Citrus Sinensis ID: 013731

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------
MLIQSSAPTSVEAAMTFAPSHGEQDLLCKWRPTERWKGYAECSELPKEVSELLIASNISENSGLNLVKRRKIQKNSVIVFPVEAETDEVRVEEGSSKSQVEYDNSVVIALPAPTSIVGSNKELRSKNIRSSKSKMGVGCCNRNTEGSDISNSDISRLEVLDEDPSAREFCVSVLRSNGLLGAVGECSVRSVASGEVSGTGHEISVIQSCKLCGKADNTSTMLLCDYCDEAFHPSCCNPRIKILPTDNWLCQCCSNLNSNVSQENSFLKSPNNSWMYGKPRSEMGRIALMLKYPEPYTSRVRIGESYQAEVPDWSDQISSNLDSFSEPLEMDPAETVGLNVQFSNQFSKPDSISNWLQCQEVLTNNDTNVCVEGTKCGKWRRAPFSEVQTDSWDCSCAILWDPLHSDCAVPQELETDQVLRQLKYIEELKSRLGVKKT
ccccccccccHHccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccccccccccccccccccccccccccEEEEcccccccccccccccccHHHHHHHHHHHHHHHHHHHcccc
ccccccccHHHHHccccccccccccccccccccccccccccccccccccccccEEEcccccccccEEEEEHcccccEEEEEEcccccccEEEccccccccEEccccEccccccHHHcccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccEcccccccccccccccccccccccHHHcEEccccccccHEEEEccccccccEEccccccccccccccccccHcccccccccccccccHHHcccccccccccccHHHHHHcccccccccEEEcccEEEEcccccccccccccccccccccccHHHcccccccccccccccccccEEEEEEEccccccccccccEEcccccccccEEEEccccccEEEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHHccc
mliqssaptsVEAAMtfapshgeqdllckwrpterwkgyaecseLPKEVSELLIASNisensglnLVKRRKIqknsvivfpveaetdevrveegssksqveydnsvvialpaptsivgsnkelrsknirsskskmgvgccnrntegsdisnsdisrlevldedpsaREFCVSVLRSNgllgavgecsvrsvasgevsgtgHEISVIQScklcgkadntstmllcdycdeafhpsccnprikilptdnwlcqccsnlnsnvsqensflkspnnswmygkprsemGRIALMlkypepytsrvrigesyqaevpdwsdqissnldsfseplemdpaetvglnvqfsnqfskpdsisNWLQCQEVltnndtnvcvegtkcgkwrrapfsevqtdswdcscailwdplhsdcavpqelETDQVLRQLKYIEELKSRLGVKKT
mliqssaptsvEAAMtfapshgeqdlLCKWRPTERWKGYAECSELPKEVSELLIASnisensglnlvkrrkiqknsvivfpveaetdevrveegssksqveydnSVVIAlpaptsivgsnkelrsknirsskskmgvgccnrntegsdisnsdisRLEVLDEDPSAREFCVSVLRSNGLLGAVGECSVRSVASGEVSGTGHEISVIQSCKLCGKADNTSTMLLCDYCDEAFHPSCCNPRIKILPTDNWLCQCCSNLNSNVSQENSflkspnnswmygkPRSEMGRIALMLKYPEPYTSRVRIGESYQAEVPDWSDQISSNLDSFSEPLEMDPAETVGLNVQFSNQFSKPDSISNWLQCQEVLTNNDTNVCVEGTKCGKWRRAPFSEVQTDSWDCSCAILWDPLHSDCAVPQELETDQVLRQLKYIEelksrlgvkkt
MLIQSSAPTSVEAAMTFAPSHGEQDLLCKWRPTERWKGYAECSELPKEVSELLIASNISENSGLNLVKRRKIQKNSVIVFPVEAETDEVRVEEGSSKSQVEYDNSVVIALPAPTSIVGSNKELRSKNIRSSKSKMGVGCCNRNTEGSDISNSDISRLEVLDEDPSAREFCVSVLRSNGLLGAVGECSVRSVASGEVSGTGHEISVIQSCKLCGKADNTSTMLLCDYCDEAFHPSCCNPRIKILPTDNWLCQCCSNLNSNVSQENSFLKSPNNSWMYGKPRSEMGRIALMLKYPEPYTSRVRIGESYQAEVPDWSDQISSNLDSFSEPLEMDPAETVGLNVQFSNQFSKPDSISNWLQCQEVLTNNDTNVCVEGTKCGKWRRAPFSEVQTDSWDCSCAILWDPLHSDCAVPQELETDQVLRQLKYIEELKSRLGVKKT
***********************QDLLCKWRPTERWKGYAECSELPKEVSELLIASNISENSGLNLVKRRKIQKNSVIVFPVE*********************SVVIAL********************************************************REFCVSVLRSNGLLGAVGECSVRSVASGEVSGTGHEISVIQSCKLCGKADNTSTMLLCDYCDEAFHPSCCNPRIKILPTDNWLCQCCSNLNS***************WMY******MGRIALMLKYPEPYTSRVRIGESY*******************************LNVQFS**F***DSISNWLQCQEVLTNNDTNVCVEGTKCGKWRRAPFSEVQTDSWDCSCAILWDPLHSDCAVPQELETDQVLRQLKYIEE**********
*************AMTFAPSHG************************************************************************************************************************************************************************************ISVIQSCKLCGKADNTSTMLLCDYCDEAFHPSCCNPRIKILPTDNWLCQCCS*************************************************************************LEMDPAETV*****************NWLQCQEVLTNNDTNVCVEGTKCGKWRRAPFSEVQTDSWDCSCAILWDPLHSDCAVPQELETDQVLRQLKYIEELKSRL*****
***********EAAMTFAPSHGEQDLLCKWRPTERWKGYAECSELPKEVSELLIASNISENSGLNLVKRRKIQKNSVIVFPVEAE***************EYDNSVVIALPAPTSIVGSNKELRSKNIRSSKSKMGVGCCNRNTEGSDISNSDISRLEVLDEDPSAREFCVSVLRSNGLLGAVGECSVRS***********EISVIQSCKLCGKADNTSTMLLCDYCDEAFHPSCCNPRIKILPTDNWLCQCCSNLNSNVSQENSFLKSPNNSWMYGKPRSEMGRIALMLKYPEPYTSRVRIGESYQAEVPDWSDQISSNLDSFSEPLEMDPAETVGLNVQFSNQFSKPDSISNWLQCQEVLTNNDTNVCVEGTKCGKWRRAPFSEVQTDSWDCSCAILWDPLHSDCAVPQELETDQVLRQLKYIEELK********
*****S*PTSVEAAMTFAPSHGEQDLLCKWRPTERWKGYAECSELPKEVSELLIASNISENSGLNLVKRRKIQKNSVIVFPVEAETDEVRVEEGSSKSQVEYDNSVVIALPAPTSIV********************************************EDPSAREFCVSVLRSNGLLGAVGECS*************HEISVIQSCKLCGKADNTSTMLLCDYCDEAFHPSCCNPRIKILPTDNWLCQCCSNL*************************EMGRIALMLKYPEPYTSRVRIGESYQAEVPDWSDQISSNLDSFSEPLEMDPAETVGLNVQFSNQFSKPDSISNWLQCQEVLTNNDTNVCVEGTKCGKWRRAPFSEVQTDSWDCSCAILWDPLHSDCAVPQELETDQVLRQLKYIEELKSRLG****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLIQSSAPTSVEAAMTFAPSHGEQDLLCKWRPTERWKGYAECSELPKEVSELLIASNISENSGLNLVKRRKIQKNSVIVFPVEAETDEVRVEEGSSKSQVEYDNSVVIALPAPTSIVGSNKELRSKNIRSSKSKMGVGCCNRNTEGSDISNSDISRLEVLDEDPSAREFCVSVLRSNGLLGAVGECSVRSVASGEVSGTGHEISVIQSCKLCGKADNTSTMLLCDYCDEAFHPSCCNPRIKILPTDNWLCQCCSNLNSNVSQENSFLKSPNNSWMYGKPRSEMGRIALMLKYPEPYTSRVRIGESYQAEVPDWSDQISSNLDSFSEPLEMDPAETVGLNVQFSNQFSKPDSISNWLQCQEVLTNNDTNVCVEGTKCGKWRRAPFSEVQTDSWDCSCAILWDPLHSDCAVPQELETDQVLRQLKYIEELKSRLGVKKT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query437 2.2.26 [Sep-21-2011]
Q9P1Y6 1649 PHD and RING finger domai yes no 0.105 0.027 0.391 9e-07
B7ZS371698 Bromodomain adjacent to z N/A no 0.141 0.036 0.393 1e-06
A6H619 1682 PHD and RING finger domai yes no 0.105 0.027 0.391 1e-06
Q63625 1685 PHD and RING finger domai yes no 0.105 0.027 0.391 1e-06
Q9UIF82168 Bromodomain adjacent to z no no 0.102 0.020 0.422 2e-06
Q9DE132130 Bromodomain adjacent to z no no 0.102 0.021 0.422 2e-06
Q3UXZ9 1690 Lysine-specific demethyla no no 0.304 0.078 0.253 3e-06
Q8BRB7 1872 Histone acetyltransferase no no 0.100 0.023 0.434 4e-06
Q9HDV4 1513 Lid2 complex component li yes no 0.107 0.031 0.404 5e-06
Q5TKR9 1998 Histone acetyltransferase no no 0.196 0.043 0.310 6e-06
>sp|Q9P1Y6|PHRF1_HUMAN PHD and RING finger domain-containing protein 1 OS=Homo sapiens GN=PHRF1 PE=1 SV=3 Back     alignment and function desciption
 Score = 55.5 bits (132), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 29/46 (63%)

Query: 209 CKLCGKADNTSTMLLCDYCDEAFHPSCCNPRIKILPTDNWLCQCCS 254
           C++CG++D    +LLCD CD  +H  C +P ++ +P D W C  C+
Sbjct: 186 CEVCGRSDREDRLLLCDGCDAGYHMECLDPPLQEVPVDEWFCPECA 231

Homo sapiens (taxid: 9606)
>sp|B7ZS37|BAZ2A_XENLA Bromodomain adjacent to zinc finger domain protein 2A OS=Xenopus laevis GN=baz2a PE=2 SV=1 Back     alignment and function description
>sp|A6H619|PHRF1_MOUSE PHD and RING finger domain-containing protein 1 OS=Mus musculus GN=Phrf1 PE=1 SV=2 Back     alignment and function description
>sp|Q63625|PHRF1_RAT PHD and RING finger domain-containing protein 1 OS=Rattus norvegicus GN=Phrf1 PE=1 SV=2 Back     alignment and function description
>sp|Q9UIF8|BAZ2B_HUMAN Bromodomain adjacent to zinc finger domain protein 2B OS=Homo sapiens GN=BAZ2B PE=1 SV=3 Back     alignment and function description
>sp|Q9DE13|BAZ2B_CHICK Bromodomain adjacent to zinc finger domain protein 2B OS=Gallus gallus GN=BAZ2B PE=2 SV=1 Back     alignment and function description
>sp|Q3UXZ9|KDM5A_MOUSE Lysine-specific demethylase 5A OS=Mus musculus GN=Kdm5a PE=1 SV=2 Back     alignment and function description
>sp|Q8BRB7|KAT6B_MOUSE Histone acetyltransferase KAT6B OS=Mus musculus GN=Kat6b PE=2 SV=3 Back     alignment and function description
>sp|Q9HDV4|LID2_SCHPO Lid2 complex component lid2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lid2 PE=1 SV=1 Back     alignment and function description
>sp|Q5TKR9|KAT6A_RAT Histone acetyltransferase KAT6A OS=Rattus norvegicus GN=Kat6a PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query437
224121224486 predicted protein [Populus trichocarpa] 0.917 0.825 0.486 1e-100
255574123412 conserved hypothetical protein [Ricinus 0.931 0.987 0.458 6e-97
356517838487 PREDICTED: uncharacterized protein LOC10 0.974 0.874 0.357 7e-69
449457271512 PREDICTED: uncharacterized protein LOC10 0.791 0.675 0.410 8e-63
224087304 651 predicted protein [Populus trichocarpa] 0.695 0.466 0.423 8e-60
224142701 714 predicted protein [Populus trichocarpa] 0.693 0.424 0.409 1e-55
356507021224 PREDICTED: bromodomain adjacent to zinc 0.478 0.933 0.497 2e-54
218194845470 hypothetical protein OsI_15901 [Oryza sa 0.608 0.565 0.413 4e-54
297602727437 Os04g0425100 [Oryza sativa Japonica Grou 0.608 0.608 0.413 2e-53
222628869465 hypothetical protein OsJ_14815 [Oryza sa 0.606 0.569 0.408 5e-52
>gi|224121224|ref|XP_002330774.1| predicted protein [Populus trichocarpa] gi|222872576|gb|EEF09707.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  370 bits (950), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 214/440 (48%), Positives = 272/440 (61%), Gaps = 39/440 (8%)

Query: 1   MLIQSSAPTSVEAAMTFAPSHGEQDLLCKWRPTERWKGYAECSELPKEVSELLIASNISE 60
           +++ S  P+SVEAA+ FAP++  QDL  +W P + WK          + S  LIA N  E
Sbjct: 78  IMLHSLIPSSVEAALPFAPNYSRQDLFSEWVPEKAWK----------DGSNPLIAGNCYE 127

Query: 61  NSGLNLVKRRKIQKNSVIVFPVEAETDEVRVEEGSSKSQVEYDNSVVIALPAPTSIVGSN 120
             G  + ++R+  K S I+  VE ETD+      +    V  D+ V              
Sbjct: 128 IPGSYVARKRR--KKSAIMSSVEPETDKAPTNAVNCDPPVVNDDGV-------------- 171

Query: 121 KELRSKNIRS----SKSKMGVGCCNRNTEGSDISNSDISRLEVLDEDPSAREFCVSVLRS 176
              R++ I S    SKS MGVG        S+I     S LEV  +D S RE C SVLRS
Sbjct: 172 ---RARTIPSVVAKSKSGMGVGSITARINISNIVELPDSELEVSGDDLSIRELCTSVLRS 228

Query: 177 NGLLGAVGECSVRSVASGEVSGTGHEISVIQSCKLCGKADNTSTMLLCDYCDEAFHPSCC 236
           +GLL   G+C V + A  EV G     +  QSC+LCG  +    MLLCD+C+EAFH SCC
Sbjct: 229 HGLLA--GDCPVSNSAPIEVLGNIKNNNFFQSCELCGNLEKALNMLLCDHCEEAFHLSCC 286

Query: 237 NPRIKILPTDNWLCQCCSNLNSNVSQENSFLKSPNNSWMYGKPRSEMGRIALMLKYPEPY 296
           N  +++LPTD W C  CS LN NVSQE SFLK+ + SW   K  S++G IA MLKYPE +
Sbjct: 287 NLNMEMLPTDLWFCPSCSKLNHNVSQETSFLKTCSISWWNEK--SKLGPIASMLKYPEAH 344

Query: 297 TSRVRIGESYQAEVPDWSDQISSNLDSFSEPLEMDPAETVGLNVQFSNQFSKPDSISNWL 356
           TSRVRIG SYQA VP+WSDQ+S + D F EP+E+D ++TV L+    ++ S    +SNWL
Sbjct: 345 TSRVRIGTSYQATVPEWSDQLSMDSDCFGEPIEIDTSQTVCLHECPQDRSSNAKPMSNWL 404

Query: 357 QCQEVLTNNDTNVCVEGTKCGKWRRAPFSEVQTDSWDCSCAILWDPLHSDCAVPQELETD 416
           QC+EVL  +D    +EGT CGKWRRAPFSEVQTDSWDCSC++LWDP HSDC  PQELETD
Sbjct: 405 QCREVL--HDDARGIEGTICGKWRRAPFSEVQTDSWDCSCSVLWDPSHSDCTAPQELETD 462

Query: 417 QVLRQLKYIEELKSRLGVKK 436
           +VLRQLKY+E+L+ RL  KK
Sbjct: 463 EVLRQLKYVEQLRLRLVAKK 482

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255574123|ref|XP_002527977.1| conserved hypothetical protein [Ricinus communis] gi|223532603|gb|EEF34389.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|356517838|ref|XP_003527593.1| PREDICTED: uncharacterized protein LOC100800660 [Glycine max] Back     alignment and taxonomy information
>gi|449457271|ref|XP_004146372.1| PREDICTED: uncharacterized protein LOC101212408 [Cucumis sativus] Back     alignment and taxonomy information
>gi|224087304|ref|XP_002308115.1| predicted protein [Populus trichocarpa] gi|222854091|gb|EEE91638.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224142701|ref|XP_002324693.1| predicted protein [Populus trichocarpa] gi|222866127|gb|EEF03258.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356507021|ref|XP_003522270.1| PREDICTED: bromodomain adjacent to zinc finger domain protein 2A-like [Glycine max] Back     alignment and taxonomy information
>gi|218194845|gb|EEC77272.1| hypothetical protein OsI_15901 [Oryza sativa Indica Group] Back     alignment and taxonomy information
>gi|297602727|ref|NP_001052802.2| Os04g0425100 [Oryza sativa Japonica Group] gi|255675461|dbj|BAF14716.2| Os04g0425100 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|222628869|gb|EEE61001.1| hypothetical protein OsJ_14815 [Oryza sativa Japonica Group] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query437
TAIR|locus:2047630631 AT2G19260 "AT2G19260" [Arabido 0.615 0.426 0.337 1.1e-34
UNIPROTKB|B7ZS371698 baz2a "Bromodomain adjacent to 0.141 0.036 0.393 3.6e-07
ZFIN|ZDB-GENE-120215-90 1263 si:ch73-39g20.1 "si:ch73-39g20 0.135 0.046 0.355 3.5e-06
UNIPROTKB|H0YMU7 826 MLL3 "Histone-lysine N-methylt 0.112 0.059 0.423 6e-06
UNIPROTKB|F1MG251456 BAZ2B "Uncharacterized protein 0.137 0.041 0.380 1.1e-05
UNIPROTKB|J3QQU3129 PHF12 "PHD finger protein 12" 0.100 0.341 0.387 1.8e-05
POMBASE|SPBP19A11.06 1513 lid2 "Lid2 complex subunit, pr 0.265 0.076 0.272 2.2e-05
TAIR|locus:2195945522 AT1G77250 "AT1G77250" [Arabido 0.139 0.116 0.377 2.6e-05
FB|FBgn0263667 1482 Lpt "Lost PHDs of trr" [Drosop 0.132 0.039 0.377 2.8e-05
ZFIN|ZDB-GENE-041014-190391 dpf3 "D4, zinc and double PHD 0.114 0.127 0.4 3.4e-05
TAIR|locus:2047630 AT2G19260 "AT2G19260" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 353 (129.3 bits), Expect = 1.1e-34, Sum P(2) = 1.1e-34
 Identities = 103/305 (33%), Positives = 147/305 (48%)

Query:   144 TEGSDISNSDISRLEVLDEDPSAREFCVSVLRSNGLLGAVGECSVRSVASGEVSGTG--- 200
             T+ +    S +S  E+LD+       C S        G    CS    +S EV+ T    
Sbjct:   334 TKKNGDQRSTVSSRELLDDTQVTEVTCSSD-------GTNDSCSSLK-SSSEVNSTSSKS 385

Query:   201 HEISVIQSCKLCGKAD---NTSTMLLCDYCDEAFHPSCCNPRIKILPTDN----WLCQCC 253
              E     S     + D   ++S    C +CD+   P       K+L  D     +  +CC
Sbjct:   386 REDDCYSSDSGVSETDTDGSSSPFRQCKHCDK---PGTVE---KMLICDECEEAYHTRCC 439

Query:   254 SNLNSNVSQENSFLKSPNNSWMYGKPRSEMGRIALMLKY--PEPYTSRVRIGESYQAEVP 311
                  +V++ + +L  P+            GRI+   K+    P+   +RIG+ +QA+VP
Sbjct:   440 GVQMKDVAEIDEWL-CPSCLKNQSSKTKTKGRISHERKWRVTVPFVIGIRIGKMFQADVP 498

Query:   312 DWSDQISSNLDSFSEPLEMDPAETVGLNVQFSNQFSKPDSISNWLQCQEVLTNNDTNVCV 371
             DWS    S+     EPLE+  +E +  +++ +    K  S  NWLQC+E     DTN   
Sbjct:   499 DWSGPTMSDTSFVGEPLEIGQSEYMH-DLKKAKNSKKQCSAVNWLQCRE----EDTN--- 550

Query:   372 EGTKCGKWRRAPFSEVQTDSWDCSCAILWDPLHSDCAVPQELETDQVLRQLKYIEELKSR 431
              G  CGKWRRAP SEVQT  W+C C   WDP  +DCAVPQELET ++L+QLKYI+ L+ R
Sbjct:   551 -GVICGKWRRAPRSEVQTKDWECFCCFSWDPSRADCAVPQELETSEILKQLKYIKMLRPR 609

Query:   432 LGVKK 436
                KK
Sbjct:   610 SDAKK 614
GO:0003677 "DNA binding" evidence=ISS
GO:0005634 "nucleus" evidence=ISM
GO:0006355 "regulation of transcription, DNA-dependent" evidence=ISS
GO:0008270 "zinc ion binding" evidence=IEA
UNIPROTKB|B7ZS37 baz2a "Bromodomain adjacent to zinc finger domain protein 2A" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-120215-90 si:ch73-39g20.1 "si:ch73-39g20.1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|H0YMU7 MLL3 "Histone-lysine N-methyltransferase MLL3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1MG25 BAZ2B "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|J3QQU3 PHF12 "PHD finger protein 12" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
POMBASE|SPBP19A11.06 lid2 "Lid2 complex subunit, predicted histone demethylase Lid2" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
TAIR|locus:2195945 AT1G77250 "AT1G77250" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
FB|FBgn0263667 Lpt "Lost PHDs of trr" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-041014-190 dpf3 "D4, zinc and double PHD fingers, family 3" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.01470065
hypothetical protein (486 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query437
pfam0062851 pfam00628, PHD, PHD-finger 6e-09
smart0024947 smart00249, PHD, PHD zinc finger 2e-08
pfam0749650 pfam07496, zf-CW, CW-type Zinc Finger 0.001
>gnl|CDD|201356 pfam00628, PHD, PHD-finger Back     alignment and domain information 
 Score = 51.3 bits (123), Expect = 6e-09
 Identities = 19/49 (38%), Positives = 26/49 (53%), Gaps = 2/49 (4%)

Query: 209 CKLCGKADNTSTMLLCDYCDEAFHPSCCNPRIKI--LPTDNWLCQCCSN 255
           C +CGK D+   +LLCD CD  FH +C  P ++   +P   W C  C  
Sbjct: 2   CAVCGKVDDDGELLLCDGCDRWFHLACLGPPLEPEEIPEGEWYCPECKP 50

PHD folds into an interleaved type of Zn-finger chelating 2 Zn ions in a similar manner to that of the RING and FYVE domains. Several PHD fingers have been identified as binding modules of methylated histone H3. Length = 51
>gnl|CDD|214584 smart00249, PHD, PHD zinc finger Back     alignment and domain information
>gnl|CDD|219431 pfam07496, zf-CW, CW-type Zinc Finger Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 437
KOG0825 1134 consensus PHD Zn-finger protein [General function 99.59
KOG1244336 consensus Predicted transcription factor Requiem/N 99.51
KOG0383 696 consensus Predicted helicase [General function pre 99.45
KOG1512381 consensus PHD Zn-finger protein [General function 99.22
KOG4443 694 consensus Putative transcription factor HALR/MLL3, 98.89
PF0062851 PHD: PHD-finger; InterPro: IPR019787 Zinc finger ( 98.87
KOG4299 613 consensus PHD Zn-finger protein [General function 98.65
smart0024947 PHD PHD zinc finger. The plant homeodomain (PHD) f 98.61
cd04718148 BAH_plant_2 BAH, or Bromo Adjacent Homology domain 98.43
PF0749650 zf-CW: CW-type Zinc Finger; InterPro: IPR011124 Zi 98.33
KOG0957707 consensus PHD finger protein [General function pre 98.03
KOG0955 1051 consensus PHD finger protein BR140/LIN-49 [General 98.0
KOG12451404 consensus Chromatin remodeling complex WSTF-ISWI, 97.96
KOG1973274 consensus Chromatin remodeling protein, contains P 97.95
COG5141 669 PHD zinc finger-containing protein [General functi 97.56
KOG4323464 consensus Polycomb-like PHD Zn-finger protein [Gen 97.34
COG5034271 TNG2 Chromatin remodeling protein, contains PhD zi 97.31
KOG0954 893 consensus PHD finger protein [General function pre 96.77
KOG0956 900 consensus PHD finger protein AF10 [General functio 96.56
PF1383136 PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A. 96.52
PHA02929238 N1R/p28-like protein; Provisional 94.44
KOG1246 904 consensus DNA-binding protein jumonji/RBP2/SMCY, c 93.93
KOG1473 1414 consensus Nucleosome remodeling factor, subunit NU 93.59
PHA02926242 zinc finger-like protein; Provisional 92.96
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 87.02
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 85.03
PF15446175 zf-PHD-like: PHD/FYVE-zinc-finger like domain 85.0
PF0144855 ELM2: ELM2 domain; InterPro: IPR000949 The ELM2 (E 82.86
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information 
Probab=99.59  E-value=3.1e-16  Score=169.41  Aligned_cols=109  Identities=26%  Similarity=0.477  Sum_probs=89.3

Q ss_pred             CCCCCCCCCcccCCCC-----CCCcchhhhHHHhhhccccccccccccccccccccCC--------C-------------
Q 013731          146 GSDISNSDISRLEVLD-----EDPSAREFCVSVLRSNGLLGAVGECSVRSVASGEVSG--------T-------------  199 (437)
Q Consensus       146 ~dd~eeC~ic~~~~~~-----ed~s~h~fCis~L~s~g~l~~v~~Cp~~~~t~~~~~~--------w-------------  199 (437)
                      -.+.+.|++|+..++.     +..|+|.||-+||.+|..+.  .+||+++..|.++..        |             
T Consensus       120 ~~~~~~CP~Ci~s~~DqL~~~~k~c~H~FC~~Ci~sWsR~a--qTCPiDR~EF~~v~V~eS~~~~~~vR~lP~EEs~~~~  197 (1134)
T KOG0825|consen  120 THVENQCPNCLKSCNDQLEESEKHTAHYFCEECVGSWSRCA--QTCPVDRGEFGEVKVLESTGIEANVRCLPSEESENIL  197 (1134)
T ss_pred             hhhhhhhhHHHHHHHHHhhccccccccccHHHHhhhhhhhc--ccCchhhhhhheeeeeccccccceeEecchhhhhhhh
Confidence            5667899999999743     45799999999999999555  999999987754321        1             


Q ss_pred             -----------cccccccccccccccCCCCCCeEEeccCCCC-CCCcccCCCCCCCCCCCCcCccCcCC
Q 013731          200 -----------GHEISVIQSCKLCGKADNTSTMLLCDYCDEA-FHPSCCNPRIKILPTDNWLCQCCSNL  256 (437)
Q Consensus       200 -----------~c~~c~~~~C~vCg~~~~~~~LLlCD~Cd~a-yH~~CL~PPL~~iP~g~W~Cp~C~~~  256 (437)
                                 .-..-....|.+|+..+.++.||+||.|+.+ ||+|||+|+|.++|.+.|||++|...
T Consensus       198 e~~~d~~~d~~~~~~~E~~~C~IC~~~DpEdVLLLCDsCN~~~YH~YCLDPdl~eiP~~eWYC~NC~dL  266 (1134)
T KOG0825|consen  198 EKGGDEKQDQISGLSQEEVKCDICTVHDPEDVLLLCDSCNKVYYHVYCLDPDLSESPVNEWYCTNCSLL  266 (1134)
T ss_pred             hhccccccccccCcccccccceeeccCChHHhheeecccccceeeccccCcccccccccceecCcchhh
Confidence                       0011124579999999999999999999999 99999999999999999999999754

>KOG1244 consensus Predicted transcription factor Requiem/NEURO-D4 [Transcription] Back     alignment and domain information
>KOG0383 consensus Predicted helicase [General function prediction only] Back     alignment and domain information
>KOG1512 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG4443 consensus Putative transcription factor HALR/MLL3, involved in embryonic development [General function prediction only] Back     alignment and domain information
>PF00628 PHD: PHD-finger; InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG4299 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>smart00249 PHD PHD zinc finger Back     alignment and domain information
>cd04718 BAH_plant_2 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function Back     alignment and domain information
>PF07496 zf-CW: CW-type Zinc Finger; InterPro: IPR011124 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG0957 consensus PHD finger protein [General function prediction only] Back     alignment and domain information
>KOG0955 consensus PHD finger protein BR140/LIN-49 [General function prediction only] Back     alignment and domain information
>KOG1245 consensus Chromatin remodeling complex WSTF-ISWI, large subunit (contains heterochromatin localization, PHD and BROMO domains) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1973 consensus Chromatin remodeling protein, contains PHD Zn-finger [Chromatin structure and dynamics] Back     alignment and domain information
>COG5141 PHD zinc finger-containing protein [General function prediction only] Back     alignment and domain information
>KOG4323 consensus Polycomb-like PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>COG5034 TNG2 Chromatin remodeling protein, contains PhD zinc finger [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0954 consensus PHD finger protein [General function prediction only] Back     alignment and domain information
>KOG0956 consensus PHD finger protein AF10 [General function prediction only] Back     alignment and domain information
>PF13831 PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>KOG1246 consensus DNA-binding protein jumonji/RBP2/SMCY, contains JmjC domain [General function prediction only] Back     alignment and domain information
>KOG1473 consensus Nucleosome remodeling factor, subunit NURF301/BPTF [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>PF15446 zf-PHD-like: PHD/FYVE-zinc-finger like domain Back     alignment and domain information
>PF01448 ELM2: ELM2 domain; InterPro: IPR000949 The ELM2 (Egl-27 and MTA1 homology 2) domain is a small domain of unknown function Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query437
3ask_A226 Structure Of Uhrf1 In Complex With Histone Tail Len 5e-05
4gy5_A241 Crystal Structure Of The Tandem Tudor Domain And Pl 5e-05
3zvz_B57 Phd Finger Of Human Uhrf1 Length = 57 7e-05
2ln0_A110 Structure Of Moz Length = 110 8e-05
3v43_A112 Crystal Structure Of Moz Length = 112 9e-05
2kwj_A114 Solution Structures Of The Double Phd Fingers Of Hu 2e-04
1f62_A51 Wstf-Phd Length = 51 3e-04
2ysm_A111 Solution Structure Of The First And Second Phd Doma 3e-04
>pdb|3ASK|A Chain A, Structure Of Uhrf1 In Complex With Histone Tail Length = 226 Back     alignment and structure 
Iteration: 1

 Score = 45.8 bits (107), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 27/49 (55%), Gaps = 1/49 (2%)
Query: 208 SCKLCGKADNTSTMLLCDYCDEAFHPSCCNPRIKILPT-DNWLCQCCSN 255
           +C LCG   +    L+CD CD AFH  C +P +  +P+ D W C  C N
Sbjct: 176 ACHLCGGRQDPDKQLMCDECDMAFHIYCLDPPLSSVPSEDEWYCPECRN 224
>pdb|4GY5|A Chain A, Crystal Structure Of The Tandem Tudor Domain And Plant Homeodomain Of Uhrf1 With Histone H3k9me3 Length = 241 Back     alignment and structure
>pdb|3ZVZ|B Chain B, Phd Finger Of Human Uhrf1 Length = 57 Back     alignment and structure
>pdb|2LN0|A Chain A, Structure Of Moz Length = 110 Back     alignment and structure
>pdb|3V43|A Chain A, Crystal Structure Of Moz Length = 112 Back     alignment and structure
>pdb|2KWJ|A Chain A, Solution Structures Of The Double Phd Fingers Of Human Transcriptional Protein Dpf3 Bound To A Histone Peptide Containing Acetylation At Lysine 14 Length = 114 Back     alignment and structure
>pdb|1F62|A Chain A, Wstf-Phd Length = 51 Back     alignment and structure
>pdb|2YSM|A Chain A, Solution Structure Of The First And Second Phd Domain From MyeloidLYMPHOID OR MIXED-Lineage Leukemia Protein 3 Homolog Length = 111 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query437
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 8e-13
2e6r_A92 Jumonji/ARID domain-containing protein 1D; PHD dom 3e-12
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 6e-12
3asl_A70 E3 ubiquitin-protein ligase UHRF1; histone reader 2e-11
2e6s_A77 E3 ubiquitin-protein ligase UHRF2; PHD domain, str 2e-11
3shb_A77 E3 ubiquitin-protein ligase UHRF1; unmodified hist 3e-11
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 4e-11
2puy_A60 PHD finger protein 21A; PHD finger, histone CODE, 5e-11
3ask_A226 E3 ubiquitin-protein ligase UHRF1; histone reader 6e-11
2k16_A75 Transcription initiation factor TFIID subunit 3; p 7e-11
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 1e-10
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 2e-09
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 1e-10
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 3e-04
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 5e-10
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 7e-10
1xwh_A66 Autoimmune regulator; PHD domain, Zn binding domai 1e-09
1fp0_A88 KAP-1 corepressor; PHD domain, C3HC4 type zinc bin 2e-09
2l7p_A100 Histone-lysine N-methyltransferase ASHH2; CW-domai 3e-08
1wev_A88 Riken cDNA 1110020M19; structural genomics, PHD do 4e-08
2ro1_A189 Transcription intermediary factor 1-beta; KAP, TIF 5e-08
2yt5_A66 Metal-response element-binding transcription facto 6e-08
2ku3_A71 Bromodomain-containing protein 1; PHD finger, chro 2e-07
2l43_A88 N-teminal domain from histone H3.3, linker, PHD1 f 4e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-06
3o7a_A52 PHD finger protein 13 variant; PHF13, zinc finger, 1e-05
3o70_A68 PHD finger protein 13; PHF13, structural genomics 3e-05
2e61_A69 Zinc finger CW-type PWWP domain protein 1; ZF-CW d 3e-05
2ri7_A174 Nucleosome-remodeling factor subunit BPTF; zinc fi 4e-05
1wem_A76 Death associated transcription factor 1; structura 6e-05
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 2e-04
1we9_A64 PHD finger family protein; structural genomics, PH 2e-04
2kgg_A52 Histone demethylase jarid1A; PHD finger, histone m 2e-04
3u5n_A207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 4e-04
2lbm_A142 Transcriptional regulator ATRX; metal binding prot 4e-04
1wep_A79 PHF8; structural genomics, PHD domain, riken struc 6e-04
3ql9_A129 Transcriptional regulator ATRX; zinc finger, trans 6e-04
3kqi_A75 GRC5, PHD finger protein 2; metal-binding, zinc-fi 9e-04
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Length = 51 Back     alignment and structure
 Score = 62.0 bits (151), Expect = 8e-13
 Identities = 17/46 (36%), Positives = 24/46 (52%)

Query: 209 CKLCGKADNTSTMLLCDYCDEAFHPSCCNPRIKILPTDNWLCQCCS 254
           CK+C K      ++LCD C++AFH  C  P +  +P   W C  C 
Sbjct: 3   CKVCRKKGEDDKLILCDECNKAFHLFCLRPALYEVPDGEWQCPACQ 48
>2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Length = 114 Back     alignment and structure
>3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B Length = 70 Back     alignment and structure
>2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 77 Back     alignment and structure
>3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} Length = 77 Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 56 Back     alignment and structure
>2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Length = 60 Back     alignment and structure
>3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} Length = 226 Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Length = 75 Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Length = 112 Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Length = 112 Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Length = 61 Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Length = 61 Back     alignment and structure
>1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Length = 66 Back     alignment and structure
>1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Length = 88 Back     alignment and structure
>2l7p_A Histone-lysine N-methyltransferase ASHH2; CW-domain; NMR {Arabidopsis thaliana} Length = 100 Back     alignment and structure
>1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Length = 88 Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Length = 189 Back     alignment and structure
>2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Length = 66 Back     alignment and structure
>2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3o7a_A PHD finger protein 13 variant; PHF13, zinc finger, PHD domain, nuclear protein, structural structural genomics consortium, SGC, protein binding; HET: M3L; 1.67A {Homo sapiens} Length = 52 Back     alignment and structure
>3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} Length = 68 Back     alignment and structure
>2e61_A Zinc finger CW-type PWWP domain protein 1; ZF-CW domain, structural genomics, NPPSFA, national project protein structural and functional analyses; NMR {Homo sapiens} PDB: 2rr4_A* Length = 69 Back     alignment and structure
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Length = 174 Back     alignment and structure
>1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 Length = 76 Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Length = 184 Back     alignment and structure
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Length = 64 Back     alignment and structure
>2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* Length = 52 Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Length = 207 Back     alignment and structure
>2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A Length = 142 Back     alignment and structure
>1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 Length = 79 Back     alignment and structure
>3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A Length = 129 Back     alignment and structure
>3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} Length = 75 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query437
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 99.62
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 99.57
3asl_A70 E3 ubiquitin-protein ligase UHRF1; histone reader 99.53
2e6s_A77 E3 ubiquitin-protein ligase UHRF2; PHD domain, str 99.53
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 99.51
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 99.51
3shb_A77 E3 ubiquitin-protein ligase UHRF1; unmodified hist 99.51
2e6r_A92 Jumonji/ARID domain-containing protein 1D; PHD dom 99.49
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 99.43
1fp0_A88 KAP-1 corepressor; PHD domain, C3HC4 type zinc bin 99.42
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 99.4
1xwh_A66 Autoimmune regulator; PHD domain, Zn binding domai 99.39
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 99.38
1wev_A88 Riken cDNA 1110020M19; structural genomics, PHD do 99.37
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 99.36
3ask_A226 E3 ubiquitin-protein ligase UHRF1; histone reader 99.36
2puy_A60 PHD finger protein 21A; PHD finger, histone CODE, 99.34
2yt5_A66 Metal-response element-binding transcription facto 99.32
2ku3_A71 Bromodomain-containing protein 1; PHD finger, chro 99.24
2l43_A88 N-teminal domain from histone H3.3, linker, PHD1 f 99.22
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 99.2
3u5n_A207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 99.19
2ro1_A189 Transcription intermediary factor 1-beta; KAP, TIF 99.15
2k16_A75 Transcription initiation factor TFIID subunit 3; p 99.11
2l7p_A100 Histone-lysine N-methyltransferase ASHH2; CW-domai 99.1
2e61_A69 Zinc finger CW-type PWWP domain protein 1; ZF-CW d 98.88
1wen_A71 Inhibitor of growth family, member 4; ING1-like pr 98.86
2lv9_A98 Histone-lysine N-methyltransferase MLL5; zinc fing 98.85
4gne_A107 Histone-lysine N-methyltransferase NSD3; zinc fing 98.84
1weu_A91 Inhibitor of growth family, member 4; structural g 98.77
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 98.77
2vnf_A60 ING 4, P29ING4, inhibitor of growth protein 4; ace 98.75
3c6w_A59 P28ING5, inhibitor of growth protein 5; chromatin, 98.71
2g6q_A62 Inhibitor of growth protein 2; protein-peptide com 98.65
2jmi_A90 Protein YNG1, ING1 homolog 1; PHD, histone, recogn 98.56
2lbm_A142 Transcriptional regulator ATRX; metal binding prot 98.49
3o70_A68 PHD finger protein 13; PHF13, structural genomics 98.32
1x4i_A70 Inhibitor of growth protein 3; structural genomics 98.32
3ql9_A129 Transcriptional regulator ATRX; zinc finger, trans 98.2
1we9_A64 PHD finger family protein; structural genomics, PH 98.2
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 98.11
1wee_A72 PHD finger family protein; structural genomics, PH 98.07
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 98.04
3o7a_A52 PHD finger protein 13 variant; PHF13, zinc finger, 98.03
2xb1_A105 Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; 98.01
2vpb_A65 Hpygo1, pygopus homolog 1; gene regulation, WNT si 97.98
1wew_A78 DNA-binding family protein; structural genomics, P 97.95
1wem_A76 Death associated transcription factor 1; structura 97.92
1wep_A79 PHF8; structural genomics, PHD domain, riken struc 97.89
2rsd_A68 E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant 97.87
2kgg_A52 Histone demethylase jarid1A; PHD finger, histone m 97.8
2ri7_A174 Nucleosome-remodeling factor subunit BPTF; zinc fi 97.72
3kqi_A75 GRC5, PHD finger protein 2; metal-binding, zinc-fi 97.59
3lqh_A183 Histone-lysine N-methyltransferase MLL; PHD finger 97.23
1wil_A89 KIAA1045 protein; ring finger domain, structural g 97.23
2ee1_A64 Chromodomain helicase-DNA-binding protein 4; EC 3. 97.22
4bbq_A117 Lysine-specific demethylase 2A; oxidoreductase, ub 97.07
4gne_A107 Histone-lysine N-methyltransferase NSD3; zinc fing 97.02
3kv5_D 488 JMJC domain-containing histone demethylation prote 96.8
3pur_A 528 Lysine-specific demethylase 7 homolog; oxidoreduct 96.64
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 96.07
3kv4_A 447 PHD finger protein 8; epigenetics, histone CODE, c 95.69
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 95.0
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 94.24
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 93.89
2ect_A78 Ring finger protein 126; metal binding protein, st 93.76
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 93.69
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 93.67
2ysl_A73 Tripartite motif-containing protein 31; ring-type 93.46
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 93.32
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 93.07
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 92.26
2ysj_A63 Tripartite motif-containing protein 31; ring-type 91.67
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 91.64
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 91.32
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 91.16
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 90.71
3rsn_A177 SET1/ASH2 histone methyltransferase complex subun; 90.7
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 90.54
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 90.53
2epb_A68 Chromodomain-helicase-DNA-binding protein 6; struc 90.01
2ecm_A55 Ring finger and CHY zinc finger domain- containing 89.95
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 89.77
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 89.32
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 89.16
2ecw_A85 Tripartite motif-containing protein 30; metal bind 88.38
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 88.28
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 88.0
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 87.07
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 86.64
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 86.49
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 86.47
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 86.22
4bbq_A117 Lysine-specific demethylase 2A; oxidoreductase, ub 85.38
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 85.33
2pv0_B386 DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, 84.19
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 83.76
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 83.07
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 82.03
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 81.07
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
Probab=99.62  E-value=1.8e-16  Score=134.97  Aligned_cols=101  Identities=27%  Similarity=0.539  Sum_probs=78.3

Q ss_pred             CCCCCCCCcccCCCCCCCcchhhhHHHhhhccccccccccccccccccccCCCcccccccccccccccCCCCCCeEEecc
Q 013731          147 SDISNSDISRLEVLDEDPSAREFCVSVLRSNGLLGAVGECSVRSVASGEVSGTGHEISVIQSCKLCGKADNTSTMLLCDY  226 (437)
Q Consensus       147 dd~eeC~ic~~~~~~ed~s~h~fCis~L~s~g~l~~v~~Cp~~~~t~~~~~~w~c~~c~~~~C~vCg~~~~~~~LLlCD~  226 (437)
                      .+...|.+|...   ++.....+|..|-+.   ++  ..|......+..+..|+|.+|  ..|.+|++.+++..||+||.
T Consensus         5 ~~~~~C~~C~~~---g~~~~ll~C~~C~~~---~H--~~Cl~~~~~~~~~~~W~C~~C--~~C~~C~~~~~~~~ll~Cd~   74 (111)
T 2ysm_A            5 SSGANCAVCDSP---GDLLDQFFCTTCGQH---YH--GMCLDIAVTPLKRAGWQCPEC--KVCQNCKQSGEDSKMLVCDT   74 (111)
T ss_dssp             CCCSCBTTTCCC---CCTTTSEECSSSCCE---EC--TTTTTCCCCTTTSTTCCCTTT--CCCTTTCCCSCCTTEEECSS
T ss_pred             CCCCCCcCCCCC---CCCcCCeECCCCCCC---cC--hHHhCCccccccccCccCCcC--CcccccCccCCCCCeeECCC
Confidence            344568888754   333344555544322   22  456666555555689999999  89999999999999999999


Q ss_pred             CCCCCCCcccCCCCCCCCCCCCcCccCcCCC
Q 013731          227 CDEAFHPSCCNPRIKILPTDNWLCQCCSNLN  257 (437)
Q Consensus       227 Cd~ayH~~CL~PPL~~iP~g~W~Cp~C~~~~  257 (437)
                      |+++||++||+|||..+|.|+|||+.|....
T Consensus        75 C~~~yH~~Cl~ppl~~~P~g~W~C~~C~~c~  105 (111)
T 2ysm_A           75 CDKGYHTFCLQPVMKSVPTNGWKCKNCRICI  105 (111)
T ss_dssp             SCCEEEGGGSSSCCSSCCSSCCCCHHHHCCS
T ss_pred             CCcHHhHHhcCCccccCCCCCcCCcCCcCcC
Confidence            9999999999999999999999999997754
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Back     alignment and structure
>3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B Back     alignment and structure
>2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Back     alignment and structure
>3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} Back     alignment and structure
>2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Back     alignment and structure
>1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} Back     alignment and structure
>2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Back     alignment and structure
>2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Back     alignment and structure
>2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Back     alignment and structure
>2l7p_A Histone-lysine N-methyltransferase ASHH2; CW-domain; NMR {Arabidopsis thaliana} Back     alignment and structure
>2e61_A Zinc finger CW-type PWWP domain protein 1; ZF-CW domain, structural genomics, NPPSFA, national project protein structural and functional analyses; NMR {Homo sapiens} PDB: 2rr4_A* Back     alignment and structure
>1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A Back     alignment and structure
>2lv9_A Histone-lysine N-methyltransferase MLL5; zinc finger, transcription, protein binding, NESG, northeast structural genomics consortium, SGC; NMR {Homo sapiens} Back     alignment and structure
>4gne_A Histone-lysine N-methyltransferase NSD3; zinc finger, transcription, nuclear protein, transf nuclear protein complex; 1.47A {Homo sapiens} PDB: 4gnd_A 4gnf_A 4gng_A* Back     alignment and structure
>1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* Back     alignment and structure
>3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* Back     alignment and structure
>2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} Back     alignment and structure
>2jmi_A Protein YNG1, ING1 homolog 1; PHD, histone, recognition, yeast, protein binding; NMR {Saccharomyces cerevisiae} PDB: 2jmj_A* Back     alignment and structure
>2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A Back     alignment and structure
>3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} Back     alignment and structure
>1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A Back     alignment and structure
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Back     alignment and structure
>1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Back     alignment and structure
>3o7a_A PHD finger protein 13 variant; PHF13, zinc finger, PHD domain, nuclear protein, structural structural genomics consortium, SGC, protein binding; HET: M3L; 1.67A {Homo sapiens} Back     alignment and structure
>2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} Back     alignment and structure
>2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* Back     alignment and structure
>1wew_A DNA-binding family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2rsd_A E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant homeodomain (PHD), histone binding; NMR {Oryza sativa japonica group} Back     alignment and structure
>2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* Back     alignment and structure
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Back     alignment and structure
>3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Back     alignment and structure
>1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 Back     alignment and structure
>2ee1_A Chromodomain helicase-DNA-binding protein 4; EC 3.6.1.-, ATP- dependent helicase CHD4, CHD-4, MI-2 autoantigen 218 kDa protein, MI2-beta; NMR {Homo sapiens} Back     alignment and structure
>4bbq_A Lysine-specific demethylase 2A; oxidoreductase, ubiquitin, ligase, ubiquitination, demethyla ZF-CXXC DNA binding domain, CPG island, chromatin; 2.24A {Homo sapiens} Back     alignment and structure
>4gne_A Histone-lysine N-methyltransferase NSD3; zinc finger, transcription, nuclear protein, transf nuclear protein complex; 1.47A {Homo sapiens} PDB: 4gnd_A 4gnf_A 4gng_A* Back     alignment and structure
>3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* Back     alignment and structure
>3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens} Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>3rsn_A SET1/ASH2 histone methyltransferase complex subun; PHD domain, winged helix domain, binding, transcription; 2.10A {Homo sapiens} PDB: 3s32_A Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2epb_A Chromodomain-helicase-DNA-binding protein 6; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4bbq_A Lysine-specific demethylase 2A; oxidoreductase, ubiquitin, ligase, ubiquitination, demethyla ZF-CXXC DNA binding domain, CPG island, chromatin; 2.24A {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2pv0_B DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, unmethylated H3K4, de novo DNA methylation, transferase regulator; HET: DNA; 3.30A {Homo sapiens} PDB: 2pvc_B* Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 437
d1f62a_51 g.50.1.2 (A:) Williams-Beuren syndrome transcripti 7e-12
d1fp0a170 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF- 6e-11
d1mm2a_61 g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens 2e-09
d1weva_88 g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus mu 4e-08
d1weea_72 g.50.1.2 (A:) PHD finger protein At1g33420 {Thale 9e-08
d1we9a_64 g.50.1.2 (A:) PHD finger protein At5g26210 {Thale 5e-07
d1wema_76 g.50.1.2 (A:) Death associated transcription facto 4e-06
d1wepa_79 g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus mus 1e-04
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Length = 51 Back     information, alignment and structure

class: Small proteins
fold: FYVE/PHD zinc finger
superfamily: FYVE/PHD zinc finger
family: PHD domain
domain: Williams-Beuren syndrome transcription factor, WSTF
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 57.7 bits (139), Expect = 7e-12
 Identities = 17/45 (37%), Positives = 24/45 (53%)

Query: 209 CKLCGKADNTSTMLLCDYCDEAFHPSCCNPRIKILPTDNWLCQCC 253
           CK+C K      ++LCD C++AFH  C  P +  +P   W C  C
Sbjct: 3   CKVCRKKGEDDKLILCDECNKAFHLFCLRPALYEVPDGEWQCPAC 47
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Length = 70 Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Length = 61 Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Length = 88 Back     information, alignment and structure
>d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 72 Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 64 Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 76 Back     information, alignment and structure
>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query437
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 99.39
d1fp0a170 Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo 99.31
d1mm2a_61 Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 99.15
d1weva_88 PHD finger protein 22 {Mouse (Mus musculus) [TaxId 98.87
d1wesa_71 PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu 98.64
d1weea_72 PHD finger protein At1g33420 {Thale cress (Arabido 98.61
d2pnxa151 Inhibitor of growth protein 4, Ing4 {Homo sapiens 98.59
d1we9a_64 PHD finger protein At5g26210 {Thale cress (Arabido 98.57
d1wepa_79 PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 98.26
d1wema_76 Death associated transcription factor 1, Datf1 (DI 98.09
d1wewa_78 Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop 97.77
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 95.53
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 93.07
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 92.57
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 90.33
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 89.68
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 88.82
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 88.69
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 88.35
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 83.39
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: FYVE/PHD zinc finger
superfamily: FYVE/PHD zinc finger
family: PHD domain
domain: Williams-Beuren syndrome transcription factor, WSTF
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.39  E-value=5.2e-14  Score=102.92  Aligned_cols=49  Identities=35%  Similarity=0.946  Sum_probs=46.1

Q ss_pred             cccccccCCCCCCeEEeccCCCCCCCcccCCCCCCCCCCCCcCccCcCC
Q 013731          208 SCKLCGKADNTSTMLLCDYCDEAFHPSCCNPRIKILPTDNWLCQCCSNL  256 (437)
Q Consensus       208 ~C~vCg~~~~~~~LLlCD~Cd~ayH~~CL~PPL~~iP~g~W~Cp~C~~~  256 (437)
                      .|.+|++.++++.||+||.|+.+||++|++||+..+|.++|+|+.|...
T Consensus         2 ~C~vC~~~~~~~~~i~Cd~C~~~~H~~C~~p~~~~~p~~~W~C~~C~~~   50 (51)
T d1f62a_           2 RCKVCRKKGEDDKLILCDECNKAFHLFCLRPALYEVPDGEWQCPACQPA   50 (51)
T ss_dssp             CCTTTCCSSCCSCCEECTTTCCEECHHHHCTTCCSCCSSCCSCTTTSCC
T ss_pred             CCcCcCCCCCCCCEEEcCCCCCCCCCCCCCCCCCcCCCCCEECcCCcCc
Confidence            5889999999999999999999999999999999999999999999753
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure