Citrus Sinensis ID: 013625

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------44
MPLTKHLSVAIIDSNPALGKSNFIKKEDPPDPRVSTVTPATISFFKEIGAWQYVQQHRHAYFDKMQVWDYTGLGYTKYNARDVNKEILGCVVENKVLHSSLLSCMQNTEFQKTIYPSRLTSMALLPSSSSISVDSTPSATTLFTKGHLAKLDLSDGTSLYAKLVVGADGGKSRVRELAGFKTTGWSYSQNAIICTVEHNKENYCAWQRFLPAGPIALLPIGDNFSNIVWTMNPKDASDCKSMNEDDFVKILNHALDYGYGPHPKSISSGSVDMFSWFRGDATLSAKECFEVPPRVVKLASERMVFPLSLKHANNYVSKRVVLIGDAAHTVHPLAGQGVNLGFGDASTLSRIIAEGIAVGADIGEASLLKKYEAERKPANIVMMAVLDGFQKAYSVDFGPLNILRAAAFHGAQYISPLKRNIISYASGEQRLPLPLPLFT
ccccccccEEEEcccccccccccccccccccccEEEccHHHHHHHHHcccHHHHHHHHcccccEEEEEccccccEEEEEcccccccccEEEEccHHHHHHHHHHHHcccccEEEEccEEEEEEEcccccccccccccccccccccccEEEEEcccccEEEEcEEEEEcccccHHHHHHcccccccccccEEEEEEEEEcccccEEEEEEcccccEEEcccccccEEEEEcccHHHHHHHHcccHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccEEEEcccccccccccccHHHHccccEEEEccccccccccHHHHHHHcHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccHHHHHHHHHHHcccccccccccccc
cccccccEEEEEEccccccccccccccccccccEEEccHHHHHHHHHccHHHHHHHHHccHHHccEEEcccccEEEEEcHHHccccHccHHHHHHHHHHHHHHHHHHccccEEEcccHHEEEEcccccccccccccccHHHHccccccEEEEEccccEEEEEEEEEcccccHHHHHHcccccEccEcccEEEEEEEEEccccccEEEEEcccccEEEEcccccccEEEEEccHHHHHHHHcccHHHHHHHHHHHccHcccccHHHHccccHHHHHHHHHccccccccccccccEEEEEccccccccccHHHHHHHHcccEEEEcccHccccccccccccccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHccccccccccccc
MPLTKHLSVAIidsnpalgksnfikkedppdprvstvtpaTISFFKEIGAWQYVQQHRHAYFDKMqvwdytglgytkynardvNKEILGCVVENKVLHSSLLScmqntefqktiypsrltsmallpssssisvdstpsattlftkghlakldlsdgtsLYAKLVVGADGGKSRVRELAGfkttgwsysQNAIICTVEHNKENYCAWqrflpagpiallpigdnfsnivwtmnpkdasdcksmneDDFVKILNHAldygygphpksissgsvdmfswfrgdatlsakecfevpprVVKLASermvfplslkhannyvsKRVVLIGDaahtvhplagqgvnlgfgdasTLSRIIAEGIAVGADIGEASLLKKYEAERKPANIVMMAVLDGFQkaysvdfgplNILRAAAFHgaqyisplkrniisyasgeqrlplplplft
MPLTKHLSVaiidsnpalgksnfikkedppdprvSTVTPATISFFKEIGAWQYVQQHRHAYFDKMQVWDYTGLGYTKYNARDVNKEILGCVVENKVLHSSLLSCMQNTEFQKTIYPSRLTSMALLPSSSSISVDSTPSATTLFTKGHLAKLDLSDGTSLYAKLvvgadggksRVRELAgfkttgwsysqNAIICTVEHNKENYCAWQRFLPAGPIALLPIGDNFSNIVWTMNPKDASDCKSMNEDDFVKILNHALDYGYGPHPKSISSGSVDMFSWFRGDATLSAKECFEVPPRVVKLASERMVFPLSLKHANNYVSKRVVLIGDAAHTVHPLAGQGVNLGFGDASTLSRIIAEGIAVGADIGEASLLKKYEAERKPANIVMMAVLDGFQKAYSVDFGPLNILRAAAFHGAQYISPLKRNIISyasgeqrlplplplft
MPLTKHLSVAIIDSNPALGKSNFIKKEDPPDPRVSTVTPATISFFKEIGAWQYVQQHRHAYFDKMQVWDYTGLGYTKYNARDVNKEILGCVVENKVLHSSLLSCMQNTEFQKTIYPSRltsmallpssssisvdstpsatTLFTKGHLAKLDLSDGTSLYAKLVVGADGGKSRVRELAGFKTTGWSYSQNAIICTVEHNKENYCAWQRFLPAGPIALLPIGDNFSNIVWTMNPKDASDCKSMNEDDFVKILNHALDYGYGPHPKSISSGSVDMFSWFRGDATLSAKECFEVPPRVVKLASERMVFPLSLKHANNYVSKRVVLIGDAAHTVHPLAGQGVNLGFGDASTLSRIIAEGIAVGADIGEASLLKKYEAERKPANIVMMAVLDGFQKAYSVDFGPLNILRAAAFHGAQYISPLKRNIISYASGEQRLPLPLPLFT
************************************VTPATISFFKEIGAWQYVQQHRHAYFDKMQVWDYTGLGYTKYNARDVNKEILGCVVENKVLHSSLLSCMQNTEFQKTIYPSRLT********************TLFTKGHLAKLDLSDGTSLYAKLVVGADGGKSRVRELAGFKTTGWSYSQNAIICTVEHNKENYCAWQRFLPAGPIALLPIGDNFSNIVWTMNPKDASDCKSMNEDDFVKILNHALDYGYGPHPKSISSGSVDMFSWFRGDATLSAKECFEVPPRVVKLASERMVFPLSLKHANNYVSKRVVLIGDAAHTVHPLAGQGVNLGFGDASTLSRIIAEGIAVGADIGEASLLKKYEAERKPANIVMMAVLDGFQKAYSVDFGPLNILRAAAFHGAQYISPLKRNIISYAS*************
*PLTKHLSVAIIDSNPAL**********PPDPRVSTVTPATISFFKEIGAWQYVQQHRHAYFDKMQVWDYTGLGYTKYNARDVNKEILGCVVENKVLHSSLLSCMQNTEFQKTIYPSRLTSMALLPSSSSISVDSTPSATTLFTKGHLAKLDLSDGTSLYAKLVVGADGGKSRVRELAGFKTTGWSYSQNAIICTVEHNKENYCAWQRFLPAGPIALLPIGDNFSNIVWTMNPKDASDCKSMNEDDFVKILNHALDYGYGPHPKSISSGSVDMFSWFRGDATLSAKECFEVPPRVVKLASERMVFPLSLKHANNYVSKRVVLIGDAAHTVHPLAGQGVNLGFGDASTLSRIIAEGIAVGADIGEASLLKKYEAERKPANIVMMAVLDGFQKAYSVDFGPLNILRAAAFHGAQYISPLKRNIISYASGEQRLPLPLPLF*
MPLTKHLSVAIIDSNPALGKSNFIKKEDPPDPRVSTVTPATISFFKEIGAWQYVQQHRHAYFDKMQVWDYTGLGYTKYNARDVNKEILGCVVENKVLHSSLLSCMQNTEFQKTIYPSRLTSMALLPS**********SATTLFTKGHLAKLDLSDGTSLYAKLVVGADGGKSRVRELAGFKTTGWSYSQNAIICTVEHNKENYCAWQRFLPAGPIALLPIGDNFSNIVWTMNPKDASDCKSMNEDDFVKILNHALDYGYGPHPKSISSGSVDMFSWFRGDATLSAKECFEVPPRVVKLASERMVFPLSLKHANNYVSKRVVLIGDAAHTVHPLAGQGVNLGFGDASTLSRIIAEGIAVGADIGEASLLKKYEAERKPANIVMMAVLDGFQKAYSVDFGPLNILRAAAFHGAQYISPLKRNIISYASGEQRLPLPLPLFT
****KHLSVAIIDSNPALGKSNFIKKEDPPDPRVSTVTPATISFFKEIGAWQYVQQHRHAYFDKMQVWDYTGLGYTKYNARDVNKEILGCVVENKVLHSSLLSCMQNTEFQKTIYPSRLTSMALLPSSSSISVDSTPSATTLFTKGHLAKLDLSDGTSLYAKLVVGADGGKSRVRELAGFKTTGWSYSQNAIICTVEHNKENYCAWQRFLPAGPIALLPIGDNFSNIVWTMNPKDASDCKSMNEDDFVKILNHALDYGYGPHPKSISSGSVDMFSWFRGDATLSAKECFEVPPRVVKLASERMVFPLSLKHANNYVSKRVVLIGDAAHTVHPLAGQGVNLGFGDASTLSRIIAEGIAVGADIGEASLLKKYEAERKPANIVMMAVLDGFQKAYSVDFGPLNILRAAAFHGAQYISPLKRNIISYASGEQRLPLPLPLFT
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPLTKHLSVAIIDSNPALGKSNFIKKEDPPDPRVSTVTPATISFFKEIGAWQYVQQHRHAYFDKMQVWDYTGLGYTKYNARDVNKEILGCVVENKVLHSSLLSCMQNTEFQKTIYPSRLTSMALLPSSSSISVDSTPSATTLFTKGHLAKLDLSDGTSLYAKLVVGADGGKSRVRELAGFKTTGWSYSQNAIICTVEHNKENYCAWQRFLPAGPIALLPIGDNFSNIVWTMNPKDASDCKSMNEDDFVKILNHALDYGYGPHPKSISSGSVDMFSWFRGDATLSAKECFEVPPRVVKLASERMVFPLSLKHANNYVSKRVVLIGDAAHTVHPLAGQGVNLGFGDASTLSRIIAEGIAVGADIGEASLLKKYEAERKPANIVMMAVLDGFQKAYSVDFGPLNILRAAAFHGAQYISPLKRNIISYASGEQRLPLPLPLFT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query439 2.2.26 [Sep-21-2011]
Q8R1S0476 Ubiquinone biosynthesis m yes no 0.856 0.789 0.367 2e-65
Q68FU7476 Ubiquinone biosynthesis m yes no 0.904 0.834 0.349 2e-64
Q9Y2Z9468 Ubiquinone biosynthesis m yes no 0.854 0.801 0.351 4e-64
Q6DF46464 Ubiquinone biosynthesis m yes no 0.854 0.808 0.346 1e-63
Q2KIL4469 Ubiquinone biosynthesis m yes no 0.856 0.801 0.36 4e-63
F1RAX8484 Ubiquinone biosynthesis m yes no 0.856 0.776 0.334 4e-62
Q54EN1495 Ubiquinone biosynthesis m yes no 0.936 0.830 0.319 7e-55
Q9VMQ5477 Putative ubiquinone biosy yes no 0.863 0.794 0.297 2e-49
O01884451 Probable ubiquinone biosy yes no 0.913 0.889 0.283 5e-48
P25535400 Protein VisC OS=Escherich N/A no 0.797 0.875 0.298 8e-48
>sp|Q8R1S0|COQ6_MOUSE Ubiquinone biosynthesis monooxygenase COQ6 OS=Mus musculus GN=Coq6 PE=2 SV=3 Back     alignment and function desciption
 Score =  250 bits (638), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 147/400 (36%), Positives = 224/400 (56%), Gaps = 24/400 (6%)

Query: 33  RVSTVTPATISFFKEIGAWQYVQQHRHAYFDKMQVWDYTGLGYTKYNARDVNKEILGCVV 92
           RVS+++P + +     GAW ++   R   F +MQVWD        ++ RD N + +G +V
Sbjct: 94  RVSSISPGSTTLLSSFGAWDHICNMRCKAFRRMQVWDSCSEALIMFD-RD-NLDDMGYIV 151

Query: 93  ENKVLHSSLLSCMQNT-EFQKTIYPSRLTSMALLPSSSSISVDSTPSATTLFTKGHLAKL 151
           EN V+  +L   ++   +  K +Y S+    +  P + S++ DS+P             +
Sbjct: 152 ENDVIMYALTKQLEAVADRVKVLYESKAVGYSW-PGAFSMA-DSSP----------WVHI 199

Query: 152 DLSDGTSLYAKLVVGADGGKSRVRELAGFKTTGWSYSQNAIICTVEHNK--ENYCAWQRF 209
            L DG++L  KL++GADG KS VR+ AG +   W Y Q+A++ T+  ++  EN  AWQRF
Sbjct: 200 TLGDGSTLQTKLLIGADGHKSGVRQAAGIQNVSWKYDQSAVVATLHLSEATENNVAWQRF 259

Query: 210 LPAGPIALLPIGDNFSNIVWTMNPKDASDCKSMNEDDFVKILNHALDYGYGPHPKSISSG 269
           LP+GPIALLP+ D  S++VW+ + + A++  SM+E++FV  +N A  +    H   + S 
Sbjct: 260 LPSGPIALLPLSDTLSSLVWSTSHEHAAELVSMDEEEFVDAINSAF-WSDVHHTDFVDSA 318

Query: 270 S--VDMFSWFRGDATLSAKECFEVPPRVVKL-ASERMVFPLSLKHANNYVSKRVVLIGDA 326
           S  V           +SA++   +PP + K+ A  R +FPL L HA  YV  RV LIGDA
Sbjct: 319 SAMVRHAVALLKPTKVSARQ---LPPSIAKVDAKSRALFPLGLGHAAEYVRPRVALIGDA 375

Query: 327 AHTVHPLAGQGVNLGFGDASTLSRIIAEGIAVGADIGEASLLKKYEAERKPANIVMMAVL 386
           AH +HPLAGQGVN+GFGD S+L   ++     G D+G  S L  YE +R+  N  ++A  
Sbjct: 376 AHRIHPLAGQGVNMGFGDISSLVHHLSTAAFNGKDLGSMSHLTGYETDRQRHNTALLAAT 435

Query: 387 DGFQKAYSVDFGPLNILRAAAFHGAQYISPLKRNIISYAS 426
           D  ++ YS    PL +LR         +SPLK  I+++AS
Sbjct: 436 DLLKRLYSTSATPLVLLRTWGLQATNAVSPLKEQIMAFAS 475

Mus musculus (taxid: 10090)
EC: 1EC: .EC: 1EC: 4EC: .EC: 1EC: 3EC: .EC: -
>sp|Q68FU7|COQ6_RAT Ubiquinone biosynthesis monooxygenase COQ6 OS=Rattus norvegicus GN=Coq6 PE=2 SV=1 Back     alignment and function description
>sp|Q9Y2Z9|COQ6_HUMAN Ubiquinone biosynthesis monooxygenase COQ6 OS=Homo sapiens GN=COQ6 PE=1 SV=2 Back     alignment and function description
>sp|Q6DF46|COQ6_XENTR Ubiquinone biosynthesis monooxygenase COQ6 OS=Xenopus tropicalis GN=coq6 PE=2 SV=1 Back     alignment and function description
>sp|Q2KIL4|COQ6_BOVIN Ubiquinone biosynthesis monooxygenase COQ6 OS=Bos taurus GN=COQ6 PE=2 SV=2 Back     alignment and function description
>sp|F1RAX8|COQ6_DANRE Ubiquinone biosynthesis monooxygenase COQ6 OS=Danio rerio GN=coq6 PE=2 SV=1 Back     alignment and function description
>sp|Q54EN1|COQ6_DICDI Ubiquinone biosynthesis monooxygenase COQ6 homolog OS=Dictyostelium discoideum GN=coq6 PE=3 SV=1 Back     alignment and function description
>sp|Q9VMQ5|COQ6_DROME Putative ubiquinone biosynthesis monooxygenase COQ6 OS=Drosophila melanogaster GN=CG7277 PE=2 SV=1 Back     alignment and function description
>sp|O01884|COQ6_CAEEL Probable ubiquinone biosynthesis monooxygenase coq-6 OS=Caenorhabditis elegans GN=coq-6 PE=3 SV=2 Back     alignment and function description
>sp|P25535|VISC_ECOLI Protein VisC OS=Escherichia coli (strain K12) GN=visC PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query439
255554178515 monoxygenase, putative [Ricinus communis 0.984 0.838 0.810 0.0
224057583447 predicted protein [Populus trichocarpa] 0.984 0.966 0.817 0.0
359494703525 PREDICTED: ubiquinone biosynthesis monoo 0.965 0.807 0.787 0.0
449524910510 PREDICTED: ubiquinone biosynthesis monoo 0.986 0.849 0.778 0.0
449457604510 PREDICTED: ubiquinone biosynthesis monoo 0.986 0.849 0.775 0.0
79313357507 ubiquinone biosynthesis monooxygenase Co 0.979 0.848 0.747 0.0
79416711505 ubiquinone biosynthesis monooxygenase Co 0.979 0.851 0.747 0.0
51968852505 monooxygenase, putatve [Arabidopsis thal 0.979 0.851 0.745 0.0
297831190505 monooxygenase [Arabidopsis lyrata subsp. 0.979 0.851 0.733 0.0
357450965514 Ubiquinone biosynthesis monooxygenase CO 0.986 0.842 0.722 0.0
>gi|255554178|ref|XP_002518129.1| monoxygenase, putative [Ricinus communis] gi|223542725|gb|EEF44262.1| monoxygenase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  741 bits (1913), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/432 (81%), Positives = 385/432 (89%)

Query: 2   PLTKHLSVAIIDSNPALGKSNFIKKEDPPDPRVSTVTPATISFFKEIGAWQYVQQHRHAY 61
           PLTKHL+VAIIDSNPALG    I +ED PDPRVSTVTPATISFFK+IGAWQYVQQHRHAY
Sbjct: 82  PLTKHLNVAIIDSNPALGSKFSINREDSPDPRVSTVTPATISFFKDIGAWQYVQQHRHAY 141

Query: 62  FDKMQVWDYTGLGYTKYNARDVNKEILGCVVENKVLHSSLLSCMQNTEFQKTIYPSRLTS 121
           FDKMQVWDYTGLGYTKY+ARD NK+ LGCVVENKVLHSSLLS +++T+FQKTIYPSRLT+
Sbjct: 142 FDKMQVWDYTGLGYTKYSARDANKDNLGCVVENKVLHSSLLSRVEDTDFQKTIYPSRLTT 201

Query: 122 MALLPSSSSISVDSTPSATTLFTKGHLAKLDLSDGTSLYAKLVVGADGGKSRVRELAGFK 181
           M+L  SSSS  VDST SA  L+ KG LAKL+LS G+SLYAKLVVGADGGKS+VRELAGFK
Sbjct: 202 MSLHQSSSSTEVDSTSSAEALYIKGRLAKLELSAGSSLYAKLVVGADGGKSQVRELAGFK 261

Query: 182 TTGWSYSQNAIICTVEHNKENYCAWQRFLPAGPIALLPIGDNFSNIVWTMNPKDASDCKS 241
           TTGW+YSQNA+ICTVEH+ EN CAWQRFLP+GPIALLPIGD FSNIVWTMNPK++SDCKS
Sbjct: 262 TTGWNYSQNAVICTVEHSVENRCAWQRFLPSGPIALLPIGDKFSNIVWTMNPKESSDCKS 321

Query: 242 MNEDDFVKILNHALDYGYGPHPKSISSGSVDMFSWFRGDATLSAKECFEVPPRVVKLASE 301
           MNEDDFVK +NHALD+GYGPHPKS      +MF+W  G++ +SA E FEVPP+VVKLAS 
Sbjct: 322 MNEDDFVKAVNHALDHGYGPHPKSSLFDGANMFTWLSGNSVVSANESFEVPPKVVKLASA 381

Query: 302 RMVFPLSLKHANNYVSKRVVLIGDAAHTVHPLAGQGVNLGFGDASTLSRIIAEGIAVGAD 361
           R+ FPLSL HA NY SKR+ LIGDAAHTVHPLAGQGVNLGFGDA  LSRIIAEGIAVG D
Sbjct: 382 RLAFPLSLMHAKNYTSKRIALIGDAAHTVHPLAGQGVNLGFGDAFALSRIIAEGIAVGTD 441

Query: 362 IGEASLLKKYEAERKPANIVMMAVLDGFQKAYSVDFGPLNILRAAAFHGAQYISPLKRNI 421
           IGE SLLKKYEAERKPAN+ MMA+LDGFQKAYSVD GPLNILRAAAFHGA +ISPLKR+I
Sbjct: 442 IGEVSLLKKYEAERKPANVTMMAILDGFQKAYSVDLGPLNILRAAAFHGAHHISPLKRSI 501

Query: 422 ISYASGEQRLPL 433
           ISYASGEQRLPL
Sbjct: 502 ISYASGEQRLPL 513

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224057583|ref|XP_002299279.1| predicted protein [Populus trichocarpa] gi|222846537|gb|EEE84084.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359494703|ref|XP_002269379.2| PREDICTED: ubiquinone biosynthesis monooxygenase COQ6-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|449524910|ref|XP_004169464.1| PREDICTED: ubiquinone biosynthesis monooxygenase COQ6-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449457604|ref|XP_004146538.1| PREDICTED: ubiquinone biosynthesis monooxygenase COQ6-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|79313357|ref|NP_001030758.1| ubiquinone biosynthesis monooxygenase Coq6 [Arabidopsis thaliana] gi|332643351|gb|AEE76872.1| ubiquinone biosynthesis monooxygenase Coq6 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|79416711|ref|NP_189062.3| ubiquinone biosynthesis monooxygenase Coq6 [Arabidopsis thaliana] gi|332643350|gb|AEE76871.1| ubiquinone biosynthesis monooxygenase Coq6 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|51968852|dbj|BAD43118.1| monooxygenase, putatve [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297831190|ref|XP_002883477.1| monooxygenase [Arabidopsis lyrata subsp. lyrata] gi|297329317|gb|EFH59736.1| monooxygenase [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|357450965|ref|XP_003595759.1| Ubiquinone biosynthesis monooxygenase COQ6 [Medicago truncatula] gi|355484807|gb|AES66010.1| Ubiquinone biosynthesis monooxygenase COQ6 [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query439
TAIR|locus:2093731507 AT3G24200 "AT3G24200" [Arabido 0.979 0.848 0.724 3.1e-170
UNIPROTKB|F1PBF7469 COQ6 "Uncharacterized protein" 0.904 0.846 0.344 5e-60
MGI|MGI:1924408476 Coq6 "coenzyme Q6 homolog (yea 0.904 0.834 0.344 3.5e-59
UNIPROTKB|Q9Y2Z9468 COQ6 "Ubiquinone biosynthesis 0.904 0.848 0.339 1.2e-58
UNIPROTKB|F1S3H4476 COQ6 "Uncharacterized protein" 0.861 0.794 0.346 1.5e-58
RGD|1311149476 Coq6 "coenzyme Q6 homolog, mon 0.904 0.834 0.341 1.9e-58
UNIPROTKB|Q2KIL4469 COQ6 "Ubiquinone biosynthesis 0.856 0.801 0.355 1.4e-57
ZFIN|ZDB-GENE-060825-297484 coq6 "coenzyme Q6 homolog, mon 0.863 0.783 0.321 2.3e-55
UNIPROTKB|F1NBR7470 COQ6 "Uncharacterized protein" 0.861 0.804 0.331 3.5e-52
UNIPROTKB|G3XA86393 COQ6 "Coenzyme Q6 homolog, mon 0.619 0.692 0.409 4.4e-52
TAIR|locus:2093731 AT3G24200 "AT3G24200" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1655 (587.6 bits), Expect = 3.1e-170, P = 3.1e-170
 Identities = 313/432 (72%), Positives = 356/432 (82%)

Query:     2 PLTKHLSVAIIDSNPALGKSNFIKKEDPPDPRVSTVTPATISFFKEIGAWQYVQQHRHAY 61
             PLTKHL+VAIID+NP LG+ N I+K   PDPRVSTVTPATISF K+IGAW+Y++Q RHAY
Sbjct:    76 PLTKHLNVAIIDNNPLLGRRNIIEKGHQPDPRVSTVTPATISFLKDIGAWKYIEQQRHAY 135

Query:    62 FDKMQVWDYTGLGYTKYNARDVNKEILGCVVENKVLHSSLLSCMQNTEFQKTIYPSRXXX 121
             FDKMQVWDYTGLGYT+YNA DV++++LGCVVENKVL SS LSC+Q ++ QKT+YP+R   
Sbjct:   136 FDKMQVWDYTGLGYTRYNANDVHQDVLGCVVENKVLQSSQLSCVQESDLQKTVYPARLNA 195

Query:   122 XXXXXXXXXXXXXXXXXXXTLFTKGHLAKLDLSDGTSLYAKLVVGADGGKSRVRELAGFK 181
                                 LF +G LAKL+LSDG  +YAKLVVGADG KSRVRELAG K
Sbjct:   196 MDMLPSSSLTGLGEVPSTTDLFMRGRLAKLELSDGNRVYAKLVVGADGSKSRVRELAGIK 255

Query:   182 TTGWSYSQNAIICTVEHNKENYCAWQRFLPAGPIALLPIGDNFSNIVWTMNPKDASDCKS 241
             TTGW+YSQNAIICTVEH  ENY AWQRFLP GPIALLPIGD FSNIVWTM+PK+ASD K 
Sbjct:   256 TTGWNYSQNAIICTVEHTAENYTAWQRFLPNGPIALLPIGDKFSNIVWTMDPKEASDRKL 315

Query:   242 MNEDDFVKILNHALDYGYGPHPKSISSGSVDMFSWFRGDATLSAKECFEVPPRVVKLASE 301
             MNEDDF+K +N ALD GYGP+P++ SS   D  SW  GDAT+SAKE FE PP+VVKL+SE
Sbjct:   316 MNEDDFIKAVNDALDSGYGPNPETTSSR--DSLSWLTGDATISAKERFETPPKVVKLSSE 373

Query:   302 RMVFPLSLKHANNYVSKRVVLIGDAAHTVHPLAGQGVNLGFGDASTLSRIIAEGIAVGAD 361
             RM+FPLSL+HA +YVSKRV L+GD+AHTVHPLAGQGVNLGF DA  LS+ IAEGIA+G D
Sbjct:   374 RMMFPLSLRHAKDYVSKRVALVGDSAHTVHPLAGQGVNLGFADACALSKAIAEGIALGTD 433

Query:   362 IGEASLLKKYEAERKPANIVMMAVLDGFQKAYSVDFGPLNILRAAAFHGAQYISPLKRNI 421
             IGEA+LLK+YEAERKPANI MMAVLDG QK YS+DFGPLN LRAAAFHGA YISPLK+ I
Sbjct:   434 IGEANLLKRYEAERKPANIAMMAVLDGIQKMYSLDFGPLNALRAAAFHGAHYISPLKKRI 493

Query:   422 ISYASGEQRLPL 433
             ISYASGEQ LPL
Sbjct:   494 ISYASGEQSLPL 505
GO:0004497 "monooxygenase activity" evidence=ISS
GO:0005739 "mitochondrion" evidence=ISM
GO:0006744 "ubiquinone biosynthetic process" evidence=IEA
GO:0008152 "metabolic process" evidence=IEA
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0016709 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen" evidence=IEA
GO:0050660 "flavin adenine dinucleotide binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0019243 "methylglyoxal catabolic process to D-lactate" evidence=RCA
UNIPROTKB|F1PBF7 COQ6 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:1924408 Coq6 "coenzyme Q6 homolog (yeast)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q9Y2Z9 COQ6 "Ubiquinone biosynthesis monooxygenase COQ6" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1S3H4 COQ6 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|1311149 Coq6 "coenzyme Q6 homolog, monooxygenase (S. cerevisiae)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q2KIL4 COQ6 "Ubiquinone biosynthesis monooxygenase COQ6" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060825-297 coq6 "coenzyme Q6 homolog, monooxygenase (S. cerevisiae)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1NBR7 COQ6 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|G3XA86 COQ6 "Coenzyme Q6 homolog, monooxygenase (Yeast), isoform CRA_a" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q68FU7COQ6_RAT1, ., 1, 4, ., 1, 3, ., -0.34900.90430.8340yesno
Q2KIL4COQ6_BOVIN1, ., 1, 4, ., 1, 3, ., -0.360.85640.8017yesno
Q9Y2Z9COQ6_HUMAN1, ., 1, 4, ., 1, 3, ., -0.35160.85420.8012yesno
Q6DF46COQ6_XENTR1, ., 1, 4, ., 1, 3, ., -0.34660.85420.8081yesno
Q54EN1COQ6_DICDI1, ., 1, 4, ., 1, 3, ., -0.31910.93620.8303yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.14.130.691

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query439
TIGR01989437 TIGR01989, COQ6, ubiquinone biosynthesis monooxyge 1e-157
TIGR01988387 TIGR01988, Ubi-OHases, Ubiquinone biosynthesis hyd 1e-132
PRK05714405 PRK05714, PRK05714, 2-octaprenyl-3-methyl-6-methox 3e-70
PRK08850405 PRK08850, PRK08850, 2-octaprenyl-6-methoxyphenol h 1e-68
TIGR01984382 TIGR01984, UbiH, 2-polyprenyl-6-methoxyphenol 4-hy 3e-68
COG0654387 COG0654, UbiH, 2-polyprenyl-6-methoxyphenol hydrox 8e-68
PRK08020391 PRK08020, ubiF, 2-octaprenyl-3-methyl-6-methoxy-1, 3e-67
PRK07364415 PRK07364, PRK07364, 2-octaprenyl-6-methoxyphenyl h 4e-64
PRK07333403 PRK07333, PRK07333, 2-octaprenyl-6-methoxyphenyl h 2e-63
PRK08849384 PRK08849, PRK08849, 2-octaprenyl-3-methyl-6-methox 8e-61
PRK07608388 PRK07608, PRK07608, ubiquinone biosynthesis hydrox 6e-59
PRK08773392 PRK08773, PRK08773, 2-octaprenyl-3-methyl-6-methox 1e-58
PRK08013400 PRK08013, PRK08013, oxidoreductase; Provisional 2e-56
PRK05732395 PRK05732, PRK05732, 2-octaprenyl-6-methoxyphenyl h 2e-51
PRK07494388 PRK07494, PRK07494, 2-octaprenyl-6-methoxyphenyl h 3e-38
PRK09126392 PRK09126, PRK09126, hypothetical protein; Provisio 4e-38
PRK06617374 PRK06617, PRK06617, 2-octaprenyl-6-methoxyphenyl h 1e-27
PRK06996398 PRK06996, PRK06996, hypothetical protein; Provisio 6e-27
pfam01494349 pfam01494, FAD_binding_3, FAD binding domain 1e-15
PRK06834 488 PRK06834, PRK06834, hypothetical protein; Provisio 2e-15
PRK06126 545 PRK06126, PRK06126, hypothetical protein; Provisio 2e-13
PRK06184 502 PRK06184, PRK06184, hypothetical protein; Provisio 1e-10
PRK07045388 PRK07045, PRK07045, putative monooxygenase; Review 2e-10
PRK06183500 PRK06183, mhpA, 3-(3-hydroxyphenyl)propionate hydr 3e-09
PRK06185407 PRK06185, PRK06185, hypothetical protein; Provisio 3e-08
COG0644396 COG0644, FixC, Dehydrogenases (flavoproteins) [Ene 1e-07
PRK08255 765 PRK08255, PRK08255, salicylyl-CoA 5-hydroxylase; R 3e-07
TIGR03219414 TIGR03219, salicylate_mono, salicylate 1-monooxyge 6e-07
PRK08244 493 PRK08244, PRK08244, hypothetical protein; Provisio 9e-07
PRK07236386 PRK07236, PRK07236, hypothetical protein; Provisio 4e-06
PRK07538413 PRK07538, PRK07538, hypothetical protein; Provisio 1e-05
PRK07190487 PRK07190, PRK07190, hypothetical protein; Provisio 3e-05
PTZ00367 567 PTZ00367, PTZ00367, squalene epoxidase; Provisiona 1e-04
PRK06475400 PRK06475, PRK06475, salicylate hydroxylase; Provis 1e-04
TIGR02023388 TIGR02023, BchP-ChlP, geranylgeranyl reductase 2e-04
TIGR02028398 TIGR02028, ChlP, geranylgeranyl reductase 5e-04
PRK06753373 PRK06753, PRK06753, hypothetical protein; Provisio 5e-04
PRK06847375 PRK06847, PRK06847, hypothetical protein; Provisio 5e-04
PRK08294 634 PRK08294, PRK08294, phenol 2-monooxygenase; Provis 6e-04
PRK08243392 PRK08243, PRK08243, 4-hydroxybenzoate 3-monooxygen 0.001
PRK06185407 PRK06185, PRK06185, hypothetical protein; Provisio 0.002
pfam08491276 pfam08491, SE, Squalene epoxidase 0.003
PLN02927 668 PLN02927, PLN02927, antheraxanthin epoxidase/zeaxa 0.003
>gnl|CDD|233672 TIGR01989, COQ6, ubiquinone biosynthesis monooxygenase COQ6 Back     alignment and domain information 
 Score =  451 bits (1162), Expect = e-157
 Identities = 190/430 (44%), Positives = 263/430 (61%), Gaps = 22/430 (5%)

Query: 1   MPLTKHLSVAIIDS--NPALGKSNFIKKEDPPDPRVSTVTPATISFFKEIGAWQYVQQHR 58
            PLTK L V ++D+  NP L   N+ K + P   RVS++TPA+ISFFK+IGAW ++Q  R
Sbjct: 22  NPLTKDLKVLLLDAVDNPKLKSRNYEKPDGPYSNRVSSITPASISFFKKIGAWDHIQSDR 81

Query: 59  HAYFDKMQVWDYTGLGYTKYNARDVNKEILGCVVENKVLHSSLLSCMQ--NTEFQKTIYP 116
              F +MQVWD   L   ++  RD  KE + C++EN  + +SL + +Q  N +  K + P
Sbjct: 82  IQPFGRMQVWDGCSLALIRF-DRDNGKEDMACIIENDNIQNSLYNRLQEYNGDNVKILNP 140

Query: 117 SRLTSMALLPSSSSISVDSTPSATTLFTKGHLAKLDLSDGTSLYAKLVVGADGGKSRVRE 176
           +RL S+ + PS       +               + LSDG  LY KL++GADG  S VR+
Sbjct: 141 ARLISVTI-PSKYPNDNSN------------WVHITLSDGQVLYTKLLIGADGSNSNVRK 187

Query: 177 LAGFKTTGWSYSQNAIICTVEH--NKENYCAWQRFLPAGPIALLPIGDNFSNIVWTMNPK 234
            A   TTGW+Y+Q+A++ T++     EN  AWQRFLP GPIALLP+ DN S +VW+ +P+
Sbjct: 188 AANIDTTGWNYNQHAVVATLKLEEATENDVAWQRFLPTGPIALLPLPDNNSTLVWSTSPE 247

Query: 235 DASDCKSMNEDDFVKILNHALDYGYGPHPKSISSG-SVDMFSWFRGDATLSAKECFEVPP 293
           +A    S+  +DFV  LN A D GY  HP S     +++  +   G  T  +K CF+VPP
Sbjct: 248 EALRLLSLPPEDFVDALNAAFDLGYSDHPYSYLLDYAMEKLNEDIGFRTEGSKSCFQVPP 307

Query: 294 RVVKLASE-RMVFPLSLKHANNYVSKRVVLIGDAAHTVHPLAGQGVNLGFGDASTLSRII 352
           RV+ +  + R  FPL L HA+ YV+KRV L+GDAAH VHPLAGQGVNLGFGD ++L + +
Sbjct: 308 RVIGVVDKSRAAFPLGLGHADEYVTKRVALVGDAAHRVHPLAGQGVNLGFGDVASLVKAL 367

Query: 353 AEGIAVGADIGEASLLKKYEAERKPANIVMMAVLDGFQKAYSVDFGPLNILRAAAFHGAQ 412
           AE ++VGADIG  S LK YE ER   N+V++ ++D   K Y+ DF P+  LR    +   
Sbjct: 368 AEAVSVGADIGSISSLKPYERERYAKNVVLLGLVDKLHKLYATDFPPVVALRTFGLNLTN 427

Query: 413 YISPLKRNII 422
           YI PLK  I+
Sbjct: 428 YIGPLKNFIM 437

This model represents the monooxygenase responsible for the 4-hydroxylateion of the phenol ring in the aerobic biosynthesis of ubiquinone. Length = 437
>gnl|CDD|233671 TIGR01988, Ubi-OHases, Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>gnl|CDD|168201 PRK05714, PRK05714, 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>gnl|CDD|236341 PRK08850, PRK08850, 2-octaprenyl-6-methoxyphenol hydroxylase; Validated Back     alignment and domain information
>gnl|CDD|233669 TIGR01984, UbiH, 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>gnl|CDD|223727 COG0654, UbiH, 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>gnl|CDD|181199 PRK08020, ubiF, 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed Back     alignment and domain information
>gnl|CDD|236001 PRK07364, PRK07364, 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>gnl|CDD|180935 PRK07333, PRK07333, 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>gnl|CDD|181564 PRK08849, PRK08849, 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>gnl|CDD|181057 PRK07608, PRK07608, ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>gnl|CDD|181552 PRK08773, PRK08773, 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>gnl|CDD|236139 PRK08013, PRK08013, oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|235584 PRK05732, PRK05732, 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>gnl|CDD|181001 PRK07494, PRK07494, 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>gnl|CDD|236385 PRK09126, PRK09126, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|168629 PRK06617, PRK06617, 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>gnl|CDD|235905 PRK06996, PRK06996, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|216530 pfam01494, FAD_binding_3, FAD binding domain Back     alignment and domain information
>gnl|CDD|235870 PRK06834, PRK06834, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|235704 PRK06126, PRK06126, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|235728 PRK06184, PRK06184, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|136171 PRK07045, PRK07045, putative monooxygenase; Reviewed Back     alignment and domain information
>gnl|CDD|235727 PRK06183, mhpA, 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>gnl|CDD|235729 PRK06185, PRK06185, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|223717 COG0644, FixC, Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|236203 PRK08255, PRK08255, salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>gnl|CDD|132263 TIGR03219, salicylate_mono, salicylate 1-monooxygenase Back     alignment and domain information
>gnl|CDD|236199 PRK08244, PRK08244, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|235980 PRK07236, PRK07236, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|236046 PRK07538, PRK07538, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|235955 PRK07190, PRK07190, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|240384 PTZ00367, PTZ00367, squalene epoxidase; Provisional Back     alignment and domain information
>gnl|CDD|180582 PRK06475, PRK06475, salicylate hydroxylase; Provisional Back     alignment and domain information
>gnl|CDD|233689 TIGR02023, BchP-ChlP, geranylgeranyl reductase Back     alignment and domain information
>gnl|CDD|131083 TIGR02028, ChlP, geranylgeranyl reductase Back     alignment and domain information
>gnl|CDD|168661 PRK06753, PRK06753, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|235874 PRK06847, PRK06847, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|236223 PRK08294, PRK08294, phenol 2-monooxygenase; Provisional Back     alignment and domain information
>gnl|CDD|236198 PRK08243, PRK08243, 4-hydroxybenzoate 3-monooxygenase; Validated Back     alignment and domain information
>gnl|CDD|235729 PRK06185, PRK06185, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|219864 pfam08491, SE, Squalene epoxidase Back     alignment and domain information
>gnl|CDD|178515 PLN02927, PLN02927, antheraxanthin epoxidase/zeaxanthin epoxidase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 439
PRK08013400 oxidoreductase; Provisional 100.0
PRK08850405 2-octaprenyl-6-methoxyphenol hydroxylase; Validate 100.0
PRK06617374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 100.0
PRK05714405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 100.0
TIGR01989437 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T 100.0
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 100.0
COG0654387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and 100.0
PRK07364415 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 100.0
PRK08849384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 100.0
PRK07333403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 100.0
PRK08020391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin 100.0
PRK09126392 hypothetical protein; Provisional 100.0
TIGR01988385 Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub 100.0
PRK07494388 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 100.0
PRK06996398 hypothetical protein; Provisional 100.0
TIGR01984382 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T 100.0
PRK05732395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 100.0
PRK07608388 ubiquinone biosynthesis hydroxylase family protein 100.0
PRK06185407 hypothetical protein; Provisional 100.0
PRK06183 538 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va 100.0
PRK07588391 hypothetical protein; Provisional 100.0
PRK08244 493 hypothetical protein; Provisional 100.0
PRK06834 488 hypothetical protein; Provisional 100.0
PRK06753373 hypothetical protein; Provisional 100.0
PRK08243392 4-hydroxybenzoate 3-monooxygenase; Validated 100.0
PRK07045388 putative monooxygenase; Reviewed 100.0
PRK06475400 salicylate hydroxylase; Provisional 100.0
PRK08132 547 FAD-dependent oxidoreductase; Provisional 100.0
PRK06184 502 hypothetical protein; Provisional 100.0
PRK05868372 hypothetical protein; Validated 100.0
PRK08294 634 phenol 2-monooxygenase; Provisional 100.0
PRK06847375 hypothetical protein; Provisional 100.0
PRK07190 487 hypothetical protein; Provisional 100.0
PRK08163396 salicylate hydroxylase; Provisional 100.0
PLN02985514 squalene monooxygenase 100.0
PRK07538413 hypothetical protein; Provisional 100.0
TIGR02360390 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase. 100.0
TIGR03219414 salicylate_mono salicylate 1-monooxygenase. Member 100.0
PTZ00367 567 squalene epoxidase; Provisional 100.0
KOG3855481 consensus Monooxygenase involved in coenzyme Q (ub 100.0
PRK06126 545 hypothetical protein; Provisional 100.0
PRK07236386 hypothetical protein; Provisional 100.0
PF01494356 FAD_binding_3: FAD binding domain; InterPro: IPR00 100.0
PLN02927 668 antheraxanthin epoxidase/zeaxanthin epoxidase 100.0
KOG2614420 consensus Kynurenine 3-monooxygenase and related f 100.0
PLN00093450 geranylgeranyl diphosphate reductase; Provisional 99.97
TIGR02023388 BchP-ChlP geranylgeranyl reductase. This model rep 99.97
TIGR02028398 ChlP geranylgeranyl reductase. This model represen 99.96
PRK08255 765 salicylyl-CoA 5-hydroxylase; Reviewed 99.95
PRK11445351 putative oxidoreductase; Provisional 99.95
TIGR02032295 GG-red-SF geranylgeranyl reductase family. This mo 99.94
COG0644396 FixC Dehydrogenases (flavoproteins) [Energy produc 99.92
KOG1298509 consensus Squalene monooxygenase [Lipid transport 99.92
PRK10015429 oxidoreductase; Provisional 99.91
PRK10157428 putative oxidoreductase FixC; Provisional 99.89
TIGR01790388 carotene-cycl lycopene cyclase family protein. Thi 99.85
PF04820454 Trp_halogenase: Tryptophan halogenase; InterPro: I 99.85
PF08491276 SE: Squalene epoxidase; InterPro: IPR013698 This d 99.85
PLN02697529 lycopene epsilon cyclase 99.77
PLN02463447 lycopene beta cyclase 99.75
TIGR01789370 lycopene_cycl lycopene cyclase. This model represe 99.66
PF05834374 Lycopene_cycl: Lycopene cyclase protein; InterPro: 99.52
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 98.17
TIGR00292254 thiazole biosynthesis enzyme. This enzyme is invol 98.08
KOG2415 621 consensus Electron transfer flavoprotein ubiquinon 98.06
TIGR02352337 thiamin_ThiO glycine oxidase ThiO. This family con 97.71
TIGR01377380 soxA_mon sarcosine oxidase, monomeric form. Sarcos 97.52
TIGR01373407 soxB sarcosine oxidase, beta subunit family, heter 97.34
PF01266358 DAO: FAD dependent oxidoreductase; InterPro: IPR00 97.28
COG2081408 Predicted flavoproteins [General function predicti 97.28
PRK12409410 D-amino acid dehydrogenase small subunit; Provisio 97.14
PRK11728393 hydroxyglutarate oxidase; Provisional 97.12
PRK12416463 protoporphyrinogen oxidase; Provisional 97.1
TIGR00275400 flavoprotein, HI0933 family. The model when search 97.08
PRK01747662 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans 96.99
PRK00711416 D-amino acid dehydrogenase small subunit; Validate 96.67
PRK05192 618 tRNA uridine 5-carboxymethylaminomethyl modificati 96.64
TIGR03862376 flavo_PP4765 uncharacterized flavoprotein, PP_4765 96.62
PRK13369502 glycerol-3-phosphate dehydrogenase; Provisional 96.61
TIGR00562462 proto_IX_ox protoporphyrinogen oxidase. This prote 96.59
TIGR02730493 carot_isom carotene isomerase. Members of this fam 96.58
PLN02612567 phytoene desaturase 96.51
PRK11259376 solA N-methyltryptophan oxidase; Provisional 96.49
PF03486409 HI0933_like: HI0933-like protein; InterPro: IPR004 96.46
PRK12266508 glpD glycerol-3-phosphate dehydrogenase; Reviewed 96.43
PRK11883451 protoporphyrinogen oxidase; Reviewed 96.4
PRK07233434 hypothetical protein; Provisional 96.21
PLN02676487 polyamine oxidase 96.2
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 96.14
PF01946230 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K. 96.13
PRK05257494 malate:quinone oxidoreductase; Validated 96.01
COG3380331 Predicted NAD/FAD-dependent oxidoreductase [Genera 95.99
PF01134392 GIDA: Glucose inhibited division protein A; InterP 95.83
PF01593450 Amino_oxidase: Flavin containing amine oxidoreduct 95.81
TIGR03467419 HpnE squalene-associated FAD-dependent desaturase. 95.71
PLN02568539 polyamine oxidase 95.53
PF12831428 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3 95.4
PLN02976 1713 amine oxidase 95.29
TIGR03197381 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouri 95.25
COG1635262 THI4 Ribulose 1,5-bisphosphate synthetase, convert 95.23
COG0579429 Predicted dehydrogenase [General function predicti 95.11
PLN02268435 probable polyamine oxidase 95.1
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 94.84
TIGR01320483 mal_quin_oxido malate:quinone-oxidoreductase. This 94.83
PRK13339497 malate:quinone oxidoreductase; Reviewed 94.83
PLN02464627 glycerol-3-phosphate dehydrogenase 94.81
TIGR02485432 CobZ_N-term precorrin 3B synthase CobZ. CobZ is es 94.53
TIGR00136 617 gidA glucose-inhibited division protein A. GidA, t 94.5
PTZ00383497 malate:quinone oxidoreductase; Provisional 94.11
KOG2820399 consensus FAD-dependent oxidoreductase [General fu 94.06
PLN02576496 protoporphyrinogen oxidase 93.81
COG2509486 Uncharacterized FAD-dependent dehydrogenases [Gene 93.56
PLN02661357 Putative thiazole synthesis 93.55
COG0578532 GlpA Glycerol-3-phosphate dehydrogenase [Energy pr 93.46
PRK05335436 tRNA (uracil-5-)-methyltransferase Gid; Reviewed 93.27
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 93.25
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 93.02
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 92.86
TIGR03329460 Phn_aa_oxid putative aminophosphonate oxidoreducta 92.42
PRK06116450 glutathione reductase; Validated 92.29
COG0665387 DadA Glycine/D-amino acid oxidases (deaminating) [ 92.07
TIGR03378419 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase 91.8
PRK09231 582 fumarate reductase flavoprotein subunit; Validated 91.17
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 91.05
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 90.88
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 90.68
PLN03000 881 amine oxidase 90.67
PLN02328808 lysine-specific histone demethylase 1 homolog 90.41
PRK07845466 flavoprotein disulfide reductase; Reviewed 90.14
PLN02507499 glutathione reductase 90.08
TIGR02734502 crtI_fam phytoene desaturase. Phytoene is converte 90.05
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 89.46
TIGR00551488 nadB L-aspartate oxidase. L-aspartate oxidase is t 89.34
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 89.13
PRK09897 534 hypothetical protein; Provisional 89.11
PRK07804541 L-aspartate oxidase; Provisional 88.97
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 88.68
COG1233487 Phytoene dehydrogenase and related proteins [Secon 88.6
COG1251 793 NirB NAD(P)H-nitrite reductase [Energy production 88.51
PRK11101546 glpA sn-glycerol-3-phosphate dehydrogenase subunit 88.43
TIGR02732474 zeta_caro_desat carotene 7,8-desaturase. Carotene 87.98
TIGR03364365 HpnW_proposed FAD dependent oxidoreductase TIGR033 87.98
PLN02172461 flavin-containing monooxygenase FMO GS-OX 87.78
PLN02529738 lysine-specific histone demethylase 1 87.57
TIGR03377516 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase 87.5
TIGR01176 580 fum_red_Fp fumarate reductase, flavoprotein subuni 87.49
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 87.41
PF06039488 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro 87.31
PTZ00363443 rab-GDP dissociation inhibitor; Provisional 87.19
COG1232444 HemY Protoporphyrinogen oxidase [Coenzyme metaboli 87.02
KOG1346659 consensus Programmed cell death 8 (apoptosis-induc 86.61
TIGR01812 566 sdhA_frdA_Gneg succinate dehydrogenase or fumarate 86.3
PRK07818466 dihydrolipoamide dehydrogenase; Reviewed 86.06
TIGR01813439 flavo_cyto_c flavocytochrome c. This model describ 85.96
TIGR01423486 trypano_reduc trypanothione-disulfide reductase. T 85.76
PTZ00052499 thioredoxin reductase; Provisional 85.63
TIGR03385427 CoA_CoA_reduc CoA-disulfide reductase. Members of 85.13
PF13454156 NAD_binding_9: FAD-NAD(P)-binding 85.13
PTZ00318424 NADH dehydrogenase-like protein; Provisional 85.01
PRK06327475 dihydrolipoamide dehydrogenase; Validated 84.42
PLN02487569 zeta-carotene desaturase 84.4
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 84.28
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Prov 83.8
PRK14989 847 nitrite reductase subunit NirD; Provisional 83.57
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 83.22
PRK07846451 mycothione reductase; Reviewed 83.19
PRK13512438 coenzyme A disulfide reductase; Provisional 83.04
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 82.5
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 82.19
TIGR00137433 gid_trmFO tRNA:m(5)U-54 methyltransferase. This mo 82.17
PRK09564444 coenzyme A disulfide reductase; Reviewed 82.0
PRK14694468 putative mercuric reductase; Provisional 81.92
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 81.89
KOG1399448 consensus Flavin-containing monooxygenase [Seconda 81.79
PRK06370463 mercuric reductase; Validated 81.17
KOG2853509 consensus Possible oxidoreductase [General functio 81.16
PRK05329422 anaerobic glycerol-3-phosphate dehydrogenase subun 80.57
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a 80.36
TIGR01438484 TGR thioredoxin and glutathione reductase selenopr 80.25
COG2072443 TrkA Predicted flavoprotein involved in K+ transpo 80.03
>PRK08013 oxidoreductase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=1.5e-49  Score=392.49  Aligned_cols=372  Identities=33%  Similarity=0.563  Sum_probs=298.6

Q ss_pred             CCCcEEEEEcCCCCCCCCCCCCCCCCCCCcEEeeCHhHHHHHHHCCCchhhhhhhcCccceEEEEeCCCcceeEEeccCC
Q 013625            4 TKHLSVAIIDSNPALGKSNFIKKEDPPDPRVSTVTPATISFFKEIGAWQYVQQHRHAYFDKMQVWDYTGLGYTKYNARDV   83 (439)
Q Consensus         4 ~~G~~V~viE~~~~~~~~~~~~~~~~~~~~~~~l~p~~~~~L~~lGl~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   83 (439)
                      .+|++|+||||.+.+....    ......++..|+|+++++|+++|+++++.+.+..++.++.+|+.+......+.....
T Consensus        24 ~~G~~v~viE~~~~~~~~~----g~~~~~r~~~l~~~s~~~L~~lGl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   99 (400)
T PRK08013         24 GSGLRVAVLEQRVPEPLAA----DAPPALRVSAINAASEKLLTRLGVWQDILARRASCYHGMEVWDKDSFGRIAFDDQSM   99 (400)
T ss_pred             hCCCEEEEEeCCCCccccc----CCCCCceeeecchhHHHHHHHcCCchhhhhhcCccccEEEEEeCCCCceEEEccccc
Confidence            4699999999999863211    112346788999999999999999999988765577889899876433444443333


Q ss_pred             CCccceeeeehHHHHHHHHHHhhcCCCcEEEcCCeeEEeeeCCCCCCcccCCCCCcccccccCceeEEEeCCCcEEEecE
Q 013625           84 NKEILGCVVENKVLHSSLLSCMQNTEFQKTIYPSRLTSMALLPSSSSISVDSTPSATTLFTKGHLAKLDLSDGTSLYAKL  163 (439)
Q Consensus        84 ~~~~~~~~i~R~~l~~~L~~~~~~~~~v~v~~~~~v~~i~~~~~~~~~~~~~~~~~~~~~~~~~~v~v~~~dg~~~~adl  163 (439)
                      ..++.++.++|..|+++|.+.+.+.++++++++++|++++.                    +++.++|++.+|++++||+
T Consensus       100 ~~~~~~~~i~r~~l~~~L~~~~~~~~~v~i~~~~~v~~i~~--------------------~~~~v~v~~~~g~~i~a~l  159 (400)
T PRK08013        100 GYSHLGHIIENSVIHYALWQKAQQSSDITLLAPAELQQVAW--------------------GENEAFLTLKDGSMLTARL  159 (400)
T ss_pred             CCCccEEEEEhHHHHHHHHHHHhcCCCcEEEcCCeeEEEEe--------------------cCCeEEEEEcCCCEEEeeE
Confidence            33445789999999999999999876799999999999977                    4467889999999999999


Q ss_pred             EEEecCCCchhhhhhCCCCCCCcCCCeEEEEEEEeecCC-ceeEEEEecCCceEEeecCCCc-eEEEEEcCccChhHhhC
Q 013625          164 VVGADGGKSRVRELAGFKTTGWSYSQNAIICTVEHNKEN-YCAWQRFLPAGPIALLPIGDNF-SNIVWTMNPKDASDCKS  241 (439)
Q Consensus       164 vVgADG~~S~vR~~l~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~g~~~~~p~~~~~-~~~~~~~~~~~~~~~~~  241 (439)
                      ||||||.+|.||+.+++......+...++.+.++.+.++ ...++.|.++++++++|+.++. .+++|..+.........
T Consensus       160 vVgADG~~S~vR~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~~~~~g~~~~~p~~~~~~~~~~~~~~~~~~~~~~~  239 (400)
T PRK08013        160 VVGADGANSWLRNKADIPLTFWDYQHHALVATIRTEEPHDAVARQVFHGDGILAFLPLSDPHLCSIVWSLSPEEAQRMQQ  239 (400)
T ss_pred             EEEeCCCCcHHHHHcCCCccccccCcEEEEEEEeccCCCCCEEEEEEcCCCCEEEEECCCCCeEEEEEEcCHHHHHHHHc
Confidence            999999999999999998888788888888887765544 4556777888999999997754 57888876654444444


Q ss_pred             CCHHHHHHHHHHhccCCCCCCCCCCCCCcccchhccccCccccccccccCCcceeeecccceeeecccccccccccCCEE
Q 013625          242 MNEDDFVKILNHALDYGYGPHPKSISSGSVDMFSWFRGDATLSAKECFEVPPRVVKLASERMVFPLSLKHANNYVSKRVV  321 (439)
Q Consensus       242 ~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~rvv  321 (439)
                      ...+.+.+.+...+.    +.               ++               ..........||+....+++|++|||+
T Consensus       240 ~~~~~~~~~l~~~~~----~~---------------l~---------------~~~~~~~~~~~~l~~~~~~~~~~grv~  285 (400)
T PRK08013        240 APEEEFNRALAIAFD----NR---------------LG---------------LCELESERQVFPLTGRYARQFAAHRLA  285 (400)
T ss_pred             CCHHHHHHHHHHHHh----Hh---------------hC---------------ceEecCCccEEecceeecccccCCcEE
Confidence            566677776665332    00               00               011222234578887789999999999


Q ss_pred             EEcccccccCCcccccchhcHHHHHHHHHHHHHhhhcCCCCChHHHHHHHHHhhchhhHHHHHHHHHHHHhhcCCCChHH
Q 013625          322 LIGDAAHTVHPLAGQGVNLGFGDASTLSRIIAEGIAVGADIGEASLLKKYEAERKPANIVMMAVLDGFQKAYSVDFGPLN  401 (439)
Q Consensus       322 LvGDAAh~~~P~~g~G~~~al~da~~La~~L~~~~~~~~~~~~~~~l~~Ye~~r~~~~~~~~~~~~~~~~~~~~~~~~~~  401 (439)
                      |+|||||.|+|++|||+|+||+||..|+++|...+..+.++....+|+.|+++|+++...++..++.+.+++...+++..
T Consensus       286 LiGDAAH~~~P~~GQG~n~gi~Da~~La~~L~~~~~~~~~~~~~~~L~~Y~~~R~~~~~~~~~~~~~~~~l~~~~~~~~~  365 (400)
T PRK08013        286 LVGDAAHTIHPLAGQGVNLGFMDAAELIAELRRLHRQGKDIGQHLYLRRYERSRKHSAALMLAGMQGFRDLFAGNNPAKK  365 (400)
T ss_pred             EEechhhcCCccccCchhhhHHHHHHHHHHHHHHHhcCCCcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcCCchHHH
Confidence            99999999999999999999999999999999876555444345689999999999999999999999999999999999


Q ss_pred             HHHHHHHHhhccChhHHHHHHHHHhcCCCCCC
Q 013625          402 ILRAAAFHGAQYISPLKRNIISYASGEQRLPL  433 (439)
Q Consensus       402 ~~r~~~~~~~~~~~~l~~~~~~~~~g~~~~p~  433 (439)
                      .+|+..++++.++|++++.+++.++|+..+|.
T Consensus       366 ~~R~~~l~~~~~~~~~~~~~~~~~~g~~~~~~  397 (400)
T PRK08013        366 LLRDIGLKLADTLPGVKPQLIRQAMGLNDLPE  397 (400)
T ss_pred             HHHHHHHHHHhhCHHHHHHHHHHHccCcCCcc
Confidence            99999999999999999999999999765664

>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated Back     alignment and domain information
>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6 Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK06996 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>PRK06185 hypothetical protein; Provisional Back     alignment and domain information
>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>PRK07588 hypothetical protein; Provisional Back     alignment and domain information
>PRK08244 hypothetical protein; Provisional Back     alignment and domain information
>PRK06834 hypothetical protein; Provisional Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated Back     alignment and domain information
>PRK07045 putative monooxygenase; Reviewed Back     alignment and domain information
>PRK06475 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK08132 FAD-dependent oxidoreductase; Provisional Back     alignment and domain information
>PRK06184 hypothetical protein; Provisional Back     alignment and domain information
>PRK05868 hypothetical protein; Validated Back     alignment and domain information
>PRK08294 phenol 2-monooxygenase; Provisional Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>PRK07190 hypothetical protein; Provisional Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>PLN02985 squalene monooxygenase Back     alignment and domain information
>PRK07538 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase Back     alignment and domain information
>TIGR03219 salicylate_mono salicylate 1-monooxygenase Back     alignment and domain information
>PTZ00367 squalene epoxidase; Provisional Back     alignment and domain information
>KOG3855 consensus Monooxygenase involved in coenzyme Q (ubiquinone) biosynthesis [Coenzyme transport and metabolism; Energy production and conversion] Back     alignment and domain information
>PRK06126 hypothetical protein; Provisional Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways Back     alignment and domain information
>PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase Back     alignment and domain information
>KOG2614 consensus Kynurenine 3-monooxygenase and related flavoprotein monooxygenases [Energy production and conversion; General function prediction only] Back     alignment and domain information
>PLN00093 geranylgeranyl diphosphate reductase; Provisional Back     alignment and domain information
>TIGR02023 BchP-ChlP geranylgeranyl reductase Back     alignment and domain information
>TIGR02028 ChlP geranylgeranyl reductase Back     alignment and domain information
>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>PRK11445 putative oxidoreductase; Provisional Back     alignment and domain information
>TIGR02032 GG-red-SF geranylgeranyl reductase family Back     alignment and domain information
>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>KOG1298 consensus Squalene monooxygenase [Lipid transport and metabolism] Back     alignment and domain information
>PRK10015 oxidoreductase; Provisional Back     alignment and domain information
>PRK10157 putative oxidoreductase FixC; Provisional Back     alignment and domain information
>TIGR01790 carotene-cycl lycopene cyclase family protein Back     alignment and domain information
>PF04820 Trp_halogenase: Tryptophan halogenase; InterPro: IPR006905 Tryptophan halogenase catalyses the chlorination of tryptophan to form 7-chlorotryptophan Back     alignment and domain information
>PF08491 SE: Squalene epoxidase; InterPro: IPR013698 This domain is found in squalene epoxidase (SE) and related proteins which are found in taxonomically diverse groups of eukaryotes and also in bacteria Back     alignment and domain information
>PLN02697 lycopene epsilon cyclase Back     alignment and domain information
>PLN02463 lycopene beta cyclase Back     alignment and domain information
>TIGR01789 lycopene_cycl lycopene cyclase Back     alignment and domain information
>PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins Back     alignment and domain information
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>TIGR00292 thiazole biosynthesis enzyme Back     alignment and domain information
>KOG2415 consensus Electron transfer flavoprotein ubiquinone oxidoreductase [Energy production and conversion] Back     alignment and domain information
>TIGR02352 thiamin_ThiO glycine oxidase ThiO Back     alignment and domain information
>TIGR01377 soxA_mon sarcosine oxidase, monomeric form Back     alignment and domain information
>TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form Back     alignment and domain information
>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>COG2081 Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>PRK11728 hydroxyglutarate oxidase; Provisional Back     alignment and domain information
>PRK12416 protoporphyrinogen oxidase; Provisional Back     alignment and domain information
>TIGR00275 flavoprotein, HI0933 family Back     alignment and domain information
>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information
>PRK00711 D-amino acid dehydrogenase small subunit; Validated Back     alignment and domain information
>PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated Back     alignment and domain information
>TIGR03862 flavo_PP4765 uncharacterized flavoprotein, PP_4765 family Back     alignment and domain information
>PRK13369 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR00562 proto_IX_ox protoporphyrinogen oxidase Back     alignment and domain information
>TIGR02730 carot_isom carotene isomerase Back     alignment and domain information
>PLN02612 phytoene desaturase Back     alignment and domain information
>PRK11259 solA N-methyltryptophan oxidase; Provisional Back     alignment and domain information
>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases Back     alignment and domain information
>PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>PRK11883 protoporphyrinogen oxidase; Reviewed Back     alignment and domain information
>PRK07233 hypothetical protein; Provisional Back     alignment and domain information
>PLN02676 polyamine oxidase Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>PF01946 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K Back     alignment and domain information
>PRK05257 malate:quinone oxidoreductase; Validated Back     alignment and domain information
>COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria Back     alignment and domain information
>PF01593 Amino_oxidase: Flavin containing amine oxidoreductase This is a subset of the Pfam family; InterPro: IPR002937 This entry consists of various amine oxidases, including maize polyamine oxidase (PAO) [], L-amino acid oxidases (LAO) and various flavin containing monoamine oxidases (MAO) Back     alignment and domain information
>TIGR03467 HpnE squalene-associated FAD-dependent desaturase Back     alignment and domain information
>PLN02568 polyamine oxidase Back     alignment and domain information
>PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>PLN02976 amine oxidase Back     alignment and domain information
>TIGR03197 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouridine biosynthesis protein MnmC, C-terminal domain Back     alignment and domain information
>COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG0579 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PLN02268 probable polyamine oxidase Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase Back     alignment and domain information
>PRK13339 malate:quinone oxidoreductase; Reviewed Back     alignment and domain information
>PLN02464 glycerol-3-phosphate dehydrogenase Back     alignment and domain information
>TIGR02485 CobZ_N-term precorrin 3B synthase CobZ Back     alignment and domain information
>TIGR00136 gidA glucose-inhibited division protein A Back     alignment and domain information
>PTZ00383 malate:quinone oxidoreductase; Provisional Back     alignment and domain information
>KOG2820 consensus FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>PLN02576 protoporphyrinogen oxidase Back     alignment and domain information
>COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>PLN02661 Putative thiazole synthesis Back     alignment and domain information
>COG0578 GlpA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit Back     alignment and domain information
>PRK09231 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>PLN03000 amine oxidase Back     alignment and domain information
>PLN02328 lysine-specific histone demethylase 1 homolog Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>TIGR02734 crtI_fam phytoene desaturase Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>TIGR00551 nadB L-aspartate oxidase Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK09897 hypothetical protein; Provisional Back     alignment and domain information
>PRK07804 L-aspartate oxidase; Provisional Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG1251 NirB NAD(P)H-nitrite reductase [Energy production and conversion] Back     alignment and domain information
>PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional Back     alignment and domain information
>TIGR02732 zeta_caro_desat carotene 7,8-desaturase Back     alignment and domain information
>TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364 Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>PLN02529 lysine-specific histone demethylase 1 Back     alignment and domain information
>TIGR03377 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase, anaerobic, A subunit Back     alignment and domain information
>TIGR01176 fum_red_Fp fumarate reductase, flavoprotein subunit Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>PF06039 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro: IPR006231 The membrane-associated enzyme, malate:quinone-oxidoreductase, is an alternative to the better-known NAD-dependent malate dehydrogenase as part of the TCA cycle Back     alignment and domain information
>PTZ00363 rab-GDP dissociation inhibitor; Provisional Back     alignment and domain information
>COG1232 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] Back     alignment and domain information
>KOG1346 consensus Programmed cell death 8 (apoptosis-inducing factor) [Signal transduction mechanisms] Back     alignment and domain information
>TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01813 flavo_cyto_c flavocytochrome c Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase Back     alignment and domain information
>PF13454 NAD_binding_9: FAD-NAD(P)-binding Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PLN02487 zeta-carotene desaturase Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR00137 gid_trmFO tRNA:m(5)U-54 methyltransferase Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>KOG1399 consensus Flavin-containing monooxygenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>KOG2853 consensus Possible oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query439
2r0c_A 549 Structure Of The Substrate-Free Form Of The Rebecca 3e-08
4eip_A 549 Native And K252c Bound Rebc-10x Length = 549 4e-08
2qa2_A 499 Crystal Structure Of Cabe, An Aromatic Hydroxylase 1e-07
3all_A379 Crystal Structure Of 2-Methyl-3-Hydroxypyridine-5-C 6e-07
3fmw_A 570 The Crystal Structure Of Mtmoiv, A Baeyer-Villiger 7e-07
3alk_A379 Crystal Structure Of 2-Methyl-3-Hydroxypyridine-5-C 8e-07
3alh_A379 Higher Resolution And Native Structure Of 2-Methyl- 1e-06
3gmc_A415 Crystal Structure Of 2-Methyl-3-Hydroxypyridine-5-C 1e-06
3gmb_A415 Crystal Structure Of 2-Methyl-3-Hydroxypyridine-5-C 2e-05
3v3n_A378 Crystal Structure Of Tetx2 T280a: An Adaptive Mutan 7e-05
2y6r_A398 Structure Of The Tetx Monooxygenase In Complex With 7e-05
4a6n_A398 Structure Of The Tetracycline Degrading Monooxygena 7e-05
2xdo_A398 Structure Of The Tetracycline Degrading Monooxygena 7e-05
1pn0_A 665 Phenol Hydroxylase From Trichosporon Cutaneum Lengt 1e-04
2x3n_A399 Crystal Structure Of Pqsl, A Probable Fad-Dependent 1e-04
2qa1_A 500 Crystal Structure Of Pgae, An Aromatic Hydroxylase 3e-04
3p9u_A378 Crystal Structure Of Tetx2 From Bacteroides Thetaio 3e-04
2xyo_A399 Structural Basis For A New Tetracycline Resistance 3e-04
1bgn_A394 P-Hydroxybenzoate Hydroxylase (Phbh) Mutant With Cy 6e-04
>pdb|2R0C|A Chain A, Structure Of The Substrate-Free Form Of The Rebeccamycin Biosynthetic Enzyme Rebc Length = 549 Back     alignment and structure 
Iteration: 1

 Score = 56.2 bits (134), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 40/109 (36%), Positives = 55/109 (50%), Gaps = 8/109 (7%)
Query: 280 DATLSAKECFEVPPRVVKLASERMVFPLSLKH-----ANNYVSKRVVLIGDAAHTVHPLA 334
           DA+ S  + FE+  R V   +E  V   S  H     A+++ + RV L GDAAHT+ P  
Sbjct: 266 DASKSTMDSFELVRRAVAFDTEIEVLSDSEWHLTHRVADSFSAGRVFLTGDAAHTLSPSG 325
Query: 335 GQGVNLGFGDASTLSRIIAEGIAVGADIGEASLLKKYEAERKPANIVMM 383
           G G+N G G A+ L   +A  +   A  G   LL  YE ER+P  I  +
Sbjct: 326 GFGMNTGIGSAADLGWKLAATLRGWAGPG---LLATYEEERRPVAITSL 371
>pdb|4EIP|A Chain A, Native And K252c Bound Rebc-10x Length = 549 Back     alignment and structure
>pdb|2QA2|A Chain A, Crystal Structure Of Cabe, An Aromatic Hydroxylase From Angucycline Biosynthesis, Determined To 2.7 A Resolution Length = 499 Back     alignment and structure
>pdb|3ALL|A Chain A, Crystal Structure Of 2-Methyl-3-Hydroxypyridine-5-Carboxylic Acid Oxygenase, Mutant Y270a Length = 379 Back     alignment and structure
>pdb|3FMW|A Chain A, The Crystal Structure Of Mtmoiv, A Baeyer-Villiger Monooxygenase From The Mithramycin Biosynthetic Pathway In Streptomyces Argillaceus. Length = 570 Back     alignment and structure
>pdb|3ALK|A Chain A, Crystal Structure Of 2-Methyl-3-Hydroxypyridine-5-Carboxylic Acid Oxygenase, Mutant Y270f Length = 379 Back     alignment and structure
>pdb|3ALH|A Chain A, Higher Resolution And Native Structure Of 2-Methyl-3-Hydroxypyridine- 5-Carboxylic Acid Oxygenase Length = 379 Back     alignment and structure
>pdb|3GMC|A Chain A, Crystal Structure Of 2-Methyl-3-Hydroxypyridine-5-Carboxylic Acid Oxygenase With Substrate Bound Length = 415 Back     alignment and structure
>pdb|3GMB|A Chain A, Crystal Structure Of 2-Methyl-3-Hydroxypyridine-5-Carboxylic Acid Oxygenase Length = 415 Back     alignment and structure
>pdb|3V3N|A Chain A, Crystal Structure Of Tetx2 T280a: An Adaptive Mutant In Complex With Minocycline Length = 378 Back     alignment and structure
>pdb|2Y6R|A Chain A, Structure Of The Tetx Monooxygenase In Complex With The Substrate 7-Chlortetracycline Length = 398 Back     alignment and structure
>pdb|4A6N|A Chain A, Structure Of The Tetracycline Degrading Monooxygenase Tetx In Complex With Tigecycline Length = 398 Back     alignment and structure
>pdb|2XDO|A Chain A, Structure Of The Tetracycline Degrading Monooxygenase Tetx2 From Bacteroides Thetaiotaomicron Length = 398 Back     alignment and structure
>pdb|1PN0|A Chain A, Phenol Hydroxylase From Trichosporon Cutaneum Length = 665 Back     alignment and structure
>pdb|2X3N|A Chain A, Crystal Structure Of Pqsl, A Probable Fad-Dependent Monooxygenase From Pseudomonas Aeruginosa Length = 399 Back     alignment and structure
>pdb|2QA1|A Chain A, Crystal Structure Of Pgae, An Aromatic Hydroxylase Involved In Angucycline Biosynthesis Length = 500 Back     alignment and structure
>pdb|3P9U|A Chain A, Crystal Structure Of Tetx2 From Bacteroides Thetaiotaomicron With Substrate Analogue Length = 378 Back     alignment and structure
>pdb|2XYO|A Chain A, Structural Basis For A New Tetracycline Resistance Mechanism Relying On The Tetx Monooxygenase Length = 399 Back     alignment and structure
>pdb|1BGN|A Chain A, P-Hydroxybenzoate Hydroxylase (Phbh) Mutant With Cys 116 Replaced By Ser (C116s) And Arg 269 Replaced By Thr (R269t), In Complex With Fad And 4-Hydroxybenzoic Acid Length = 394 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query439
2x3n_A399 Probable FAD-dependent monooxygenase; oxidoreducta 1e-96
2qa2_A499 CABE, polyketide oxygenase CABE; FAD, angucycline, 7e-27
2qa1_A500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 1e-26
1pn0_A 665 Phenol 2-monooxygenase; two dimers, TLS refinement 2e-23
2vou_A397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 3e-21
3fmw_A 570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 3e-21
2dkh_A 639 3-hydroxybenzoate hydroxylase; flavoprotein, monoo 1e-20
3ihg_A 535 RDME; flavoenzyme, anthracycline, polyketide biosy 2e-20
2xdo_A398 TETX2 protein; tetracycline degradation, tigecycli 3e-20
2r0c_A 549 REBC; flavin adenine dinucleotide, monooxygenase, 1e-18
3alj_A379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 3e-18
1k0i_A394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 1e-17
3c4a_A381 Probable tryptophan hydroxylase VIOD; alpha-beta p 7e-14
3rp8_A407 Flavoprotein monooxygenase; FAD-binding protein, o 7e-14
3nix_A421 Flavoprotein/dehydrogenase; structural genomics, P 7e-14
3c96_A410 Flavin-containing monooxygenase; FAD, oxidoreducta 2e-13
3e1t_A512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 1e-11
3i3l_A 591 Alkylhalidase CMLS; flavin-dependent halogenase, c 4e-11
3ihm_A430 Styrene monooxygenase A; rossman fold, anti-parall 2e-07
3atr_A453 Conserved archaeal protein; saturating double bond 2e-07
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 2e-07
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Length = 399 Back     alignment and structure
 Score =  294 bits (755), Expect = 1e-96
 Identities = 72/432 (16%), Positives = 137/432 (31%), Gaps = 66/432 (15%)

Query: 7   LSVAIIDSNPALGKSNFIKKEDPPDPRVSTVTPATISFFKEIGAWQYVQQHRHAYFDKMQ 66
             V +++              +        + PA I   +  G    V +       +++
Sbjct: 30  HRVVVVEQAR----------RERAINGADLLKPAGIRVVEAAGLLAEVTRRGGRVRHELE 79

Query: 67  VWDYTGLGYTKYNARDVNKEILGCVVENKVLHSSLLSCMQNTEFQKTIYPSRLTSMALLP 126
           V+   G     +N   V+      ++  + L   +L  +      + ++ +R+ ++    
Sbjct: 80  VYH-DGELLRYFNYSSVDARGYFILMPCESLRRLVLEKIDGEATVEMLFETRIEAVQRDE 138

Query: 127 SSSSISVDSTPSATTLFTKGHLAKLDLSDGTSLYAKLVVGADGGKSRVRE-LAGFKTTGW 185
                                + ++ L+DG  L  ++VVGADG  S VR  L        
Sbjct: 139 R------------------HAIDQVRLNDGRVLRPRVVVGADGIASYVRRRLLDIDVERR 180

Query: 186 SYSQNAIICTVEHNKE-NYCAWQRFLPAGPIA-LLPIGDNFSNIVWTMNPKDASDCKSMN 243
            Y    ++ T                  G +A   PIG + + +V +   ++A +  +  
Sbjct: 181 PYPSPMLVGTFALAPCVAERNRLYVDSQGGLAYFYPIGFDRARLVVSFPREEARELMADT 240

Query: 244 EDDFVKILNHALDYGYGPHPKSISSGSVDMFSWFRGDATLSAKECFEVPPRVVKLASERM 303
             + ++                                     +        V   S   
Sbjct: 241 RGESLRRRLQRF-----------------------------VGDESAEAIAAVTGTSRFK 271

Query: 304 VFPLSLKHANNYVSKRVVLIGDAAHTVHPLAGQGVNLGFGDASTLSRIIAEGIAVGADIG 363
             P+   + + Y +  V ++GDA H VHP+ GQG+NL   DAS L+  +   +     + 
Sbjct: 272 GIPIGYLNLDRYWADNVAMLGDAIHNVHPITGQGMNLAIEDASALADALDLALRDACALE 331

Query: 364 EASLLKKYEAERKPANIVMMAVLDGFQKAYSVDFGPLNILRAAAFHGAQYISPLKRNIIS 423
               L  Y+AER P N  +++       +          +   A  G+           S
Sbjct: 332 --DALAGYQAERFPVNQAIVSYGHALATSLEDR-QRFAGVFDTALQGSSRTPEALGGERS 388

Query: 424 YASGEQRLPLPL 435
           Y     R P PL
Sbjct: 389 YQPV--RSPAPL 398
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Length = 499 Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Length = 500 Back     alignment and structure
>1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* Length = 665 Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Length = 397 Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Length = 570 Back     alignment and structure
>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* Length = 639 Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Length = 535 Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Length = 398 Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Length = 549 Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Length = 379 Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Length = 394 Back     alignment and structure
>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Length = 381 Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Length = 407 Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Length = 421 Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Length = 410 Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Length = 512 Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Length = 591 Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Length = 430 Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Length = 453 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query439
2qa2_A 499 CABE, polyketide oxygenase CABE; FAD, angucycline, 100.0
2qa1_A 500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 100.0
3fmw_A 570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 100.0
2x3n_A399 Probable FAD-dependent monooxygenase; oxidoreducta 100.0
3rp8_A407 Flavoprotein monooxygenase; FAD-binding protein, o 100.0
4hb9_A412 Similarities with probable monooxygenase; flavin, 100.0
1pn0_A 665 Phenol 2-monooxygenase; two dimers, TLS refinement 100.0
1k0i_A394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 100.0
3ihg_A 535 RDME; flavoenzyme, anthracycline, polyketide biosy 100.0
2r0c_A 549 REBC; flavin adenine dinucleotide, monooxygenase, 100.0
2vou_A397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 100.0
2dkh_A 639 3-hydroxybenzoate hydroxylase; flavoprotein, monoo 100.0
3alj_A379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 100.0
3c96_A410 Flavin-containing monooxygenase; FAD, oxidoreducta 100.0
2xdo_A398 TETX2 protein; tetracycline degradation, tigecycli 100.0
3e1t_A 512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 100.0
3oz2_A397 Digeranylgeranylglycerophospholipid reductase; str 99.98
3i3l_A 591 Alkylhalidase CMLS; flavin-dependent halogenase, c 99.98
3nix_A421 Flavoprotein/dehydrogenase; structural genomics, P 99.97
3atr_A453 Conserved archaeal protein; saturating double bond 99.97
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 99.97
3c4a_A381 Probable tryptophan hydroxylase VIOD; alpha-beta p 99.97
2weu_A511 Tryptophan 5-halogenase; regioselectivity, antifun 99.95
2pyx_A526 Tryptophan halogenase; structural genomics, JOI fo 99.95
2aqj_A538 Tryptophan halogenase, pRNA; flavin-dependent halo 99.94
2gmh_A 584 Electron transfer flavoprotein-ubiquinone oxidored 99.94
2e4g_A550 Tryptophan halogenase; flavin-binding, rebeccamyci 99.94
3ihm_A430 Styrene monooxygenase A; rossman fold, anti-parall 99.89
2bry_A497 NEDD9 interacting protein with calponin homology a 99.75
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 99.53
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 98.5
2gag_B405 Heterotetrameric sarcosine oxidase beta-subunit; f 98.35
3ps9_A676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 98.32
1y56_B382 Sarcosine oxidase; dehydrogenase, protein-protein 98.21
3nyc_A381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 98.14
3nlc_A549 Uncharacterized protein VP0956; FAD-binding protei 97.99
2qcu_A501 Aerobic glycerol-3-phosphate dehydrogenase; glycer 97.96
2gf3_A389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 97.95
2oln_A397 NIKD protein; flavoprotein, rossmann fold, oxidore 97.9
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 97.86
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 97.8
3pvc_A689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 97.75
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 97.74
2ywl_A180 Thioredoxin reductase related protein; uncharacter 97.63
4dgk_A501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 97.62
1qo8_A566 Flavocytochrome C3 fumarate reductase; oxidoreduct 97.48
3c4n_A405 Uncharacterized protein DR_0571; alpha-beta protei 97.4
2i0z_A447 NAD(FAD)-utilizing dehydrogenases; structural geno 97.37
3ces_A 651 MNMG, tRNA uridine 5-carboxymethylaminomethyl modi 97.34
3v76_A417 Flavoprotein; structural genomics, PSI-biology, NE 97.33
3i6d_A470 Protoporphyrinogen oxidase; protein-inhibitor comp 97.26
3axb_A448 Putative oxidoreductase; dinucleotide-binding fold 97.26
3da1_A561 Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 97.24
2cul_A232 Glucose-inhibited division protein A-related PROT 97.24
1y0p_A571 Fumarate reductase flavoprotein subunit; flavocyto 97.18
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 97.18
2gjc_A326 Thiazole biosynthetic enzyme, mitochondrial; gluta 97.16
3dme_A369 Conserved exported protein; structural genomics, P 97.09
3cp8_A 641 TRNA uridine 5-carboxymethylaminomethyl modificati 97.09
2zxi_A 637 TRNA uridine 5-carboxymethylaminomethyl modificat 97.04
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 97.04
3nrn_A421 Uncharacterized protein PF1083; alpha-beta protein 96.92
1c0p_A363 D-amino acid oxidase; alpha-beta-alpha motif, flav 96.85
3dje_A438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 96.85
2gqf_A401 Hypothetical protein HI0933; structural genomics, 96.7
3qj4_A342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 96.64
2uzz_A372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 96.61
3lov_A475 Protoporphyrinogen oxidase; structural genomics, J 96.57
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 96.21
3ka7_A425 Oxidoreductase; structural genomics, PSI-2, protei 96.18
3nks_A477 Protoporphyrinogen oxidase; FAD containing protein 96.17
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 95.99
3k7m_X431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 95.97
3gwf_A 540 Cyclohexanone monooxygenase; flavoprotein biocatal 95.93
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 95.67
1w4x_A 542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 95.55
1s3e_A520 Amine oxidase [flavin-containing] B; human monoami 95.5
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 95.5
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 95.38
2ivd_A478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 95.26
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 95.17
1pj5_A 830 N,N-dimethylglycine oxidase; channelling, FAD bind 95.02
4ap3_A 549 Steroid monooxygenase; oxidoreductase, baeyer-vill 94.92
1kf6_A 602 Fumarate reductase flavoprotein; respiration, fuma 94.89
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 94.78
1d4d_A572 Flavocytochrome C fumarate reductase; oxidoreducta 94.47
3uox_A 545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 94.4
1sez_A504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 94.39
2rgh_A571 Alpha-glycerophosphate oxidase; flavoprotein oxida 94.36
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 94.17
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 94.15
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 93.91
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 93.89
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 93.82
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 93.79
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 93.78
2vvm_A495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 93.73
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 93.6
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 93.55
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 93.5
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 93.5
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 93.37
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 93.33
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 93.22
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 93.21
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 93.07
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 93.04
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 92.95
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 92.68
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 92.51
1fec_A490 Trypanothione reductase; redox-active center, oxid 92.39
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 92.31
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 92.25
3g3e_A351 D-amino-acid oxidase; FAD, flavoprotein, oxidoredu 92.18
1b37_A472 Protein (polyamine oxidase); flavin-dependent amin 92.12
3p1w_A475 Rabgdi protein; GDI RAB, malaria, structural genom 92.07
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 92.0
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 91.98
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 91.72
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 91.64
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 91.49
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 90.97
1ojt_A482 Surface protein; redox-active center, glycolysis, 90.82
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 90.75
4at0_A510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 90.0
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 89.77
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 89.62
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 89.58
2wdq_A 588 Succinate dehydrogenase flavoprotein subunit; succ 89.52
1d5t_A433 Guanine nucleotide dissociation inhibitor; ultra-h 89.5
2e5v_A472 L-aspartate oxidase; archaea, oxidoreductase; HET: 89.18
4dna_A463 Probable glutathione reductase; structural genomic 89.06
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 88.82
2h88_A 621 Succinate dehydrogenase flavoprotein subunit; comp 88.74
1chu_A540 Protein (L-aspartate oxidase); flavoenzyme, NAD bi 88.62
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 88.37
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 88.33
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 88.1
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 87.78
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 87.63
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 87.61
2bcg_G453 Secretory pathway GDP dissociation inhibitor; RABG 87.56
1rsg_A516 FMS1 protein; FAD binding motif, oxidoreductase; H 87.37
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 87.31
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 87.09
3h8l_A409 NADH oxidase; membrane protein, complete form, ros 86.84
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 86.76
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 85.75
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 84.97
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 84.53
3ics_A588 Coenzyme A-disulfide reductase; pyridine nucleotid 84.5
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 84.35
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 83.98
4gut_A776 Lysine-specific histone demethylase 1B; histone de 83.98
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 83.85
4b1b_A542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 83.84
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 83.82
2bs2_A 660 Quinol-fumarate reductase flavoprotein subunit A; 82.69
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 82.59
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 82.47
4gde_A513 UDP-galactopyranose mutase; flavin adenine dinucle 82.05
2jae_A489 L-amino acid oxidase; oxidoreductase, dimerisation 81.76
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 81.63
1vg0_A650 RAB proteins geranylgeranyltransferase component A 81.35
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 81.07
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 81.06
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 80.17
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Back     alignment and structure
Probab=100.00  E-value=5e-40  Score=331.97  Aligned_cols=347  Identities=18%  Similarity=0.212  Sum_probs=267.7

Q ss_pred             CCCcEEEEEcCCCCCCCCCCCCCCCCCCCcEEeeCHhHHHHHHHCCCchhhhhhhcCccceEEEEeCCCcceeEEeccCC
Q 013625            4 TKHLSVAIIDSNPALGKSNFIKKEDPPDPRVSTVTPATISFFKEIGAWQYVQQHRHAYFDKMQVWDYTGLGYTKYNARDV   83 (439)
Q Consensus         4 ~~G~~V~viE~~~~~~~~~~~~~~~~~~~~~~~l~p~~~~~L~~lGl~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   83 (439)
                      .+|++|+||||.+.+          ...++++.|+++++++|+++|+++++.+. . +.... .+  .+.   .++....
T Consensus        33 ~~G~~v~vlE~~~~~----------~~~~r~~~l~~~~~~~l~~lGl~~~~~~~-~-~~~~~-~~--~~~---~~~~~~~   94 (499)
T 2qa2_A           33 LGGVDVMVLEQLPQR----------TGESRGLGFTARTMEVFDQRGILPAFGPV-E-TSTQG-HF--GGR---PVDFGVL   94 (499)
T ss_dssp             HTTCCEEEEESCSSC----------CCCCCSEEECHHHHHHHHHTTCGGGGCSC-C-EESEE-EE--TTE---EEEGGGS
T ss_pred             HCCCCEEEEECCCCC----------CCCCceeEECHHHHHHHHHCCCHHHHHhc-c-ccccc-ee--cce---ecccccC
Confidence            369999999999887          34567999999999999999999998775 2 22222 12  111   2333222


Q ss_pred             C-CccceeeeehHHHHHHHHHHhhcCCCcEEEcCCeeEEeeeCCCCCCcccCCCCCcccccccCceeEEEeCCCc---EE
Q 013625           84 N-KEILGCVVENKVLHSSLLSCMQNTEFQKTIYPSRLTSMALLPSSSSISVDSTPSATTLFTKGHLAKLDLSDGT---SL  159 (439)
Q Consensus        84 ~-~~~~~~~i~R~~l~~~L~~~~~~~~~v~v~~~~~v~~i~~~~~~~~~~~~~~~~~~~~~~~~~~v~v~~~dg~---~~  159 (439)
                      . ..++++.++|..|+++|.+.+.+.+ ++|+++++|++++.                    ++++++|++++|+   ++
T Consensus        95 ~~~~~~~~~i~~~~l~~~L~~~~~~~g-v~v~~~~~v~~i~~--------------------~~~~v~v~~~~~~g~~~~  153 (499)
T 2qa2_A           95 EGAHYGVKAVPQSTTESVLEEWALGRG-AELLRGHTVRALTD--------------------EGDHVVVEVEGPDGPRSL  153 (499)
T ss_dssp             TTCCCEEEEEEHHHHHHHHHHHHHHTT-CEEEESCEEEEEEE--------------------CSSCEEEEEECSSCEEEE
T ss_pred             CCCCCceEecCHHHHHHHHHHHHHhCC-CEEEcCCEEEEEEE--------------------eCCEEEEEEEcCCCcEEE
Confidence            2 2345688999999999999999986 99999999999987                    4467889998876   89


Q ss_pred             EecEEEEecCCCchhhhhhCCCCCCCcCCCeEEEEEEEeecCCceeEEEEecCCceEEeecCCCceEEEEEcCccC-hhH
Q 013625          160 YAKLVVGADGGKSRVRELAGFKTTGWSYSQNAIICTVEHNKENYCAWQRFLPAGPIALLPIGDNFSNIVWTMNPKD-ASD  238 (439)
Q Consensus       160 ~adlvVgADG~~S~vR~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~p~~~~~~~~~~~~~~~~-~~~  238 (439)
                      +||+||||||.+|.||+.+|+......+...++.+.+............+.++++++++|++++..++++...... ...
T Consensus       154 ~a~~vVgADG~~S~VR~~lg~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~~~~g~~~~~P~~~g~~~~~~~~~~~~~~~~  233 (499)
T 2qa2_A          154 TTRYVVGCDGGRSTVRKAAGFDFPGTSASREMFLADIRGCEITPRPIGETVPLGMVMSAPLGDGVDRIIVCERGAPARRR  233 (499)
T ss_dssp             EEEEEEECCCTTCHHHHHTTCCCCEECCCCCEEEEEEESCCCCCEEEEEEETTEEEEEEECSSSCEEEEEEETTCCCCCC
T ss_pred             EeCEEEEccCcccHHHHHcCCCCCCCCCccEEEEEEEEECCCCcceEEEECCCeEEEEEEcCCCEEEEEEEecCCCCccc
Confidence            9999999999999999999988777667677788877765433333445678889999999988877777653321 111


Q ss_pred             hhCCCHHHHHHHHHHhccCCCCCCCCCCCCCcccchhccccCccccccccccCCcceeeecccceeeecccccccccccC
Q 013625          239 CKSMNEDDFVKILNHALDYGYGPHPKSISSGSVDMFSWFRGDATLSAKECFEVPPRVVKLASERMVFPLSLKHANNYVSK  318 (439)
Q Consensus       239 ~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  318 (439)
                      ....+.+++.+.+...+.....                                  +.+ ..+...|++..+.+++|.+|
T Consensus       234 ~~~~~~~~~~~~l~~~~~~~~~----------------------------------~~~-~~~~~~~~~~~~~a~~~~~g  278 (499)
T 2qa2_A          234 TGPPPYQEVAAAWQRLTGQDIS----------------------------------HGE-PVWVSAFGDPARQVSAYRRG  278 (499)
T ss_dssp             SSSCCHHHHHHHHHHHHSCCCT----------------------------------TCE-EEEEEEECCCEEECSCSEET
T ss_pred             cCCCCHHHHHHHHHHHhCCCCC----------------------------------ccc-eeEEEEEeCCcEEcccccCC
Confidence            2235667777777764431000                                  000 11223466666778999999


Q ss_pred             CEEEEcccccccCCcccccchhcHHHHHHHHHHHHHhhhcCCCCChHHHHHHHHHhhchhhHHHHHHHHHHHHhhcCCCC
Q 013625          319 RVVLIGDAAHTVHPLAGQGVNLGFGDASTLSRIIAEGIAVGADIGEASLLKKYEAERKPANIVMMAVLDGFQKAYSVDFG  398 (439)
Q Consensus       319 rvvLvGDAAh~~~P~~g~G~~~al~da~~La~~L~~~~~~~~~~~~~~~l~~Ye~~r~~~~~~~~~~~~~~~~~~~~~~~  398 (439)
                      ||+|+|||||.|+|++|||+|+||+||..|+++|...++.. +  ...+|+.|+++|+++...++..++.+..++.. ++
T Consensus       279 rv~L~GDAAH~~~P~~GqG~n~gi~DA~~La~~La~~l~g~-~--~~~~L~~Ye~eR~~~~~~~~~~s~~~~~l~~~-~~  354 (499)
T 2qa2_A          279 RVLLAGDSAHVHLPAGGQGMNVSVQDSVNLGWKLAAVVSGR-A--PAGLLDTYHEERHPVGRRLLMNTQAQGMLFLS-GD  354 (499)
T ss_dssp             TEEECGGGTEEECCCSSCHHHHHHHHHHHHHHHHHHHHTTS-S--CTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC-CG
T ss_pred             CEEEEecccccCCCccccchhhhHHHHHHHHHHHHHHHcCC-C--ChHHHHHHHHHHHHHHHHHHHHHHHHHHHhcC-Cc
Confidence            99999999999999999999999999999999999987633 2  36899999999999999999999999998874 67


Q ss_pred             hHHHHHHHHHHhhccChhHHHHHHHHHhcCC
Q 013625          399 PLNILRAAAFHGAQYISPLKRNIISYASGEQ  429 (439)
Q Consensus       399 ~~~~~r~~~~~~~~~~~~l~~~~~~~~~g~~  429 (439)
                      ....+|+.++.++ ..|.+++.+...++|..
T Consensus       355 ~~~~~R~~~~~~~-~~~~~~~~~~~~~~~~~  384 (499)
T 2qa2_A          355 EMQPLRDVLSELI-RYDEVSRHLAGMVSGLD  384 (499)
T ss_dssp             GGHHHHHHHHHHH-TSSHHHHHHHHHHHTTT
T ss_pred             hHHHHHHHHHHhh-cCHHHHHHHHHHHhCCC
Confidence            7788999888777 67899999998888765
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure
>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Back     alignment and structure
>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* Back     alignment and structure
>2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina} Back     alignment and structure
>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* Back     alignment and structure
>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Back     alignment and structure
>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Back     alignment and structure
>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A* Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
>3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} Back     alignment and structure
>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Back     alignment and structure
>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* Back     alignment and structure
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Back     alignment and structure
>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* Back     alignment and structure
>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Back     alignment and structure
>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... Back     alignment and structure
>1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Back     alignment and structure
>4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A* Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R* Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 439
d1pn0a1360 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {So 5e-15
d3c96a1288 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Ps 1e-07
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Length = 360 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD-linked reductases, N-terminal domain
domain: Phenol hydroxylase
species: Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]

 Score = 73.6 bits (179), Expect = 5e-15
 Identities = 55/421 (13%), Positives = 91/421 (21%), Gaps = 103/421 (24%)

Query: 7   LSVAIIDSNPALGKSNFIKKEDPPDPRVSTVTPATISFFKEIGAWQYVQQHRHAYFDKMQ 66
           L V IID                 + +   +   T+   K +G    +    +     + 
Sbjct: 36  LKVRIIDKRSTK----------VYNGQADGLQCRTLESLKNLGLADKILSEANDM-STIA 84

Query: 67  VWDYTGLGYTKYNARDVNKEILGCVVENKVLHSSLLSCMQNTEFQKTIYPSRLTSMALLP 126
           +++    G+ +   R  +           VLH   +         +           L  
Sbjct: 85  LYNPDENGHIRRTDRIPDTLPGISRYHQVVLHQGRIERRILDSIAEISDTRIKVERPL-- 142

Query: 127 SSSSISVDSTPSATTLFTKGHLAKLDLSDGTSLYAKLVVGADGGKSRVRELAGFKTTGWS 186
                                           +        D     V     + +   S
Sbjct: 143 ----------------------------IPEKMEIDSSKAEDPEAYPVTMTLRYMSEDES 174

Query: 187 YSQNAIICTVEHNKENYCAWQRFLPAGPIALLPIGDNFSNIVWTMNPKDASDCKSMNEDD 246
                   T   N       Q          LP G     I                   
Sbjct: 175 TPLQFGHKTE--NGLFRSNLQTQEEEDANYRLPEGKEAGEIET----------------- 215

Query: 247 FVKILNHALDYGYGPHPKSISSGSVDMFSWFRGDATLSAKECFEVPPRVVKLASERMVFP 306
                     Y  G             F     +                          
Sbjct: 216 ------VHCKYVIGCDGGHSWVRRTLGFEMIVTEKF------------------------ 245

Query: 307 LSLKHANNYVSKRVVLIGDAAHTVHPLAGQGVNLGFGDASTLSRIIAEGIAVGADIGEAS 366
                      +RV + GDA HT  P AGQG+N    D   L   +     V     +  
Sbjct: 246 --------SKDERVFIAGDACHTHSPKAGQGMNTSMMDTYNLGWKLG---LVLTGRAKRD 294

Query: 367 LLKKYEAERKPANIVMMAVLDGFQKAYSVDFGPLNILRAAAFHGAQYISPLKRNIISYAS 426
           +LK YE ER+P    ++     F + +S      ++          +     +    +AS
Sbjct: 295 ILKTYEEERQPFAQALIDFDHQFSRLFSGR-PAKDVADEMGVSMDVFKEAFVKG-NEFAS 352

Query: 427 G 427
           G
Sbjct: 353 G 353
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Length = 288 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query439
d1pn0a1360 Phenol hydroxylase {Soil-living yeast (Trichosporo 99.94
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 99.93
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 99.89
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 99.77
d2gmha1380 Electron transfer flavoprotein-ubiquinone oxidored 99.35
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 97.62
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 97.33
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 96.97
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 96.96
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 96.88
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 96.71
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 96.58
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 96.57
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 96.33
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 96.09
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 95.99
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 95.9
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 95.83
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 95.81
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 95.76
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 95.52
d1d4ca2322 Flavocytochrome c3 (respiratory fumarate reductase 95.51
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 95.18
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 95.14
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 95.0
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 94.85
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 94.45
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 94.29
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 93.93
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 93.44
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 93.15
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 92.89
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 92.85
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 92.53
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 92.23
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 91.93
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 90.92
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 90.88
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 84.67
d1qo8a2317 Flavocytochrome c3 (respiratory fumarate reductase 82.71
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 82.4
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD-linked reductases, N-terminal domain
domain: Phenol hydroxylase
species: Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]

Probab=99.94  E-value=3.2e-28  Score=233.17  Aligned_cols=310  Identities=16%  Similarity=0.168  Sum_probs=184.9

Q ss_pred             CCCCcEEEEEcCCCCCCCCCCCCCCCCCCCcEEeeCHhHHHHHHHCCCchhhhhhhcCccceEEEEeCCCcceeE-Ee-c
Q 013625            3 LTKHLSVAIIDSNPALGKSNFIKKEDPPDPRVSTVTPATISFFKEIGAWQYVQQHRHAYFDKMQVWDYTGLGYTK-YN-A   80 (439)
Q Consensus         3 ~~~G~~V~viE~~~~~~~~~~~~~~~~~~~~~~~l~p~~~~~L~~lGl~~~l~~~~~~~~~~~~~~~~~~~~~~~-~~-~   80 (439)
                      ..+|++|+||||++.++          ..++++.|+|+++++|+++|+++++.+.+. ++....++......... .. .
T Consensus        32 ~~~G~~v~vlEr~~~~~----------~~~r~~~l~~~~~~~L~~lGl~~~i~~~~~-~~~~~~~~~~~~~~~~~~~~~~  100 (360)
T d1pn0a1          32 QKPDLKVRIIDKRSTKV----------YNGQADGLQCRTLESLKNLGLADKILSEAN-DMSTIALYNPDENGHIRRTDRI  100 (360)
T ss_dssp             HSTTCCEEEECSSSSCC----------CSCSCCEECHHHHHHHHTTTCHHHHHTTCB-CCCEEEEEEECTTSCEEEEEEE
T ss_pred             ccCCCcEEEEcCCCCCC----------cCCeEEEECHHHHHHHHHcCChHHHHhhcC-CcceeEEEecccCCcccccccc
Confidence            36799999999999984          456699999999999999999999999888 66676666544332221 11 1


Q ss_pred             cC---CCCccceeeeehHHHHHHHHHHhhcCCCcEEEcCCeeEEeeeCCCCCCcccCCCCCcccccccCceeEEEeCCCc
Q 013625           81 RD---VNKEILGCVVENKVLHSSLLSCMQNTEFQKTIYPSRLTSMALLPSSSSISVDSTPSATTLFTKGHLAKLDLSDGT  157 (439)
Q Consensus        81 ~~---~~~~~~~~~i~R~~l~~~L~~~~~~~~~v~v~~~~~v~~i~~~~~~~~~~~~~~~~~~~~~~~~~~v~v~~~dg~  157 (439)
                      ..   .........++|..++..|.+.+.+.....+.....+.                                   +.
T Consensus       101 ~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~-----------------------------------~~  145 (360)
T d1pn0a1         101 PDTLPGISRYHQVVLHQGRIERRILDSIAEISDTRIKVERPLI-----------------------------------PE  145 (360)
T ss_dssp             ESSCTTSCSSCCEECCHHHHHHHHHHHHHHHHTTSSCEECSEE-----------------------------------EE
T ss_pred             cccccccccchheeecHHHHHHHHHHHHHhccccceeeeEecc-----------------------------------cc
Confidence            11   11233456789999999999988765433222221111                                   23


Q ss_pred             EEEecEEEEecCCCchhhhhhCCCCCCCcCCCeEEEEEEEeecCCceeEEEEecCCceEEeecCCCceEEEEEcCccChh
Q 013625          158 SLYAKLVVGADGGKSRVRELAGFKTTGWSYSQNAIICTVEHNKENYCAWQRFLPAGPIALLPIGDNFSNIVWTMNPKDAS  237 (439)
Q Consensus       158 ~~~adlvVgADG~~S~vR~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~p~~~~~~~~~~~~~~~~~~  237 (439)
                      ++.+|+|++|||.+|.||..............                         ....+..++.....+.       
T Consensus       146 ~~~~d~~~~~dg~~s~v~~~~~~~~~~~~~~~-------------------------~~~~~~~~~~~~~~~~-------  193 (360)
T d1pn0a1         146 KMEIDSSKAEDPEAYPVTMTLRYMSEDESTPL-------------------------QFGHKTENGLFRSNLQ-------  193 (360)
T ss_dssp             EEEECGGGTTCTTCCCEEEEEEECCGGGSCCC-------------------------TTCCCCCSSSCCCHHH-------
T ss_pred             eEEeeEEEEeecCCcceEEEEEEeecccccce-------------------------eeeeecCCCceEEeee-------
Confidence            57899999999999999865421111000000                         0000111111000000       


Q ss_pred             HhhCCCHHHHHHHHHHhccCCCC-CCCCCCCCCcccchhccccCccccccccccCCcceeeecc----cceeeecccccc
Q 013625          238 DCKSMNEDDFVKILNHALDYGYG-PHPKSISSGSVDMFSWFRGDATLSAKECFEVPPRVVKLAS----ERMVFPLSLKHA  312 (439)
Q Consensus       238 ~~~~~~~~~~~~~l~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~----~~~~~~~~~~~~  312 (439)
                               .......    .|. +....    ..+......              ..+.....    ....++......
T Consensus       194 ---------~~~~~~~----~~~~~~~~~----~~~~~~~~~--------------~~~~~~~~~~~~~~~~~~~~~~~~  242 (360)
T d1pn0a1         194 ---------TQEEEDA----NYRLPEGKE----AGEIETVHC--------------KYVIGCDGGHSWVRRTLGFEMIVT  242 (360)
T ss_dssp             ---------HHHHHHT----SCCCSTTCC----TTCEEEEEE--------------EEEEECCCTTCHHHHHHTCCCEEC
T ss_pred             ---------cCCcccc----eeecCcccc----hhhHHHHHH--------------HhhcCcccccchhhcccccccchh
Confidence                     0000000    000 00000    000000000              00000000    011123333345


Q ss_pred             cccc-cCCEEEEcccccccCCcccccchhcHHHHHHHHHHHHHhhhcCCCCChHHHHHHHHHhhchhhHHHHHHHHHHHH
Q 013625          313 NNYV-SKRVVLIGDAAHTVHPLAGQGVNLGFGDASTLSRIIAEGIAVGADIGEASLLKKYEAERKPANIVMMAVLDGFQK  391 (439)
Q Consensus       313 ~~~~-~~rvvLvGDAAh~~~P~~g~G~~~al~da~~La~~L~~~~~~~~~~~~~~~l~~Ye~~r~~~~~~~~~~~~~~~~  391 (439)
                      .+|. .|||+|||||||.|+|+.|||+|+||+||..|+++|...++..   ..+.+|+.|+++|+++...++..++.+.+
T Consensus       243 ~~~~~~grv~LvGDAAH~~~P~~GqG~n~al~Da~~La~~l~~~~~~~---~~~~~L~~Y~~~R~~~~~~~~~~s~~~~~  319 (360)
T d1pn0a1         243 EKFSKDERVFIAGDACHTHSPKAGQGMNTSMMDTYNLGWKLGLVLTGR---AKRDILKTYEEERQPFAQALIDFDHQFSR  319 (360)
T ss_dssp             SCSEETTTEEECGGGTEECCSTTCCHHHHHHHHHHHHHHHHHHHHTTC---BCGGGGHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             hheeecCcEEEccCcccccccccCCCCcccHHHHHHHHHHHHHHhcCC---ChHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            6775 5899999999999999999999999999999999999887643   23678999999999999999999999999


Q ss_pred             hhcCCCChHHHHHHHHHHhhccChhHHHHHHHH---HhcCC
Q 013625          392 AYSVDFGPLNILRAAAFHGAQYISPLKRNIISY---ASGEQ  429 (439)
Q Consensus       392 ~~~~~~~~~~~~r~~~~~~~~~~~~l~~~~~~~---~~g~~  429 (439)
                      +++.. +.....|    ......+.+++.+++.   ++|.+
T Consensus       320 ~~~~~-~~~~~~~----~~~~~~~~~~~~f~~~~~~~~G~~  355 (360)
T d1pn0a1         320 LFSGR-PAKDVAD----EMGVSMDVFKEAFVKGNEFASGTA  355 (360)
T ss_dssp             HHHSC-BCSSTTC----TTSBCHHHHHHHHHHHHHHHTTCC
T ss_pred             HHCCC-chHHHHH----hcccchHHHHHHHHHhhhhheeeC
Confidence            98764 3222222    2233345555555444   56654
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure