and structure
>2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} Back     alignment and structure
>2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Back     alignment and structure
>3obb_A Probable 3-hydroxyisobutyrate dehydrogenase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: EPE; 2.20A {Pseudomonas aeruginosa} PDB: 3q3c_A* Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Back     alignment and structure
>3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Back     alignment and structure
>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} Back     alignment and structure
>1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A* Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Back     alignment and structure
>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Back     alignment and structure
>3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>4b8w_A GDP-L-fucose synthase; oxidoreductase; HET: NAP GDP; 2.75A {Homo sapiens} Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Back     alignment and structure
>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Back     alignment and structure
>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* Back     alignment and structure
>1x7d_A Ornithine cyclodeaminase; binds NAD+, binds L-ornithine, binds L-proline, 2 bundle, beta barrel, rossmann fold, lyase; HET: NAD ORN MES; 1.60A {Pseudomonas putida} SCOP: c.2.1.13 PDB: 1u7h_A* Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Back     alignment and structure
>4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Back     alignment and structure
>4dpl_A Malonyl-COA/succinyl-COA reductase; dinucleotide binding, dimerization domain, NADP, oxidoreductase; HET: NAP; 1.90A {Sulfolobus tokodaii} PDB: 4dpk_A* 4dpm_A* Back     alignment and structure
>4dpk_A Malonyl-COA/succinyl-COA reductase; dinucleotide binding, dimerization domain, NADP, oxidoreductase; 2.05A {Sulfolobus tokodaii} PDB: 4dpm_A* Back     alignment and structure
>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Back     alignment and structure
>3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Back     alignment and structure
>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3pwk_A Aspartate-semialdehyde dehydrogenase; NADP binding, oxidoreductase-oxidoreductase I complex; HET: 25A L14; 1.50A {Streptococcus pneumoniae} PDB: 2gyy_A* 2gz2_A* 2gz3_A* 2gz1_A* 3pws_A* 3pyl_A 3pyx_A* 3pzb_A* 3q11_A* 3q1l_A Back     alignment and structure
>2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A Back     alignment and structure
>4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Back     alignment and structure
>1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6 Back     alignment and structure
>3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Back     alignment and structure
>2i76_A Hypothetical protein; NADP, dehydrogenase, TM1727, structural genomics, PSI-2, protein structure initiative; HET: NDP; 3.00A {Thermotoga maritima} SCOP: a.100.1.10 c.2.1.6 Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Back     alignment and structure
>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>1r6d_A TDP-glucose-4,6-dehydratase; rossmann fold, short-chain dehydrogenase/reductase, lyase; HET: NAD DAU; 1.35A {Streptomyces venezuelae} SCOP: c.2.1.2 PDB: 1r66_A* Back     alignment and structure
>1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A* Back     alignment and structure
>3euw_A MYO-inositol dehydrogenase; protein structure initiative II (PSI II), NYSGXRC, MYO-inosi dehydrogenase, oxidoreductase, tetramer; 2.30A {Corynebacterium glutamicum} Back     alignment and structure
>4f6l_B AUSA reductase domain protein; thioester reductase, oxidoreductase; 3.86A {Staphylococcus aureus} Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Back     alignment and structure
>1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 Back     alignment and structure
>3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Back     alignment and structure
>1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 Back     alignment and structure
>1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A* Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Back     alignment and structure
>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3dr3_A N-acetyl-gamma-glutamyl-phosphate reductase; csgid target, ARGC, essential gene, amino-acid biosynthesis, arginine biosynthesis, cytoplasm; HET: MLT; 2.00A {Shigella flexneri} PDB: 2g17_A Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>3tz6_A Aspartate-semialdehyde dehydrogenase; asadh, ASD, ASA, amino-acid biosynthesis, diaminopimelate biosynthesis, lysine biosynthesis; HET: SO4; 1.95A {Mycobacterium tuberculosis} PDB: 3vos_A* 3kub_A 3llg_A Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP} Back     alignment and structure
>1gy8_A UDP-galactose 4-epimerase; oxidoreductase; HET: NAD UDP; 2.0A {Trypanosoma brucei} SCOP: c.2.1.2 PDB: 2cnb_A* Back     alignment and structure
>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 Back     alignment and structure
>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} Back     alignment and structure
>1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A* Back     alignment and structure
>1omo_A Alanine dehydrogenase; two-domain, beta-sandwich-dimer, rossmann-fold NAD domain, human MU crystallin homolog; HET: NAD; 2.32A {Archaeoglobus fulgidus} SCOP: c.2.1.13 PDB: 1vll_A Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A* Back     alignment and structure
>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} Back     alignment and structure
>2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} Back     alignment and structure
>1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 Back     alignment and structure
>3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A Back     alignment and structure
>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Back     alignment and structure
>3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} Back     alignment and structure
>2ep5_A 350AA long hypothetical aspartate-semialdehyde dehydrogenase; oxidoreductase, structural genomics, NPPSFA; 2.40A {Sulfolobus tokodaii} Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Back     alignment and structure
>1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>1udb_A Epimerase, UDP-galactose-4-epimerase; isomerase; HET: NAD UFG; 1.65A {Escherichia coli} SCOP: c.2.1.2 PDB: 1lrj_A* 1nai_A* 1uda_A* 1nah_A* 1xel_A* 1kvq_A* 1kvs_A* 1udc_A* 2udp_A* 1a9z_A* 1kvt_A* 1kvr_A* 1lrk_A* 1lrl_A* 1kvu_A* 1a9y_A* Back     alignment and structure
>3hsk_A Aspartate-semialdehyde dehydrogenase; candida albicans NADP complex, amino-acid biosynthesis; HET: NAP; 2.20A {Candida albicans} Back     alignment and structure
>3q2i_A Dehydrogenase; rossmann fold, UDP-sugar binding, NAD binding oxidoreductase; HET: NAD HP7; 1.50A {Chromobacterium violaceum} PDB: 3q2k_A* Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1z45_A GAL10 bifunctional protein; epimerase, mutarotase, metabolism, isomerase; HET: GAL NAD GUD; 1.85A {Saccharomyces cerevisiae} SCOP: b.30.5.4 c.2.1.2 Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Back     alignment and structure
>2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Back     alignment and structure
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* Back     alignment and structure
>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Back     alignment and structure
>3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* Back     alignment and structure
>2nqt_A N-acetyl-gamma-glutamyl-phosphate reductase; apoprotein, dimer, rossmann fold, structural genomics, PSI, protein structure initiative; 1.58A {Mycobacterium tuberculosis} PDB: 2i3a_A* 2i3g_A Back     alignment and structure
>2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} Back     alignment and structure
>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... Back     alignment and structure
>3e9m_A Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, PSI-II, dimeric dihydodiol dehydrogenase, structural genomics; 2.70A {Enterococcus faecalis} Back     alignment and structure
>2r00_A Aspartate-semialdehyde dehydrogenase; conformational change, half-OF-sites-reactivity, protein evolution, sequence homology; HET: HTI; 2.03A {Vibrio cholerae} PDB: 2qz9_A* 2r00_C* Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Back     alignment and structure
>3hdj_A Probable ornithine cyclodeaminase; APC62486, bordetella pertussis TOH structural genomics, PSI-2, protein structure initiative; 1.70A {Bordetella pertussis} Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>1t4b_A Aspartate-semialdehyde dehydrogenase; asadh, HOSR, lysine biosynthesis, NADP+ oxidoreductase (phosphorylating), domain movement; 1.60A {Escherichia coli} SCOP: c.2.1.3 d.81.1.1 PDB: 1t4d_A 1brm_A 1gl3_A* 1nwc_A 1ta4_A 1tb4_A 1ps8_A 1pr3_A 1oza_A 1pqu_A* 1pqp_A 1nwh_A* 1nx6_A* 1pu2_A* 1q2x_A* Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>2ggs_A 273AA long hypothetical DTDP-4-dehydrorhamnose reductase; alpha, beta, oxidoreductase; HET: NDP; 1.70A {Sulfolobus tokodaii} Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>4had_A Probable oxidoreductase protein; structural genomics, protein structure initiative, nysgrc, PSI-biology; 2.00A {Rhizobium etli} Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Back     alignment and structure
>4f3y_A DHPR, dihydrodipicolinate reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Burkholderia thailandensis} Back     alignment and structure
>1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* Back     alignment and structure
>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} Back     alignment and structure
>1ydw_A AX110P-like protein; structural genomics, protein structure initiative, center for eukaryotic structural genomics, CESG, AT4G09670; 2.49A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.5 PDB: 2q4e_A Back     alignment and structure
>2ozp_A N-acetyl-gamma-glutamyl-phosphate reductase; amino acid biosynthesis, structural genomics, riken structur genomics/proteomics initiative; 2.01A {Thermus thermophilus} Back     alignment and structure
>2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* Back     alignment and structure
>2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>1tlt_A Putative oxidoreductase (virulence factor MVIM HO; structural genomics, NYSGXRC, PSI, protein structure initiative; 2.70A {Escherichia coli} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>2hjs_A USG-1 protein homolog; aspartate-semialdehyde dehydrogenase, probable hydrolase, PS aeruginosa, structurual genomics; 2.20A {Pseudomonas aeruginosa} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Back     alignment and structure
>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>3db2_A Putative NADPH-dependent oxidoreductase; two domain protein, rossman fold, putative dehydrogenase, ST genomics; 1.70A {Desulfitobacterium hafniense dcb-2} Back     alignment and structure
>1vkn_A N-acetyl-gamma-glutamyl-phosphate reductase; TM1782, structu genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; 1.80A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3pzr_A Aspartate-semialdehyde dehydrogenase; NADP, oxidoreductase-oxidoreductase inhibitor complex; HET: NAP; 1.75A {Vibrio cholerae} PDB: 1mc4_A 1mb4_A* 3q0e_A Back     alignment and structure
>1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* Back     alignment and structure
>1kew_A RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fold, lyase; HET: TYD NAD; 1.80A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1g1a_A* 1keu_A* 1bxk_A* Back     alignment and structure
>1dih_A Dihydrodipicolinate reductase; oxidoreductase; HET: NDP; 2.20A {Escherichia coli} SCOP: c.2.1.3 d.81.1.3 PDB: 1arz_A* 1dru_A* 1drv_A* 1drw_A* Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2v6g_A Progesterone 5-beta-reductase; tyrosine-dependent oxidoreductase, oxidoreductase, SDR, cardenolides, cardiac glycosides; HET: NAP; 2.3A {Digitalis lanata} PDB: 2v6f_A* Back     alignment and structure
>3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} Back     alignment and structure
>1y81_A Conserved hypothetical protein; hyperthermophIle, structural genomics, PSI, protein structure initiative; HET: COA; 1.70A {Pyrococcus furiosus} SCOP: c.2.1.8 Back     alignment and structure
>3dfu_A Uncharacterized protein from 6-phosphogluconate dehydrogenase-like family; putative rossmann-like dehydrogenase, structural genomics; HET: MSE; 2.07A {Corynebacterium glutamicum} Back     alignment and structure
>3uuw_A Putative oxidoreductase with NAD(P)-binding rossm domain; structural genomics, center for structural genomics of infec diseases, csgid; HET: 1PE PGE; 1.63A {Clostridium difficile} Back     alignment and structure
>3ezy_A Dehydrogenase; structural genomics, unknown function, PSI-2, protein structure initiative; 2.04A {Thermotoga maritima} Back     alignment and structure
>3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str} Back     alignment and structure
>1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* Back     alignment and structure
>2yjz_A Metalloreductase steap4; oxidoreductase, metabolic syndrome; HET: NAP; 2.20A {Rattus norvegicus} Back     alignment and structure
>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} Back     alignment and structure
>1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 Back     alignment and structure
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Back     alignment and structure
>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} Back     alignment and structure
>2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Back     alignment and structure
>1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Back     alignment and structure
>1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3cea_A MYO-inositol 2-dehydrogenase; NP_786804.1, oxidoreductase FA NAD-binding rossmann fold, structural genomics; HET: NAD; 2.40A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3evn_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics; 2.00A {Streptococcus agalactiae serogroup V} Back     alignment and structure
>3rc1_A Sugar 3-ketoreductase; sugar biosynthesis, TDP binding, NADP binding binding protein; HET: TLO NAP; 1.71A {Actinomadura kijaniata} PDB: 3rbv_A* 3rc2_A* 3rcb_A* 3rc7_A* 3rc9_A* Back     alignment and structure
>3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} SCOP: c.2.1.0 Back     alignment and structure
>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} Back     alignment and structure
>3ec7_A Putative dehydrogenase; alpha-beta, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; HET: MSE NAD EPE; 2.15A {Salmonella typhimurium} Back     alignment and structure
>4hkt_A Inositol 2-dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium, oxidoreductase; HET: MSE; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} Back     alignment and structure
>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Back     alignment and structure
>1gz6_A Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MFE-2, beta-oxidation, peroxisome, SDR, steroid biosynthesis, oxidoreductase, NADP; HET: NAI; 2.38A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1zbq_A* Back     alignment and structure
>1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 Back     alignment and structure
>2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* Back     alignment and structure
>4gqa_A NAD binding oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: MSE; 2.42A {Klebsiella pneumoniae} Back     alignment and structure
>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Back     alignment and structure
>3ijp_A DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, decode biostructures, niaid, amino-acid biosynthesis, cytoplasm; HET: NAP; 2.30A {Bartonella henselae} Back     alignment and structure
>2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* Back     alignment and structure
>1nvm_B Acetaldehyde dehydrogenase (acylating), 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* Back     alignment and structure
>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* Back     alignment and structure
>2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A* Back     alignment and structure
>3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* Back     alignment and structure
>3mz0_A Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; MYO-inositol dehydrogenase, bsidh, oxidoreductase; HET: MSE PGE; 1.54A {Bacillus subtilis} PDB: 3nt2_A* 3nt4_A* 3nt5_A* 3nto_A* 3ntq_A* 3ntr_A* Back     alignment and structure
>3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* Back     alignment and structure
>1xea_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, protein structure initiative, NYSGXRC, VCA1048, GFO/IDH/MOCA family oxidoreductase; 2.65A {Vibrio cholerae} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>3c1a_A Putative oxidoreductase; ZP_00056571.1, oxidoreductase FAM binding rossmann fold, structural genomics; HET: MSE PG4 PGE; 1.85A {Magnetospirillum magnetotacticum} Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Back     alignment and structure
>3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A Back     alignment and structure
>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Back     alignment and structure
>1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Back     alignment and structure
>2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} Back     alignment and structure
>3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} Back     alignment and structure
>3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} SCOP: c.2.1.0 PDB: 3gdf_A Back     alignment and structure
>2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A Back     alignment and structure
>3uw3_A Aspartate-semialdehyde dehydrogenase; structural genomics, seattle structural genomics center for infectious disease (ssgcid); 1.55A {Burkholderia thailandensis} Back     alignment and structure
>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Back     alignment and structure
>3fr7_A Putative ketol-acid reductoisomerase (OS05G057370 protein); rossmann fold, NADPH, knotted protein, branched-chain amino biosynthesis; 1.55A {Oryza sativa japonica group} PDB: 3fr8_A* 1qmg_A* 1yve_I* Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* Back     alignment and structure
>3u3x_A Oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.79A {Sinorhizobium meliloti} Back     alignment and structure
>3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A* Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} Back     alignment and structure
>3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster} Back     alignment and structure
>2fr1_A Erythromycin synthase, eryai; short chain dehydrogenase/reductase, oxidoreductase; HET: NDP; 1.79A {Saccharopolyspora erythraea} SCOP: c.2.1.2 c.2.1.2 PDB: 2fr0_A* Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
>1xyg_A Putative N-acetyl-gamma-glutamyl-phosphate reduct; structural genomics, protein structure initiative, CENT eukaryotic structural genomics; 2.19A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.1 PDB: 2q49_A 2cvo_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 439
d7mdha1175 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum ( 4e-68
d7mdha2188 d.162.1.1 (A:198-385) Malate dehydrogenase {Sorghu 3e-66
d5mdha2179 d.162.1.1 (A:155-333) Malate dehydrogenase {Pig (S 5e-44
d1y7ta1154 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus th 2e-43
d5mdha1154 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus s 1e-41
d1y7ta2173 d.162.1.1 (A:154-332) Malate dehydrogenase {Thermu 1e-40
d1b8pa2171 d.162.1.1 (A:159-329) Malate dehydrogenase {Aquasp 9e-33
d1ldma2169 d.162.1.1 (A:161-329) Lactate dehydrogenase {Dogfi 4e-24
d1mlda2169 d.162.1.1 (A:145-313) Malate dehydrogenase {Pig (S 6e-23
d2cmda2167 d.162.1.1 (A:146-312) Malate dehydrogenase {Escher 6e-23
d2ldxa2172 d.162.1.1 (A:160-331) Lactate dehydrogenase {Mouse 2e-22
d2cmda1145 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichi 7e-22
d1llda2170 d.162.1.1 (A:150-319) Lactate dehydrogenase {Bifid 5e-21
d1i0za2172 d.162.1.1 (A:161-332) Lactate dehydrogenase {Human 7e-21
d1guza2163 d.162.1.1 (A:143-305) Malate dehydrogenase {Chloro 1e-20
d1pzga2174 d.162.1.1 (A:164-334) Lactate dehydrogenase {Toxop 5e-20
d1hyea2168 d.162.1.1 (A:146-313) MJ0490, lactate/malate dehyd 6e-20
d1a5za2172 d.162.1.1 (A:164-333) Lactate dehydrogenase {Therm 2e-18
d1uxja2164 d.162.1.1 (A:144-307) Malate dehydrogenase {Chloro 3e-18
d1mlda1144 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus s 3e-18
d1ez4a2171 d.162.1.1 (A:163-334) Lactate dehydrogenase {Lacto 6e-18
d1t2da2165 d.162.1.1 (A:151-315) Lactate dehydrogenase {Malar 8e-18
d1hyea1145 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydroge 2e-17
d1ldna2168 d.162.1.1 (A:163-330) Lactate dehydrogenase {Bacil 2e-17
d1y6ja2169 d.162.1.1 (A:149-317) Lactate dehydrogenase {Clost 3e-17
d1hyha2163 d.162.1.1 (A:167-329) L-2-hydroxyisocapronate dehy 7e-17
d1guza1142 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium 4e-16
d1llca2172 d.162.1.1 (A:165-334) Lactate dehydrogenase {Lacto 4e-16
d1o6za2161 d.162.1.1 (A:163-330) Malate dehydrogenase {Archae 4e-16
d1o6za1142 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon 2e-15
d1ojua1142 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon 4e-11
d1hyha1146 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydro 4e-11
d1a5za1140 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermoto 1e-10
d1llda1143 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobac 1e-10
d1ldna1148 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus 2e-10
d1i0za1160 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Ho 1e-09
d1ez4a1146 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobac 5e-08
d2ldxa1159 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mu 5e-08
d1uxja1142 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflex 7e-08
d1y6ja1142 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridi 4e-06
d1pzga1154 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplas 2e-04
d1u8xx1167 c.2.1.5 (X:3-169) Maltose-6'-phosphate glucosidase 8e-04
d1up7a1162 c.2.1.5 (A:1-162) 6-phospho-beta-glucosidase {Ther 0.004
>d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} Length = 175 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: LDH N-terminal domain-like
domain: Malate dehydrogenase
species: Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]

 Score =  212 bits (541), Expect = 4e-68
 Identities = 154/175 (88%), Positives = 167/175 (95%)

Query: 73  DCYGVFCLTYDLKAEEETKSWKKMVNIAVSGAAGMIANHLLFKLAAGEVLGPDQPIALKL 132
           DC+GVFC TYDLKAE++TKSWKK+VNIAVSGAAGMI+NHLLFKLA+GEV G DQPIALKL
Sbjct: 1   DCFGVFCTTYDLKAEDKTKSWKKLVNIAVSGAAGMISNHLLFKLASGEVFGQDQPIALKL 60

Query: 133 LGSERSLQALEGVAMELEDSLFPLLREVKIGINPYELFEDAEWALLIGAKPRGPGMERAG 192
           LGSERS QALEGVAMELEDSL+PLLREV IGI+PYE+FED +WALLIGAKPRGPGMERA 
Sbjct: 61  LGSERSFQALEGVAMELEDSLYPLLREVSIGIDPYEVFEDVDWALLIGAKPRGPGMERAA 120

Query: 193 LLDINGQIFAEQGKALNAVASRNVKVIVVGNPCNTNALICLKNAPSIPAKNFHAL 247
           LLDINGQIFA+QGKALNAVAS+NVKV+VVGNPCNTNALICLKNAP IPAKNFHAL
Sbjct: 121 LLDINGQIFADQGKALNAVASKNVKVLVVGNPCNTNALICLKNAPDIPAKNFHAL 175
>d7mdha2 d.162.1.1 (A:198-385) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} Length = 188 Back     information, alignment and structure
>d5mdha2 d.162.1.1 (A:155-333) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Length = 179 Back     information, alignment and structure
>d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Length = 154 Back     information, alignment and structure
>d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Length = 154 Back     information, alignment and structure
>d1y7ta2 d.162.1.1 (A:154-332) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Length = 173 Back     information, alignment and structure
>d1b8pa2 d.162.1.1 (A:159-329) Malate dehydrogenase {Aquaspirillum arcticum [TaxId: 87645]} Length = 171 Back     information, alignment and structure
>d1ldma2 d.162.1.1 (A:161-329) Lactate dehydrogenase {Dogfish (Squalus acanthias) [TaxId: 7797]} Length = 169 Back     information, alignment and structure
>d1mlda2 d.162.1.1 (A:145-313) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Length = 169 Back     information, alignment and structure
>d2cmda2 d.162.1.1 (A:146-312) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Length = 167 Back     information, alignment and structure
>d2ldxa2 d.162.1.1 (A:160-331) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Length = 172 Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Length = 145 Back     information, alignment and structure
>d1llda2 d.162.1.1 (A:150-319) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Length = 170 Back     information, alignment and structure
>d1i0za2 d.162.1.1 (A:161-332) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Length = 172 Back     information, alignment and structure
>d1guza2 d.162.1.1 (A:143-305) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Length = 163 Back     information, alignment and structure
>d1pzga2 d.162.1.1 (A:164-334) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Length = 174 Back     information, alignment and structure
>d1hyea2 d.162.1.1 (A:146-313) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 168 Back     information, alignment and structure
>d1a5za2 d.162.1.1 (A:164-333) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Length = 172 Back     information, alignment and structure
>d1uxja2 d.162.1.1 (A:144-307) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Length = 164 Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Length = 144 Back     information, alignment and structure
>d1ez4a2 d.162.1.1 (A:163-334) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Length = 171 Back     information, alignment and structure
>d1t2da2 d.162.1.1 (A:151-315) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 165 Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 145 Back     information, alignment and structure
>d1ldna2 d.162.1.1 (A:163-330) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Length = 168 Back     information, alignment and structure
>d1y6ja2 d.162.1.1 (A:149-317) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Length = 169 Back     information, alignment and structure
>d1hyha2 d.162.1.1 (A:167-329) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Length = 163 Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Length = 142 Back     information, alignment and structure
>d1llca2 d.162.1.1 (A:165-334) Lactate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Length = 172 Back     information, alignment and structure
>d1o6za2 d.162.1.1 (A:163-330) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Length = 161 Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Length = 142 Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 142 Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Length = 146 Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Length = 140 Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Length = 143 Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Length = 148 Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Length = 160 Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Length = 146 Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Length = 159 Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Length = 142 Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Length = 142 Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Length = 154 Back     information, alignment and structure
>d1u8xx1 c.2.1.5 (X:3-169) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis [TaxId: 1423]} Length = 167 Back     information, alignment and structure
>d1up7a1 c.2.1.5 (A:1-162) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]} Length = 162 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query439
d7mdha2188 Malate dehydrogenase {Sorghum (Sorghum vulgare), c 100.0
d7mdha1175 Malate dehydrogenase {Sorghum (Sorghum vulgare), c 100.0
d5mdha2179 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 100.0
d1b8pa2171 Malate dehydrogenase {Aquaspirillum arcticum [TaxI 100.0
d1y7ta2173 Malate dehydrogenase {Thermus thermophilus [TaxId: 100.0
d1i0za2172 Lactate dehydrogenase {Human (Homo sapiens), heart 100.0
d1hyea2168 MJ0490, lactate/malate dehydrogenase {Archaeon Met 100.0
d1llda2170 Lactate dehydrogenase {Bifidobacterium longum, str 100.0
d1pzga2174 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 100.0
d1y6ja2169 Lactate dehydrogenase {Clostridium thermocellum [T 100.0
d1hyha2163 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 100.0
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 100.0
d1a5za2172 Lactate dehydrogenase {Thermotoga maritima [TaxId: 100.0
d1guza2163 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 100.0
d1ojua2152 Lactate dehydrogenase {Archaeon Archaeoglobus fulg 100.0
d1y7ta1154 Malate dehydrogenase {Thermus thermophilus [TaxId: 100.0
d1ldma2169 Lactate dehydrogenase {Dogfish (Squalus acanthias) 100.0
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 100.0
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 100.0
d1ez4a2171 Lactate dehydrogenase {Lactobacillus pentosus [Tax 100.0
d2ldxa2172 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 100.0
d5mdha1154 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 100.0
d1uxja2164 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 100.0
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 100.0
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 100.0
d1t2da2165 Lactate dehydrogenase {Malaria parasite (Plasmodiu 100.0
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 99.98
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 99.98
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 99.98
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 99.98
d1ldna2168 Lactate dehydrogenase {Bacillus stearothermophilus 99.97
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 99.97
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 99.97
d1o6za2161 Malate dehydrogenase {Archaeon Haloarcula marismor 99.97
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 99.97
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 99.97
d1llca2172 Lactate dehydrogenase {Lactobacillus casei [TaxId: 99.97
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 99.97
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 99.96
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 99.96
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 99.96
d1mlda2169 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 99.96
d2cmda2167 Malate dehydrogenase {Escherichia coli [TaxId: 562 99.94
d1s6ya1169 6-phospho-beta-glucosidase {Bacillus stearothermop 99.9
d1u8xx1167 Maltose-6'-phosphate glucosidase GlvA {Bacillus su 99.89
d1obba1171 Alpha-glucosidase AglA {Thermotoga maritima [TaxId 99.88
d1up7a1162 6-phospho-beta-glucosidase {Thermotoga maritima [T 99.88
d1vjta1193 Putative alpha-glucosidase TM0752 {Thermotoga mari 99.36
d1up7a2253 6-phospho-beta-glucosidase {Thermotoga maritima [T 98.94
d1s6ya2270 6-phospho-beta-glucosidase {Bacillus stearothermop 98.85
d1u8xx2276 Maltose-6'-phosphate glucosidase GlvA {Bacillus su 98.66
d1obba2308 Alpha-glucosidase AglA {Thermotoga maritima [TaxId 98.5
d1vjta2278 Putative alpha-glucosidase TM0752 {Thermotoga mari 98.41
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 98.17
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 98.06
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 97.9
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 97.84
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 97.8
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 97.75
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 97.72
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 97.7
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 97.69
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 97.66
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 97.5
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 97.49
d1t4ba1146 Aspartate beta-semialdehyde dehydrogenase {Escheri 97.27
d1mb4a1147 Aspartate beta-semialdehyde dehydrogenase {Vibrio 97.17
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 97.11
d1dlja2196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 97.0
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 96.9
d2bkaa1232 TAT-interacting protein TIP30 {Human (Homo sapiens 96.76
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 96.75
d1r6da_322 dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces 96.71
d1udca_338 Uridine diphosphogalactose-4-epimerase (UDP-galact 96.65
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 96.55
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 96.46
d2b69a1312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 96.43
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 96.41
d2c5aa1363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 96.39
d1y1pa1342 Aldehyde reductase II {Sporobolomyces salmonicolor 96.38
d2a35a1212 Hypothetical protein PA4017 {Pseudomonas aeruginos 96.26
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 96.22
d2hjsa1144 Usg-1 protein homolog PA3116 {Pseudomonas aerugino 96.22
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 96.15
d1gy8a_383 Uridine diphosphogalactose-4-epimerase (UDP-galact 96.11
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 96.03
d2g17a1179 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 96.0
d2cvoa1183 Putative semialdehyde dehydrogenase {Rice (Oryza s 95.99
d2i76a2153 Hypothetical protein TM1727 {Thermotoga maritima [ 95.92
d2blla1342 Polymyxin resistance protein ArnA (PrmI) {Escheric 95.88
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 95.84
d1gega_255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 95.76
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 95.75
d2q46a1252 Hypothetical protein At5g02240 (T7H20_290) {Thale 95.72
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 95.7
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 95.44
d1db3a_357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 95.44
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 95.43
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 95.39
d1orra_338 CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 95.36
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 95.35
d1xhla_274 Hypothetical protein F25D1.5 {Caenorhabditis elega 95.31
d1n2sa_298 dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {S 95.29
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 95.27
d2cvza2156 Hydroxyisobutyrate dehydrogenase {Thermus thermoph 95.21
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 95.17
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 95.16
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 95.14
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 95.11
d1oc2a_346 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 95.07
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 95.05
d1xkqa_272 Hypothetical protein R05D8.7 {Caenorhabditis elega 95.03
d1k2wa_256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 95.03
d1q7ba_243 beta-keto acyl carrier protein reductase {Escheric 94.96
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 94.87
d1vkna1176 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 94.85
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 94.83
d1hdca_254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 94.82
d1i24a_393 Sulfolipid biosynthesis protein SQD1 {Thale cress 94.78
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 94.58
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 94.53
d1ydwa1184 Probable oxidoreductase At4g09670 {Thale cress (Ar 94.41
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 94.39
d1spxa_264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 94.38
d1o5ia_234 beta-keto acyl carrier protein reductase {Thermoto 94.36
d1rkxa_356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 94.32
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 94.31
d2bd0a1240 Bacterial sepiapterin reductase {Chlorobium tepidu 94.18
d1tlta1164 Virulence factor MviM {Escherichia coli [TaxId: 56 94.09
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 93.96
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 93.95
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 93.93
d2rhca1257 beta-keto acyl carrier protein reductase {Streptom 93.9
d1w6ua_294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 93.89
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 93.88
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 93.85
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 93.8
d1hxha_253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 93.78
d1xu9a_269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 93.77
d2gz1a1154 Aspartate beta-semialdehyde dehydrogenase {Strepto 93.74
d1rpna_321 GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos 93.73
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 93.65
d1z45a2347 Uridine diphosphogalactose-4-epimerase (UDP-galact 93.6
d1yxma1297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 93.57
d1diha1162 Dihydrodipicolinate reductase {Escherichia coli [T 93.46
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 93.32
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 93.31
d1x7da_340 Ornithine cyclodeaminase {Pseudomonas putida [TaxI 93.29
d1xeaa1167 Putative oxidoreductase VCA1048 {Vibrio cholerae [ 93.05
d1bdba_276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 93.01
d1h6da1221 Glucose-fructose oxidoreductase, N-terminal domain 92.86
d1oaaa_259 Sepiapterin reductase {Mouse (Mus musculus) [TaxId 92.84
d1nvmb1157 Acetaldehyde dehydrogenase (acylating) {Pseudomona 92.65
d1vm6a3128 Dihydrodipicolinate reductase {Thermotoga maritima 92.55
d1jtva_285 Human estrogenic 17beta-hydroxysteroid dehydrogena 92.55
d1ek6a_346 Uridine diphosphogalactose-4-epimerase (UDP-galact 92.48
d1gz6a_302 (3R)-hydroxyacyl-CoA dehydrogenase domain of estra 92.46
d1x1ta1260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 92.43
d1dxha2185 Ornithine transcarbamoylase {Pseudomonas aeruginos 92.42
d1e6ua_315 GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( 92.37
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 92.27
d1omoa_320 Archaeal alanine dehydrogenase {Archaeon Archaeogl 92.25
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 92.21
d1sb8a_341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 92.14
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 92.09
d2ag5a1245 Dehydrogenase/reductase SDR family member 6, DHRS6 92.06
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 92.05
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 91.88
d1gdha1191 D-glycerate dehydrogenase {Hyphomicrobium methylov 91.78
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 91.75
d1wmaa1275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 91.67
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 91.66
d2d1ya1248 Hypothetical protein TTHA0369 {Thermus thermophilu 91.39
d1eq2a_307 ADP-L-glycero-D-mannoheptose 6-epimerase {Escheric 91.35
d1ygya1184 Phosphoglycerate dehydrogenase {Mycobacterium tube 91.18
d1f06a1170 Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb 91.17
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 91.13
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 91.1
d1w5fa1194 Cell-division protein FtsZ {Thermotoga maritima [T 91.09
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 91.0
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 90.8
d1edoa_244 beta-keto acyl carrier protein reductase {Oil seed 90.78
d1n7ha_339 GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop 90.62
d1pvva2163 Ornithine transcarbamoylase {Archaeon Pyrococcus f 90.59
d1vl0a_281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 90.39
d1ooea_235 Dihydropteridin reductase (pteridine reductase) {N 90.06
d1vlva2161 Ornithine transcarbamoylase {Thermotoga maritima [ 90.05
d1zh8a1181 Hypothetical protein TM0312 {Thermotoga maritima [ 90.04
d1g0oa_272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 89.86
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 89.73
d1sbya1254 Drosophila alcohol dehydrogenase {Fly (Drosophila 89.45
d1t2aa_347 GDP-mannose 4,6-dehydratase {Human (Homo sapiens) 89.42
d1kewa_361 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 89.25
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 89.14
d1j6ua189 UDP-N-acetylmuramate-alanine ligase MurC {Thermoto 88.99
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 88.88
d1id1a_153 Rck domain from putative potassium channel Kch {Es 88.78
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 88.68
d2ew8a1247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 88.12
d2fr1a1259 Erythromycin synthase, eryAI, 1st ketoreductase mo 88.08
d1zmta1252 Halohydrin dehalogenase HheC {Agrobacterium tumefa 87.99
d1uzma1237 beta-keto acyl carrier protein reductase {Mycobact 87.86
d1rq2a1198 Cell-division protein FtsZ {Mycobacterium tubercul 87.81
d1duvg2183 Ornithine transcarbamoylase {Escherichia coli [Tax 87.72
d1dhra_236 Dihydropteridin reductase (pteridine reductase) {R 87.67
d1xgka_350 Negative transcriptional regulator NmrA {Aspergill 87.6
d1pg5a2153 Aspartate carbamoyltransferase catalytic subunit { 87.57
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 87.53
d2vapa1209 Cell-division protein FtsZ {Archaeon Methanococcus 87.27
d1sc6a1188 Phosphoglycerate dehydrogenase {Escherichia coli [ 87.18
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 87.18
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 87.09
d1r0ka2150 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Z 86.75
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 86.67
d1ja9a_259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 85.98
d2pd4a1274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 85.92
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 85.9
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 85.79
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 85.79
d1snya_248 Carbonyl reductase sniffer {Fruit fly (Drosophila 85.76
d1q0qa2151 1-deoxy-D-xylulose-5-phosphate reductoisomerase {E 85.74
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 85.15
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 84.76
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 83.89
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 83.55
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 83.28
d2o23a1248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 83.2
d2h7ma1268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 82.87
d1ulua_256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 82.72
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 81.38
d1b7go1178 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 81.09
d1leha1230 Leucine dehydrogenase {Bacillus sphaericus [TaxId: 80.79
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 80.59
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 80.57
d2d59a1139 Hypothetical protein PH1109 {Pyrococcus horikoshii 80.38
d2dw4a2 449 Lysine-specific histone demethylase 1, LSD1 {Human 80.32
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 80.32
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 80.28
>d7mdha2 d.162.1.1 (A:198-385) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: LDH C-terminal domain-like
superfamily: LDH C-terminal domain-like
family: Lactate & malate dehydrogenases, C-terminal domain
domain: Malate dehydrogenase
species: Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]

Probab=100.00  E-value=3.7e-46  Score=344.52  Aligned_cols=188  Identities=85%  Similarity=1.330  Sum_probs=180.6

Q ss_pred             ccchHHHHHHHHHHHhCCCcccceeeEEEeccCCcceeccccceecCcchhhhhhhccccHHHHHHHHHHhHHHHHHhcC
Q 013619          248 TRLDENRAKCQLALKAGVFYDKVSNMTIWGNHSTTQVPDFLNARINGLPVKEIIKDHKWLEEGFTETIQKRGGLLIKKWG  327 (439)
Q Consensus       248 t~LDs~R~~~~lA~~lgv~~~~V~~~~V~GeHGdt~Vp~~S~~~I~G~pi~~~i~~~~~~~~ei~~~v~~~~~~Ii~~kG  327 (439)
                      |+||++||+++||+++||+|++|++++||||||++|||+||+++|+|+|+.+++++..|..+++.+.+++++++|++.+|
T Consensus         1 T~LDs~R~r~~lA~~l~V~~~~V~~~iI~GeHGds~vp~~S~a~v~g~~l~~~~~~~~~~~~~~~~~v~~~~~~ii~~kg   80 (188)
T d7mdha2           1 TRLDENRAKCQLALKAGVFYDKVSNVTIWGNHSTTQVPDFLNAKIDGRPVKEVIKRTKWLEEEFTITVQKRGGALIQKWG   80 (188)
T ss_dssp             CHHHHHHHHHHHHHHTTSCGGGEECCEEEBCSSTTCEEECSSCEETTEEGGGTCCCHHHHHHHHHHHHHTHHHHHHHHTS
T ss_pred             CccHHHHHHHHHHHHHCcCHHHeeEEEEEEcCCCcEeeeeeccEeeccchhhcccchhhhHHHHHHHHhhhHHHHHHhhc
Confidence            78999999999999999999999987899999999999999999999999999988788889999999999999999999


Q ss_pred             CccHHHHHHHHHHHHHHhhcCCCCCcEEEEeeeeCCCccCCCCceEEEEEEEEcCCCceEeecCCCCCHHHHHHHHHHHH
Q 013619          328 RSSAASTAVSIVDAMKSLVTPTPEGDWFSSGVYTNGNPYGIAEDIVFSMPCRSKGDGDYELVKDVIFDDYLRKRIAKTEQ  407 (439)
Q Consensus       328 ~s~~~s~A~~i~~aI~~il~~~d~~~v~~~sv~~~G~~yGip~dv~~svPv~ig~~Gv~~iv~~~~L~~~E~~~l~~sa~  407 (439)
                      +++++++|.++++++++|+.++++..++|++|+++|++||+++|+|||+||++|++|+++++.+++|+++|+++|++|++
T Consensus        81 ~s~~~s~A~A~~~~~~ai~~~~~~~~~~s~~v~~~g~~YGi~~~v~~s~Pv~ig~~G~~~iv~~l~L~~~e~~~l~~S~~  160 (188)
T d7mdha2          81 RSSAASTAVSIADAIKSLVTPTPEGDWFSTGVYTTGNPYGIAEDIVFSMPCRSKGDGDYELATDVSNDDFLWERIKKSEA  160 (188)
T ss_dssp             SCCHHHHHHHHHHHHHHHHSCCCTTCCEEEEEECTTCSSCCCSSSEEEEEEECCSSSCCEECCCCCCCHHHHHHHHHHHH
T ss_pred             ccchhhHHHHHHHHHHHHHcCCCCCceEEEEEEeCCCccCCCCCeEEEEeeEECCCccEEEeCCCCCCHHHHHHHHHHHH
Confidence            99999999999999999998878889999999999956999999999999999999999998789999999999999999


Q ss_pred             HHHHHHHHHHHhhccCcccccCCCCCCC
Q 013619          408 ELLAEKKCVAHLTGEGIAFCDLPEDTML  435 (439)
Q Consensus       408 ~l~~~~~~v~~~~~~~~~~~~~~~~~~~  435 (439)
                      +|++++++|.||+|+....|++|+||||
T Consensus       161 eL~~e~~~v~~Llg~~~~~~~~~~~~~~  188 (188)
T d7mdha2         161 ELLAEKKCVAHLTGEGNAYCDVPEDTML  188 (188)
T ss_dssp             HHHHHHHHTHHHHTSSSCCCCCCSTTCC
T ss_pred             HHHHHHHHHHHhhccccccCCCCccccC
Confidence            9999999999999999999999999997
>d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} Back     information, alignment and structure
>d5mdha2 d.162.1.1 (A:155-333) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1b8pa2 d.162.1.1 (A:159-329) Malate dehydrogenase {Aquaspirillum arcticum [TaxId: 87645]} Back     information, alignment and structure
>d1y7ta2 d.162.1.1 (A:154-332) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1i0za2 d.162.1.1 (A:161-332) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1hyea2 d.162.1.1 (A:146-313) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1llda2 d.162.1.1 (A:150-319) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1pzga2 d.162.1.1 (A:164-334) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1y6ja2 d.162.1.1 (A:149-317) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1hyha2 d.162.1.1 (A:167-329) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1a5za2 d.162.1.1 (A:164-333) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1guza2 d.162.1.1 (A:143-305) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1ojua2 d.162.1.1 (A:164-331) Lactate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ldma2 d.162.1.1 (A:161-329) Lactate dehydrogenase {Dogfish (Squalus acanthias) [TaxId: 7797]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ez4a2 d.162.1.1 (A:163-334) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d2ldxa2 d.162.1.1 (A:160-331) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1uxja2 d.162.1.1 (A:144-307) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1t2da2 d.162.1.1 (A:151-315) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1ldna2 d.162.1.1 (A:163-330) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1o6za2 d.162.1.1 (A:163-330) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1llca2 d.162.1.1 (A:165-334) Lactate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1mlda2 d.162.1.1 (A:145-313) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2cmda2 d.162.1.1 (A:146-312) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s6ya1 c.2.1.5 (A:4-172) 6-phospho-beta-glucosidase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1u8xx1 c.2.1.5 (X:3-169) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1obba1 c.2.1.5 (A:2-172) Alpha-glucosidase AglA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1up7a1 c.2.1.5 (A:1-162) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1up7a2 d.162.1.2 (A:163-415) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1s6ya2 d.162.1.2 (A:173-445) 6-phospho-beta-glucosidase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1u8xx2 d.162.1.2 (X:170-445) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1obba2 d.162.1.2 (A:173-480) Alpha-glucosidase AglA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vjta2 d.162.1.2 (A:192-469) Putative alpha-glucosidase TM0752 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1t4ba1 c.2.1.3 (A:1-133,A:355-367) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mb4a1 c.2.1.3 (A:1-132,A:355-369) Aspartate beta-semialdehyde dehydrogenase {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2g17a1 c.2.1.3 (A:1-153,A:309-334) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2cvoa1 c.2.1.3 (A:68-218,A:384-415) Putative semialdehyde dehydrogenase {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d2i76a2 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cvza2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1vkna1 c.2.1.3 (A:1-144,A:308-339) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1tlta1 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gz1a1 c.2.1.3 (A:2-127,A:330-357) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1diha1 c.2.1.3 (A:2-130,A:241-273) Dihydrodipicolinate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1x7da_ c.2.1.13 (A:) Ornithine cyclodeaminase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1xeaa1 c.2.1.3 (A:2-122,A:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d1h6da1 c.2.1.3 (A:51-212,A:375-433) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nvmb1 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1dxha2 c.78.1.1 (A:151-335) Ornithine transcarbamoylase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1omoa_ c.2.1.13 (A:) Archaeal alanine dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1eq2a_ c.2.1.2 (A:) ADP-L-glycero-D-mannoheptose 6-epimerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1w5fa1 c.32.1.1 (A:22-215) Cell-division protein FtsZ {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1pvva2 c.78.1.1 (A:151-313) Ornithine transcarbamoylase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1vlva2 c.78.1.1 (A:153-313) Ornithine transcarbamoylase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1zh8a1 c.2.1.3 (A:4-131,A:276-328) Hypothetical protein TM0312 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1rq2a1 c.32.1.1 (A:8-205) Cell-division protein FtsZ {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1duvg2 c.78.1.1 (G:151-333) Ornithine transcarbamoylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1pg5a2 c.78.1.1 (A:147-299) Aspartate carbamoyltransferase catalytic subunit {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2vapa1 c.32.1.1 (A:23-231) Cell-division protein FtsZ {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1r0ka2 c.2.1.3 (A:3-126,A:265-290) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1q0qa2 c.2.1.3 (A:1-125,A:275-300) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2d59a1 c.2.1.8 (A:4-142) Hypothetical protein PH1109 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure