Citrus Sinensis ID: 013896

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430----
MAVEDEDINPQKKKAPSEDDKRRMKIVPGSLMKAVMRPGGGDSTPSDGDQVAYHCTVRTLDGVIVESTRSEYGGKGIPIRHVLGKSKILLGLLEGIPTMLKGEVSMFKMKPQMHYGEDDCPVAAPSTFPKDEELHFEIEMIDFAKAKIIADDFGVVKKVINEGQGWETPRAPYEVKAWISAKTGDGKLILSHREGEPYFFTFGKSEVPKGLEMGIGTMTREEKAVIYVTSQYLTPSPLMPVVEGCEEVHFEVELVHLIQVRDMLGDGRLIKRRIRDGKGEFPMDCPLHDSLLCVHYKGMLLNEEKKVFYDTRVDNDGQPLEFSSGEGLVPEGFEMCVRLMLPGEIALVTCPPDYAYDKFLRPANVPEGAHIQWEIELLGFEKPKDWTGLSFDGIMDEAEKIRVTGNRLFKEGKFELAKAKYEKVIFSVLKIACG
ccccccccccccccccccccccccEEccccEEEEEEEccccccccccccEEEEEEEEEEccccEEEEcccccccccccEEEEccccccccHHHHHHcccccccEEEEEEccccccccccccccccccccccccEEEEEEEEccccccccccccccEEEEEEccccccccccccEEEEEEEEEEccccEEEEccccccEEEEcccccccccHHHHHHccccccEEEEEEcccccccccccccccccccEEEEEEEEcEEEEEcccccccEEEEEEEcccccccccccccccEEEEEEEEEEEcccccEEEEcccccccccEEEEcccccccHHHHHHHHccccccEEEEEEcccccccccccccccccccEEEEEEEEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccc
cccccccccccccccccccccccEEcccccEEEEEEcccccccccccccEEEEEEEEEEccccEEccccccccccccEEEEEEccccEHHHHHHHHHHcccccEEEEEEcccccccccccccccccccccccEEEEEEEEEEccccccccccccEEEEEEEccccccccccccEEEEEEEEEEcccEEEccccccccEEEEEcccccHHHHHHHHHHcccccEEEEEEccccccccccccccccccEEEEEEEEEEccccccccccccEEEEEEEcccccccccccccccEEEEEEEEEEEcccccEEEcccccccccEEEEEEccccccHHHHHHHHHcccccEEEEEEccHHcccccccccccccccEEEEEEEEEEcccccccEEEcccccHHHHHHHHHcccHHccccHHHHHHHHHHHHHHHHHHcccc
mavededinpqkkkapseddkrrmkivpgslmkavmrpgggdstpsdgdqvayhctvrtldgvivestrseyggkgipirhvLGKSKILLGLlegiptmlkgevsmfkmkpqmhygeddcpvaapstfpkdeelhFEIEMIDFAKAKIIADDFGVVKKVINegqgwetprapyeVKAWISaktgdgklilshregepyfftfgksevpkglemgigtmtREEKAVIYVTsqyltpsplmpvvegceEVHFEVELVHLIQVRDMLGDGRLIKRRIrdgkgefpmdcplhdsllcvhykgmllneeKKVFYdtrvdndgqplefssgeglvpeGFEMCVRLMLpgeialvtcppdyaydkflrpanvpegaHIQWEIELlgfekpkdwtglsfdgIMDEAEKIRVTGNRLFKEGKFELAKAKYEKVIFSVLKIACG
mavededinpqkkkapseddkrrmkIVPGSLMKAVMRPGGGDSTPSDGDQVAYHCTVrtldgvivestrseyggkgipirhvLGKSKILLGLLEGIPTMLKGEVSMFKMKPQMHYGEDDCPVAAPSTFPKDEELHFEIEMIDFAKAKIIADDFGVVKKVInegqgwetprapYEVKAWISAKTGDGKLILSHREGEPYfftfgksevpkGLEMGIGTMTREEKAVIYVTSQYLTPSPLMPVVEGCEEVHFEVELVHLIqvrdmlgdgrLIKRRIRdgkgefpmdcPLHDSLLCVHYKGMLLNEEKKVFYDTRVDNDGQPLEFSSGEGLVPEGFEMCVRLMLPGEIALVTCPPDYAYDKFLRPANVPEGAHIQWEIELLGFEKPKDWTGLSFDGIMDEAEKIRVTGnrlfkegkfelakakyekVIFSVLKIACG
MAVEDEDINPQKKKAPSEDDKRRMKIVPGSLMKAVMRpgggdstpsdgdQVAYHCTVRTLDGVIVESTRSEYGGKGIPIRHVLGKSKILLGLLEGIPTMLKGEVSMFKMKPQMHYGEDDCPVAAPSTFPKDEELHFEIEMIDFAKAKIIADDFGVVKKVINEGQGWETPRAPYEVKAWISAKTGDGKLILSHREGEPYFFTFGKSEVPKGLEMGIGTMTREEKAVIYVTSQYLTPSPLMPVVEGCeevhfevelvhlIQVRDMLGDGRLIKRRIRDGKGEFPMDCPLHDSLLCVHYKGMLLNEEKKVFYDTRVDNDGQPLEFSSGEGLVPEGFEMCVRLMLPGEIALVTCPPDYAYDKFLRPANVPEGAHIQWEIELLGFEKPKDWTGLSFDGIMDEAEKIRVTGNRLFKEGKFELAKAKYEKVIFSVLKIACG
**************************************************VAYHCTVRTLDGVIVESTRSEYGGKGIPIRHVLGKSKILLGLLEGIPTMLKGEVSMFKMKPQMHYGEDDCPVAAPSTFPKDEELHFEIEMIDFAKAKIIADDFGVVKKVINEGQGWETPRAPYEVKAWISAKTGDGKLILSHREGEPYFFTFGKSEVPKGLEMGIGTMTREEKAVIYVTSQYLTPSPLMPVVEGCEEVHFEVELVHLIQVRDMLGDGRLIKRRIRDGKGEFPMDCPLHDSLLCVHYKGMLLNEEKKVFYDTRVDNDGQPLEFSSGEGLVPEGFEMCVRLMLPGEIALVTCPPDYAYDKFLRPANVPEGAHIQWEIELLGFEKPKDWTGLSFDGIMDEAEKIRVTGNRLFKEGKFELAKAKYEKVIFSVLKIAC*
****************************GSLMKAVMRPGGGDSTPSDGDQVAYHCTVRTLDGVIVESTRSEYGGKGIPIRHVLGKSKILLGLLEGIPTMLKGEVSMFKMKPQMHYGEDDCP****STFPKDEELHFEIEMIDFAKAKIIADDFGVVK**********TPRAPYEVKAWISAKTGDGKLILSHREGEPYFFTFGKSEVPKGLEMGIGTMTREEKAVIYVTSQYL************EEVHFEVELVHLIQVRDMLGDGRLIKRRIRDGKGEFPMDCPLHDSLLCVHYKGMLLNEEKKVFYDTRVDNDGQPLEFSSGEGLVPEGFEMCVRLMLPGEIALVTCPPDYAYDKFLRPANVPEGAHIQWEIELLGFEKPKDWTGLSFDGIMDEAEKIRVTGNRLFKEGKFELAKAKYEKVIFSVLKIACG
**********************RMKIVPGSLMKAVMRPGGGDSTPSDGDQVAYHCTVRTLDGVIVESTRSEYGGKGIPIRHVLGKSKILLGLLEGIPTMLKGEVSMFKMKPQMHYGEDDCPVAAPSTFPKDEELHFEIEMIDFAKAKIIADDFGVVKKVINEGQGWETPRAPYEVKAWISAKTGDGKLILSHREGEPYFFTFGKSEVPKGLEMGIGTMTREEKAVIYVTSQYLTPSPLMPVVEGCEEVHFEVELVHLIQVRDMLGDGRLIKRRIRDGKGEFPMDCPLHDSLLCVHYKGMLLNEEKKVFYDTRVDNDGQPLEFSSGEGLVPEGFEMCVRLMLPGEIALVTCPPDYAYDKFLRPANVPEGAHIQWEIELLGFEKPKDWTGLSFDGIMDEAEKIRVTGNRLFKEGKFELAKAKYEKVIFSVLKIACG
*********************RRMKIVPGSLMKAVMRPGGGDSTPSDGDQVAYHCTVRTLDGVIVESTRSEYGGKGIPIRHVLGKSKILLGLLEGIPTMLKGEVSMFKMKPQMHYGEDDCPVAAPSTFPKDEELHFEIEMIDFAKAKIIADDFGVVKKVINEGQGWETPRAPYEVKAWISAKTGDGKLILSHREGEPYFFTFGKSEVPKGLEMGIGTMTREEKAVIYVTSQYLTPSPLMPVVEGCEEVHFEVELVHLIQVRDMLGDGRLIKRRIRDGKGEFPMDCPLHDSLLCVHYKGMLLNEEKKVFYDTRVDNDGQPLEFSSGEGLVPEGFEMCVRLMLPGEIALVTCPPDYAYDKFLRPANVPEGAHIQWEIELLGFEKPKDWTGLSFDGIMDEAEKIRVTGNRLFKEGKFELAKAKYEKVIFSVLKIACG
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAVEDEDINPQKKKAPSEDDKRRMKIVPGSLMKAVMRPGGGDSTPSDGDQVAYHCTVRTLDGVIVESTRSEYGGKGIPIRHVLGKSKILLGLLEGIPTMLKGEVSMFKMKPQMHYGEDDCPVAAPSTFPKDEELHFEIEMIDFAKAKIIADDFGVVKKVINEGQGWETPRAPYEVKAWISAKTGDGKLILSHREGEPYFFTFGKSEVPKGLEMGIGTMTREEKAVIYVTSQYLTPSPLMPVVEGCEEVHFEVELVHLIQVRDMLGDGRLIKRRIRDGKGEFPMDCPLHDSLLCVHYKGMLLNEEKKVFYDTRVDNDGQPLEFSSGEGLVPEGFEMCVRLMLPGEIALVTCPPDYAYDKFLRPANVPEGAHIQWEIELLGFEKPKDWTGLSFDGIMDEAEKIRVTGNRLFKEGKFELAKAKYEKVIFSVLKIACG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query434 2.2.26 [Sep-21-2011]
Q7DMA9 635 Peptidyl-prolyl cis-trans yes no 0.976 0.667 0.782 0.0
Q9FJL3 578 Peptidyl-prolyl cis-trans no no 0.921 0.692 0.301 2e-40
Q38931551 Peptidyl-prolyl cis-trans no no 0.907 0.715 0.289 3e-40
Q43207 559 70 kDa peptidyl-prolyl is N/A no 0.838 0.651 0.313 4e-39
Q95L05 457 Peptidyl-prolyl cis-trans N/A no 0.599 0.568 0.271 2e-15
Q9XSI2 457 Peptidyl-prolyl cis-trans N/A no 0.599 0.568 0.271 2e-15
Q9XSH5 457 Peptidyl-prolyl cis-trans N/A no 0.599 0.568 0.271 3e-15
Q9XT11 457 Peptidyl-prolyl cis-trans N/A no 0.599 0.568 0.267 4e-15
Q5RF88 457 Peptidyl-prolyl cis-trans yes no 0.599 0.568 0.264 5e-15
Q13451 457 Peptidyl-prolyl cis-trans no no 0.599 0.568 0.264 1e-14
>sp|Q7DMA9|PAS1_ARATH Peptidyl-prolyl cis-trans isomerase PASTICCINO1 OS=Arabidopsis thaliana GN=PAS1 PE=1 SV=2 Back     alignment and function desciption
 Score =  703 bits (1815), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/428 (78%), Positives = 379/428 (88%), Gaps = 4/428 (0%)

Query: 1   MAVEDE---DINPQKKKAPSEDDKRRMKIVPGSLMKAVMRPGGGDSTPSDGDQVAYHCTV 57
           MAV D+   +  P+KKK+ +EDDKRR KIVPGSL+KAV+RPGGGDS+P DGDQV YHCTV
Sbjct: 1   MAVGDQTEQNYLPKKKKSETEDDKRRKKIVPGSLLKAVVRPGGGDSSPVDGDQVIYHCTV 60

Query: 58  RTLDGVIVESTRSEYGGKGIPIRHVLGKSKILLGLLEGIPTMLKGEVSMFKMKPQMHYGE 117
           RTLDGV+VESTRSE GG+G+PIR VLG SK++LGLLEGIPTM KGE++MFKMKP+MHY E
Sbjct: 61  RTLDGVVVESTRSESGGRGVPIRDVLGNSKMILGLLEGIPTMHKGEIAMFKMKPEMHYAE 120

Query: 118 DDCPVAAPSTFPKDEELHFEIEMIDFAKAKIIADDFGVVKKVINEGQGWETPRAPYEVKA 177
            DCPV+AP  FPKD+ELHFEIE++DF+KAKI +DD GV+KK++NEG+GWE+PR PYEVKA
Sbjct: 121 IDCPVSAPENFPKDDELHFEIELLDFSKAKIASDDLGVIKKILNEGEGWESPREPYEVKA 180

Query: 178 WISAKTGDGKLILSHREGEPYFFTFGKSEVPKGLEMGIGTMTREEKAVIYVTSQYLTPSP 237
            ISAK+GDG +I SH E EPYFFTFGKSEVPKGLE+GIGTM R+EKAVIYV  QYLT SP
Sbjct: 181 RISAKSGDGHVIFSHTE-EPYFFTFGKSEVPKGLEIGIGTMARKEKAVIYVRKQYLTESP 239

Query: 238 LMPVVEGCEEVHFEVELVHLIQVRDMLGDGRLIKRRIRDGKGEFPMDCPLHDSLLCVHYK 297
           L+ + +  EEVHFEVELVH IQVRDMLGDGRLIKRRIRDG+GEFPMDCPL DS L VHYK
Sbjct: 240 LLHIDQDLEEVHFEVELVHFIQVRDMLGDGRLIKRRIRDGRGEFPMDCPLQDSRLSVHYK 299

Query: 298 GMLLNEEKKVFYDTRVDNDGQPLEFSSGEGLVPEGFEMCVRLMLPGEIALVTCPPDYAYD 357
           GMLLNEEK VFYD+++DN+ QPLEFSSGEGLVPEGFEMC RLMLPGEIALVTCPPDYAYD
Sbjct: 300 GMLLNEEKTVFYDSKIDNNDQPLEFSSGEGLVPEGFEMCTRLMLPGEIALVTCPPDYAYD 359

Query: 358 KFLRPANVPEGAHIQWEIELLGFEKPKDWTGLSFDGIMDEAEKIRVTGNRLFKEGKFELA 417
           KF RP  V EGAH+QWEIELLGFE P+DWTGL+F  IMDEA+KIR TGNRLFKEGKFELA
Sbjct: 360 KFPRPPGVSEGAHVQWEIELLGFETPRDWTGLNFQSIMDEADKIRSTGNRLFKEGKFELA 419

Query: 418 KAKYEKVI 425
           KAKYEKV+
Sbjct: 420 KAKYEKVL 427
PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides (By similarity). Essential protein regulating cell division, adhesion and elongation throughout the plant development and embryogenesis. Required for the spatial organization of apical meristems. Involved in the hormonal control of cell division and differentiation mediated by cytokinins and auxin. Regulates the function of NAC089 transcription factor by controlling its targeting to the nucleus upon plant cell division. Interacts with enzymes of the fatty acid elongase complex and favors the generation of very-long-chain fatty acids (VLCFAs) required for polar auxin transport and tissue patterning during plant development.
Arabidopsis thaliana (taxid: 3702)
EC: 5EC: .EC: 2EC: .EC: 1EC: .EC: 8
>sp|Q9FJL3|FKB65_ARATH Peptidyl-prolyl cis-trans isomerase FKBP65 OS=Arabidopsis thaliana GN=FKBP65 PE=1 SV=1 Back     alignment and function description
>sp|Q38931|FKB62_ARATH Peptidyl-prolyl cis-trans isomerase FKBP62 OS=Arabidopsis thaliana GN=FKBP62 PE=1 SV=2 Back     alignment and function description
>sp|Q43207|FKB70_WHEAT 70 kDa peptidyl-prolyl isomerase OS=Triticum aestivum GN=FKBP70 PE=1 SV=1 Back     alignment and function description
>sp|Q95L05|FKBP5_CHLAE Peptidyl-prolyl cis-trans isomerase FKBP5 OS=Chlorocebus aethiops GN=FKBP5 PE=2 SV=1 Back     alignment and function description
>sp|Q9XSI2|FKBP5_SAGOE Peptidyl-prolyl cis-trans isomerase FKBP5 OS=Saguinus oedipus GN=FKBP5 PE=2 SV=2 Back     alignment and function description
>sp|Q9XSH5|FKBP5_SAIBB Peptidyl-prolyl cis-trans isomerase FKBP5 OS=Saimiri boliviensis boliviensis GN=FKBP5 PE=1 SV=1 Back     alignment and function description
>sp|Q9XT11|FKBP5_AOTNA Peptidyl-prolyl cis-trans isomerase FKBP5 OS=Aotus nancymaae GN=FKBP5 PE=2 SV=2 Back     alignment and function description
>sp|Q5RF88|FKBP5_PONAB Peptidyl-prolyl cis-trans isomerase FKBP5 OS=Pongo abelii GN=FKBP5 PE=2 SV=1 Back     alignment and function description
>sp|Q13451|FKBP5_HUMAN Peptidyl-prolyl cis-trans isomerase FKBP5 OS=Homo sapiens GN=FKBP5 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query434
356504332 635 PREDICTED: peptidyl-prolyl isomerase PAS 0.953 0.651 0.850 0.0
225440540 620 PREDICTED: peptidyl-prolyl isomerase PAS 0.958 0.670 0.834 0.0
224138922 621 predicted protein [Populus trichocarpa] 0.972 0.679 0.820 0.0
357471973 694 Peptidyl-prolyl isomerase PASTICCINO1 [M 0.972 0.608 0.808 0.0
255574548 618 fk506 binding protein, putative [Ricinus 0.970 0.681 0.821 0.0
3080740 634 pasticcino 1-D [Arabidopsis thaliana] 0.976 0.668 0.785 0.0
312282321 635 unnamed protein product [Thellungiella h 0.976 0.667 0.783 0.0
18409970 635 peptidyl-prolyl isomerase PASTICCINO1 [A 0.976 0.667 0.782 0.0
7630021 634 pasticcino 1 [Arabidopsis thaliana] 0.974 0.667 0.780 0.0
449460353 589 PREDICTED: peptidyl-prolyl cis-trans iso 0.905 0.667 0.837 0.0
>gi|356504332|ref|XP_003520950.1| PREDICTED: peptidyl-prolyl isomerase PASTICCINO1-like [Glycine max] Back     alignment and taxonomy information
 Score =  734 bits (1896), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/414 (85%), Positives = 380/414 (91%)

Query: 12  KKKAPSEDDKRRMKIVPGSLMKAVMRPGGGDSTPSDGDQVAYHCTVRTLDGVIVESTRSE 71
           KKK PSED+KR+ KIVPGSLMKA+MRPGGGD+ PSDGDQ+ YHCT+RTLDGV+VESTRS+
Sbjct: 14  KKKPPSEDEKRKKKIVPGSLMKALMRPGGGDAGPSDGDQIIYHCTIRTLDGVLVESTRSD 73

Query: 72  YGGKGIPIRHVLGKSKILLGLLEGIPTMLKGEVSMFKMKPQMHYGEDDCPVAAPSTFPKD 131
           YGGKGIPIRHVLGKSK+LLGLLEGIP+MLKGEV+MFKMKPQ+HYGEDDCPV+AP  FPKD
Sbjct: 74  YGGKGIPIRHVLGKSKMLLGLLEGIPSMLKGEVAMFKMKPQLHYGEDDCPVSAPDGFPKD 133

Query: 132 EELHFEIEMIDFAKAKIIADDFGVVKKVINEGQGWETPRAPYEVKAWISAKTGDGKLILS 191
           +ELHFEIE+I+F KAK++ DD GVVKKV  EGQGWE+PR PYEVKA ISAKT  GKLI+S
Sbjct: 134 DELHFEIELIEFFKAKVVTDDLGVVKKVECEGQGWESPREPYEVKALISAKTVTGKLIMS 193

Query: 192 HREGEPYFFTFGKSEVPKGLEMGIGTMTREEKAVIYVTSQYLTPSPLMPVVEGCEEVHFE 251
           H EGEPYFFTFGKSEVPKGLEM IGTM REEKAVIYVTSQYLT SPLMPV+EG +EVHFE
Sbjct: 194 HMEGEPYFFTFGKSEVPKGLEMAIGTMVREEKAVIYVTSQYLTESPLMPVIEGYDEVHFE 253

Query: 252 VELVHLIQVRDMLGDGRLIKRRIRDGKGEFPMDCPLHDSLLCVHYKGMLLNEEKKVFYDT 311
           VELVH IQVRDMLGDGRLIKRRIRDGKG+FPMDCPLHDSLL VHYKG +LNEEK+VFYDT
Sbjct: 254 VELVHFIQVRDMLGDGRLIKRRIRDGKGDFPMDCPLHDSLLRVHYKGTVLNEEKRVFYDT 313

Query: 312 RVDNDGQPLEFSSGEGLVPEGFEMCVRLMLPGEIALVTCPPDYAYDKFLRPANVPEGAHI 371
           RVDND QPLEF SGEGLVPEGFEM VRLMLPGEIALVTCPPDYAYDKF RP NVPEGAHI
Sbjct: 314 RVDNDSQPLEFCSGEGLVPEGFEMSVRLMLPGEIALVTCPPDYAYDKFPRPLNVPEGAHI 373

Query: 372 QWEIELLGFEKPKDWTGLSFDGIMDEAEKIRVTGNRLFKEGKFELAKAKYEKVI 425
           QWEIELLGFE PKDWTGL F  IM+EAE IR TGNRLFKEGK+ELAKAKYEKV+
Sbjct: 374 QWEIELLGFETPKDWTGLDFKSIMNEAENIRNTGNRLFKEGKYELAKAKYEKVL 427

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225440540|ref|XP_002273173.1| PREDICTED: peptidyl-prolyl isomerase PASTICCINO1 [Vitis vinifera] gi|297740281|emb|CBI30463.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224138922|ref|XP_002322935.1| predicted protein [Populus trichocarpa] gi|222867565|gb|EEF04696.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357471973|ref|XP_003606271.1| Peptidyl-prolyl isomerase PASTICCINO1 [Medicago truncatula] gi|355507326|gb|AES88468.1| Peptidyl-prolyl isomerase PASTICCINO1 [Medicago truncatula] Back     alignment and taxonomy information
>gi|255574548|ref|XP_002528185.1| fk506 binding protein, putative [Ricinus communis] gi|223532397|gb|EEF34192.1| fk506 binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|3080740|gb|AAC39445.1| pasticcino 1-D [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|312282321|dbj|BAJ34026.1| unnamed protein product [Thellungiella halophila] Back     alignment and taxonomy information
>gi|18409970|ref|NP_566993.1| peptidyl-prolyl isomerase PASTICCINO1 [Arabidopsis thaliana] gi|73921623|sp|Q7DMA9.2|PAS1_ARATH RecName: Full=Peptidyl-prolyl cis-trans isomerase PASTICCINO1; AltName: Full=70 kDa peptidyl-prolyl isomerase; AltName: Full=FK506-binding protein 72; Short=AtFKBP72; AltName: Full=Immunophilin FKBP72; AltName: Full=Peptidyl-prolyl cis-trans isomerase FKBP72; Short=PPIase FKBP72; AltName: Full=Rotamase gi|15810453|gb|AAL07114.1| putative pasticcino 1 protein [Arabidopsis thaliana] gi|20465605|gb|AAM20285.1| putative pasticcino 1 protein [Arabidopsis thaliana] gi|332645653|gb|AEE79174.1| peptidyl-prolyl isomerase PASTICCINO1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|7630021|emb|CAB88363.1| pasticcino 1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449460353|ref|XP_004147910.1| PREDICTED: peptidyl-prolyl cis-trans isomerase PASTICCINO1-like [Cucumis sativus] gi|449519521|ref|XP_004166783.1| PREDICTED: peptidyl-prolyl cis-trans isomerase PASTICCINO1-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query434
TAIR|locus:2084435 635 PAS1 "AT3G54010" [Arabidopsis 0.976 0.667 0.735 5.6e-171
UNIPROTKB|Q10KX6 632 Os03g0367000 "Peptidylprolyl i 0.953 0.655 0.712 2.1e-164
TAIR|locus:2152561 578 ROF2 "AT5G48570" [Arabidopsis 0.930 0.698 0.285 4.3e-37
UNIPROTKB|Q6K5Q1 682 P0579G08.8 "Putative peptidylp 0.824 0.524 0.299 4.6e-37
UNIPROTKB|Q9XFE4 585 OSJNBa0091C07.4 "OSJNBa0091C07 0.808 0.6 0.315 2e-36
TAIR|locus:2090265 562 ROF1 "AT3G25230" [Arabidopsis 0.887 0.685 0.270 2.4e-35
UNIPROTKB|Q7F1F2 580 OJ1191_A10.119 "cDNA clone:J03 0.820 0.613 0.302 1.3e-34
UNIPROTKB|A8HPN3710 FKB99 "Peptidyl-prolyl cis-tra 0.281 0.171 0.338 5.2e-20
UNIPROTKB|Q65XG1186 OJ1362_D02.6 "Peptidyl-prolyl 0.347 0.811 0.339 2.5e-14
UNIPROTKB|Q657L6422 P0468H06.14-3 "Peptidyl-prolyl 0.728 0.748 0.265 4.7e-14
TAIR|locus:2084435 PAS1 "AT3G54010" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1662 (590.1 bits), Expect = 5.6e-171, P = 5.6e-171
 Identities = 315/428 (73%), Positives = 358/428 (83%)

Query:     1 MAVEDE-DIN--PQKKKAPSEDDKRRMKIVPGSLMKAVMRXXXXXXXXXXXXQVAYHCTV 57
             MAV D+ + N  P+KKK+ +EDDKRR KIVPGSL+KAV+R            QV YHCTV
Sbjct:     1 MAVGDQTEQNYLPKKKKSETEDDKRRKKIVPGSLLKAVVRPGGGDSSPVDGDQVIYHCTV 60

Query:    58 RTLDGVIVESTRSEYGGKGIPIRHVLGKSKILLGLLEGIPTMLKGEVSMFKMKPQMHYGE 117
             RTLDGV+VESTRSE GG+G+PIR VLG SK++LGLLEGIPTM KGE++MFKMKP+MHY E
Sbjct:    61 RTLDGVVVESTRSESGGRGVPIRDVLGNSKMILGLLEGIPTMHKGEIAMFKMKPEMHYAE 120

Query:   118 DDCPVAAPSTFPKDEELHFEIEMIDFAKAKIIADDFGVVKKVINEGQGWETPRAPYEVKA 177
              DCPV+AP  FPKD+ELHFEIE++DF+KAKI +DD GV+KK++NEG+GWE+PR PYEVKA
Sbjct:   121 IDCPVSAPENFPKDDELHFEIELLDFSKAKIASDDLGVIKKILNEGEGWESPREPYEVKA 180

Query:   178 WISAKTGDGKLILSHREGEPYFFTFGKSEVPKGLEMGIGTMTREEKAVIYVTSQYLTPSP 237
              ISAK+GDG +I SH E EPYFFTFGKSEVPKGLE+GIGTM R+EKAVIYV  QYLT SP
Sbjct:   181 RISAKSGDGHVIFSHTE-EPYFFTFGKSEVPKGLEIGIGTMARKEKAVIYVRKQYLTESP 239

Query:   238 LMPVVEGCXXXXXXXXXXXXIQVRDMLGDGRLIKRRIRDGKGEFPMDCPLHDSLLCVHYK 297
             L+ + +              IQVRDMLGDGRLIKRRIRDG+GEFPMDCPL DS L VHYK
Sbjct:   240 LLHIDQDLEEVHFEVELVHFIQVRDMLGDGRLIKRRIRDGRGEFPMDCPLQDSRLSVHYK 299

Query:   298 GMLLNEEKKVFYDTRVDNDGQPLEFSSGEGLVPEGFEMCVRLMLPGEIALVTCPPDYAYD 357
             GMLLNEEK VFYD+++DN+ QPLEFSSGEGLVPEGFEMC RLMLPGEIALVTCPPDYAYD
Sbjct:   300 GMLLNEEKTVFYDSKIDNNDQPLEFSSGEGLVPEGFEMCTRLMLPGEIALVTCPPDYAYD 359

Query:   358 KFLRPANVPEGAHIQWEIELLGFEKPKDWTGLSFDGIMDEAEKIRVTGNRLFKEGKFELA 417
             KF RP  V EGAH+QWEIELLGFE P+DWTGL+F  IMDEA+KIR TGNRLFKEGKFELA
Sbjct:   360 KFPRPPGVSEGAHVQWEIELLGFETPRDWTGLNFQSIMDEADKIRSTGNRLFKEGKFELA 419

Query:   418 KAKYEKVI 425
             KAKYEKV+
Sbjct:   420 KAKYEKVL 427
GO:0000413 "protein peptidyl-prolyl isomerization" evidence=IBA
GO:0003755 "peptidyl-prolyl cis-trans isomerase activity" evidence=ISS;IBA
GO:0005528 "FK506 binding" evidence=ISS;IBA
GO:0005634 "nucleus" evidence=ISM;ISS
GO:0006457 "protein folding" evidence=IEA
GO:0016020 "membrane" evidence=IBA
GO:0018208 "peptidyl-proline modification" evidence=IBA
GO:0005515 "protein binding" evidence=IPI
GO:0005783 "endoplasmic reticulum" evidence=IDA
GO:0009880 "embryonic pattern specification" evidence=IMP
GO:0030010 "establishment of cell polarity" evidence=IMP
GO:0042761 "very long-chain fatty acid biosynthetic process" evidence=IMP
GO:0048527 "lateral root development" evidence=IMP
GO:0005829 "cytosol" evidence=IDA
GO:0000226 "microtubule cytoskeleton organization" evidence=RCA
GO:0000911 "cytokinesis by cell plate formation" evidence=RCA
GO:0010048 "vernalization response" evidence=RCA
GO:0009735 "response to cytokinin stimulus" evidence=IMP
GO:0009790 "embryo development" evidence=IMP
GO:0009826 "unidimensional cell growth" evidence=IMP
GO:0030154 "cell differentiation" evidence=IMP
GO:0048364 "root development" evidence=IMP
UNIPROTKB|Q10KX6 Os03g0367000 "Peptidylprolyl isomerase PASTICCINO1, putative, expressed" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2152561 ROF2 "AT5G48570" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q6K5Q1 P0579G08.8 "Putative peptidylprolyl isomerase" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q9XFE4 OSJNBa0091C07.4 "OSJNBa0091C07.4 protein" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2090265 ROF1 "AT3G25230" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q7F1F2 OJ1191_A10.119 "cDNA clone:J033121G16, full insert sequence" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|A8HPN3 FKB99 "Peptidyl-prolyl cis-trans isomerase, FKBP-type" [Chlamydomonas reinhardtii (taxid:3055)] Back     alignment and assigned GO terms
UNIPROTKB|Q65XG1 OJ1362_D02.6 "Peptidyl-prolyl cis-trans isomerase" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q657L6 P0468H06.14-3 "Peptidyl-prolyl cis-trans isomerase" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q7DMA9PAS1_ARATH5, ., 2, ., 1, ., 80.78270.97690.6677yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer5.2.10.963
4th Layer5.2.1.80.946

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query434
pfam0025494 pfam00254, FKBP_C, FKBP-type peptidyl-prolyl cis-t 2e-16
pfam0025494 pfam00254, FKBP_C, FKBP-type peptidyl-prolyl cis-t 5e-16
pfam0025494 pfam00254, FKBP_C, FKBP-type peptidyl-prolyl cis-t 4e-07
COG0545205 COG0545, FkpA, FKBP-type peptidyl-prolyl cis-trans 1e-06
COG0545205 COG0545, FkpA, FKBP-type peptidyl-prolyl cis-trans 7e-06
>gnl|CDD|215821 pfam00254, FKBP_C, FKBP-type peptidyl-prolyl cis-trans isomerase Back     alignment and domain information 
 Score = 73.8 bits (182), Expect = 2e-16
 Identities = 30/86 (34%), Positives = 47/86 (54%), Gaps = 5/86 (5%)

Query: 294 VHYKGMLLNEEKKVFYDTRVDNDGQPLEFSSGEGLVPEGFEMCVRLMLPGEIALVTCPPD 353
           VHY G L +    VF  ++  + G+P EF+ G G V  G++  +  M  GE   +T PP+
Sbjct: 13  VHYTGKLED--GTVFDSSK--DRGKPFEFTLGSGQVIPGWDEGLLGMKVGEKRKLTIPPE 68

Query: 354 YAY-DKFLRPANVPEGAHIQWEIELL 378
            AY ++ L    +P  A + +E+ELL
Sbjct: 69  LAYGEEGLAGGVIPPNATLVFEVELL 94

Length = 94
>gnl|CDD|215821 pfam00254, FKBP_C, FKBP-type peptidyl-prolyl cis-trans isomerase Back     alignment and domain information
>gnl|CDD|215821 pfam00254, FKBP_C, FKBP-type peptidyl-prolyl cis-trans isomerase Back     alignment and domain information
>gnl|CDD|223619 COG0545, FkpA, FKBP-type peptidyl-prolyl cis-trans isomerases 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|223619 COG0545, FkpA, FKBP-type peptidyl-prolyl cis-trans isomerases 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 434
KOG0543 397 consensus FKBP-type peptidyl-prolyl cis-trans isom 100.0
KOG0549188 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.98
KOG0549188 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.97
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.96
KOG0544108 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.95
COG0545205 FkpA FKBP-type peptidyl-prolyl cis-trans isomerase 99.95
KOG0544108 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.95
COG0545205 FkpA FKBP-type peptidyl-prolyl cis-trans isomerase 99.92
PRK11570206 peptidyl-prolyl cis-trans isomerase; Provisional 99.91
KOG0552226 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.9
TIGR03516177 ppisom_GldI peptidyl-prolyl isomerase, gliding mot 99.88
PRK10902269 FKBP-type peptidyl-prolyl cis-trans isomerase; Pro 99.86
PRK11570206 peptidyl-prolyl cis-trans isomerase; Provisional 99.84
KOG0552226 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.82
PF0025494 FKBP_C: FKBP-type peptidyl-prolyl cis-trans isomer 99.82
TIGR03516177 ppisom_GldI peptidyl-prolyl isomerase, gliding mot 99.82
KOG0545 329 consensus Aryl-hydrocarbon receptor-interacting pr 99.82
PF0025494 FKBP_C: FKBP-type peptidyl-prolyl cis-trans isomer 99.78
PRK10902269 FKBP-type peptidyl-prolyl cis-trans isomerase; Pro 99.76
PRK15095156 FKBP-type peptidyl-prolyl cis-trans isomerase; Pro 99.56
PRK15095156 FKBP-type peptidyl-prolyl cis-trans isomerase; Pro 99.55
COG1047174 SlpA FKBP-type peptidyl-prolyl cis-trans isomerase 99.46
COG1047174 SlpA FKBP-type peptidyl-prolyl cis-trans isomerase 99.43
PRK10737196 FKBP-type peptidyl-prolyl cis-trans isomerase; Pro 99.42
PRK10737196 FKBP-type peptidyl-prolyl cis-trans isomerase; Pro 99.4
TIGR00115408 tig trigger factor. Trigger factor is a ribosome-a 98.73
TIGR00115 408 tig trigger factor. Trigger factor is a ribosome-a 98.63
PRK01490435 tig trigger factor; Provisional 98.61
PRK01490 435 tig trigger factor; Provisional 98.51
COG0544441 Tig FKBP-type peptidyl-prolyl cis-trans isomerase 98.45
COG0544 441 Tig FKBP-type peptidyl-prolyl cis-trans isomerase 98.35
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 97.68
KOG4648 536 consensus Uncharacterized conserved protein, conta 96.82
KOG0547 606 consensus Translocase of outer mitochondrial membr 96.53
KOG4234 271 consensus TPR repeat-containing protein [General f 96.49
TIGR00990 615 3a0801s09 mitochondrial precursor proteins import 96.35
KOG0553 304 consensus TPR repeat-containing protein [General f 95.45
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 94.39
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 94.13
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 93.39
KOG0546 372 consensus HSP90 co-chaperone CPR7/Cyclophilin [Pos 92.16
KOG0551 390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 92.12
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 91.64
KOG0548 539 consensus Molecular co-chaperone STI1 [Posttransla 88.64
KOG0550 486 consensus Molecular chaperone (DnaJ superfamily) [ 88.46
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 88.18
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 87.82
cd0268176 MIT_calpain7_1 MIT: domain contained within Microt 85.58
cd0268275 MIT_AAA_Arch MIT: domain contained within Microtub 85.42
cd0268377 MIT_1 MIT: domain contained within Microtubule Int 84.28
PF0421269 MIT: MIT (microtubule interacting and transport) d 83.95
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 83.71
cd0267775 MIT_SNX15 MIT: domain contained within Microtubule 83.16
cd0267875 MIT_VPS4 MIT: domain contained within Microtubule 82.68
cd0268475 MIT_2 MIT: domain contained within Microtubule Int 82.57
KOG0550 486 consensus Molecular chaperone (DnaJ superfamily) [ 80.19
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=9.8e-45  Score=348.29  Aligned_cols=239  Identities=38%  Similarity=0.595  Sum_probs=219.2

Q ss_pred             ecCCCCCCCCCCCeEEEEEEEEeCCCcEEeecCCCCCeEEEeCCCCccchHHHHHhcCccccEEEEEEeeeccCCCCCCC
Q 013896          161 NEGQGWETPRAPYEVKAWISAKTGDGKLILSHREGEPYFFTFGKSEVPKGLEMGIGTMTREEKAVIYVTSQYLTPSPLMP  240 (434)
Q Consensus       161 ~~G~g~~~p~~gd~V~v~y~~~~~dg~~~~s~~~~~p~~~~~g~~~~~~gl~~~l~~mk~Ge~~~~~v~~~~~~~~~~~~  240 (434)
                      +.|.|+.+|..|+.|.+||++++.||+.|+|+.++.||.|.+|.|+++.||+.++.+|+.|+             ...|+
T Consensus         1 ~eg~g~~~p~~g~~v~~hytg~l~dgt~fdss~d~~~~~~~lg~g~vi~~~~~gv~tm~~g~-------------~~~pp   67 (397)
T KOG0543|consen    1 KEGTGTETPMTGDKVEVHYTGTLLDGTKFDSSRDGDPFKFDLGKGSVIKGWDLGVATMKKGE-------------AGSPP   67 (397)
T ss_pred             CCCCCccCCCCCceeEEEEeEEecCCeecccccCCCceeeecCCCccccccccccccccccc-------------cCCCC
Confidence            36889999999999999999999999999999889999999999999999999999999833             25778


Q ss_pred             CcCCCceEEEEEEeEEEEEeeeccCCcceEEEEEeCCCCCCCCCCCCCCCeEEEEEEEEEecCCCcEEEeccCCCCCCcE
Q 013896          241 VVEGCEEVHFEVELVHLIQVRDMLGDGRLIKRRIRDGKGEFPMDCPLHDSLLCVHYKGMLLNEEKKVFYDTRVDNDGQPL  320 (434)
Q Consensus       241 ~ip~~~~l~~~vel~~~~~~~d~~~d~~~~k~il~~G~g~~~~~~P~~g~~V~v~y~~~~~~~~g~~~~ds~~~~~~~p~  320 (434)
                      .+|++++|.|+|+|.          |++|+|+|+++|.|.  ..+|..|..|.|||.|++.+  + +|+++     ...|
T Consensus        68 ~ip~~a~l~fe~el~----------Dg~iiKriir~G~gd--~~~P~~g~~V~v~~~G~~~~--~-~f~~~-----~~~f  127 (397)
T KOG0543|consen   68 KIPSNATLLFEVELL----------DGGIIKRIIREGEGD--YSRPNKGAVVKVHLEGELED--G-VFDQR-----ELRF  127 (397)
T ss_pred             CCCCCcceeeeeccc----------CCceEEeeeecCCCC--CCCCCCCcEEEEEEEEEECC--c-ceecc-----ccce
Confidence            999999999999998          799999999999996  36799999999999999987  4 77443     3448


Q ss_pred             EEEeCC-CCcchHHHHHHhcCCcccEEEEEecCCcccc-cCCCCCCCCCCceEEEEEEEeeee-cCCCCCCCChhhhHHH
Q 013896          321 EFSSGE-GLVPEGFEMCVRLMLPGEIALVTCPPDYAYD-KFLRPANVPEGAHIQWEIELLGFE-KPKDWTGLSFDGIMDE  397 (434)
Q Consensus       321 ~~~lG~-~~~~~gle~~l~~M~~Ge~~~v~v~~~~ayg-~~g~~~~ip~~~~l~f~ieLl~v~-~~~~~~~~~~~e~~~~  397 (434)
                      +|.+|+ ..++.||+.+|++|++||++.|+|+|+|||| ..++++.|||+++|.|+|+|+++. +....|.|..+|++++
T Consensus       128 e~~~Ge~~~vi~Gle~al~~M~~GE~a~v~i~~~YayG~~~~~~p~IPPnA~l~yEVeL~~f~~~~~~s~~~~~~e~l~~  207 (397)
T KOG0543|consen  128 EFGEGEDIDVIEGLEIALRMMKVGEVALVTIDPKYAYGEEGGEPPLIPPNATLLYEVELLDFELKEDESWKMFAEERLEA  207 (397)
T ss_pred             EEecCCccchhHHHHHHHHhcCccceEEEEeCcccccCCCCCCCCCCCCCceEEEEEEEEeeecCcccccccchHHHHHH
Confidence            999998 5799999999999999999999999999999 556677999999999999999999 7888899999999999


Q ss_pred             HHHHHHHHhHHHhcCcHHHHHHHHHHHHHHHhhhh
Q 013896          398 AEKIRVTGNRLFKEGKFELAKAKYEKVIFSVLKIA  432 (434)
Q Consensus       398 a~~~k~~gn~~~k~~~y~~A~~~Y~~a~~~l~~~~  432 (434)
                      |.++|++||.+||+++|..|+.+|+||+.+|++..
T Consensus       208 A~~~ke~Gn~~fK~gk~~~A~~~Yerav~~l~~~~  242 (397)
T KOG0543|consen  208 ADRKKERGNVLFKEGKFKLAKKRYERAVSFLEYRR  242 (397)
T ss_pred             HHHHHHhhhHHHhhchHHHHHHHHHHHHHHhhccc
Confidence            99999999999999999999999999999998754

>KOG0549 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0549 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0544 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0545 FkpA FKBP-type peptidyl-prolyl cis-trans isomerases 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0544 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0545 FkpA FKBP-type peptidyl-prolyl cis-trans isomerases 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11570 peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>KOG0552 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03516 ppisom_GldI peptidyl-prolyl isomerase, gliding motility-associated Back     alignment and domain information
>PRK10902 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>PRK11570 peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>KOG0552 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00254 FKBP_C: FKBP-type peptidyl-prolyl cis-trans isomerase; InterPro: IPR001179 Synonym(s): Peptidylprolyl cis-trans isomerase FKBP-type peptidylprolyl isomerases (5 Back     alignment and domain information
>TIGR03516 ppisom_GldI peptidyl-prolyl isomerase, gliding motility-associated Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00254 FKBP_C: FKBP-type peptidyl-prolyl cis-trans isomerase; InterPro: IPR001179 Synonym(s): Peptidylprolyl cis-trans isomerase FKBP-type peptidylprolyl isomerases (5 Back     alignment and domain information
>PRK10902 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>PRK15095 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>PRK15095 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>COG1047 SlpA FKBP-type peptidyl-prolyl cis-trans isomerases 2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1047 SlpA FKBP-type peptidyl-prolyl cis-trans isomerases 2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10737 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>PRK10737 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>TIGR00115 tig trigger factor Back     alignment and domain information
>TIGR00115 tig trigger factor Back     alignment and domain information
>PRK01490 tig trigger factor; Provisional Back     alignment and domain information
>PRK01490 tig trigger factor; Provisional Back     alignment and domain information
>COG0544 Tig FKBP-type peptidyl-prolyl cis-trans isomerase (trigger factor) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0544 Tig FKBP-type peptidyl-prolyl cis-trans isomerase (trigger factor) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>KOG0546 consensus HSP90 co-chaperone CPR7/Cyclophilin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>cd02681 MIT_calpain7_1 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>cd02682 MIT_AAA_Arch MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>cd02683 MIT_1 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>PF04212 MIT: MIT (microtubule interacting and transport) domain; InterPro: IPR007330 The MIT domain is found in vacuolar sorting proteins, spastin (probable ATPase involved in the assembly or function of nuclear protein complexes), and a sorting nexin, which may play a role in intracellular trafficking Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>cd02677 MIT_SNX15 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>cd02678 MIT_VPS4 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>cd02684 MIT_2 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query434
3jym_A377 Crystal Structure Of The 3 Fkbp Domains Of Wheat Fk 5e-30
3jym_A 377 Crystal Structure Of The 3 Fkbp Domains Of Wheat Fk 3e-10
3jxv_A356 Crystal Structure Of The 3 Fkbp Domains Of Wheat Fk 2e-29
3jxv_A 356 Crystal Structure Of The 3 Fkbp Domains Of Wheat Fk 3e-10
1kt1_A 457 Structure Of The Large Fkbp-Like Protein, Fkbp51, I 8e-13
1kt0_A 457 Structure Of The Large Fkbp-like Protein, Fkbp51, I 1e-12
3o5d_A264 Crystal Structure Of A Fragment Of Fkbp51 Comprisin 4e-11
3o5d_A264 Crystal Structure Of A Fragment Of Fkbp51 Comprisin 3e-09
4drh_A144 Co-crystal Structure Of The Ppiase Domain Of Fkbp51 2e-09
3o5g_A128 Fk1 Domain Of Fkbp51, Crystal Form I Length = 128 2e-09
3o5l_A128 Fk1 Domain Mutant A19t Of Fkbp51, Crystal Form I Le 2e-09
3o5e_A144 Fk1 Domain Of Fkbp51, Crystal Form Vi Length = 144 2e-09
2if4_A 338 Crystal Structure Of A Multi-Domain Immunophilin Fr 1e-08
1qz2_A 336 Crystal Structure Of Fkbp52 C-Terminal Domain Compl 2e-08
1n1a_A140 Crystal Structure Of The N-Terminal Domain Of Human 2e-08
4drj_A144 O-crystal Structure Of The Ppiase Domain Of Fkbp52, 2e-08
1rot_A149 Structure Of Fkbp59-I, The N-Terminal Domain Of A 5 2e-08
1r9h_A135 Structural Genomics Of C.Elegans: Fkbp-Type Peptidy 4e-08
1q1c_A280 Crystal Structure Of N(1-260) Of Human Fkbp52 Lengt 4e-08
1c9h_A107 Crystal Structure Of Fkbp12.6 In Complex With Rapam 4e-08
3uqi_A108 Crystallographic Structure Of Fkbp12 From Aedes Aeg 1e-07
2dg4_A107 Fk506-Binding Protein Mutant Wf59 Complexed With Ra 2e-07
1p5q_A 336 Crystal Structure Of Fkbp52 C-Terminal Domain Lengt 2e-07
1fkk_A107 Atomic Structure Of Fkbp12, An Immunophilin Binding 6e-07
2fap_A107 The Structure Of The Immunophilin-Immunosuppressant 1e-06
3h9r_B109 Crystal Structure Of The Kinase Domain Of Type I Ac 1e-06
1fkb_A107 Atomic Structure Of The Rapamycin Human Immunophili 1e-06
2dg9_A107 Fk506-Binding Protein Mutant Wl59 Complexed With Ra 1e-06
1bkf_A107 Fk506 Binding Protein Fkbp Mutant R42kH87V COMPLEX 2e-06
1tco_C107 Ternary Complex Of A Calcineurin A Fragment, Calcin 2e-06
2ppp_A107 Crystal Structure Of E60q Mutant Of Fkbp12 Length = 2e-06
2ppo_A107 Crystal Structure Of E60a Mutant Of Fkbp12 Length = 4e-06
1bl4_A107 Fkbp Mutant F36v Complexed With Remodeled Synthetic 5e-06
2ki3_A126 Structural And Biochemical Characterization Of Fk50 5e-06
1eym_A107 Fk506 Binding Protein Mutant, Homodimeric Complex L 5e-06
2lgo_A130 Solution Nmr Structure Of A Fkbp-Type Peptidyl-Prol 9e-06
2lgo_A130 Solution Nmr Structure Of A Fkbp-Type Peptidyl-Prol 2e-05
1yat_A113 Improved Calcineurin Inhibition By Yeast Fkbp12-Dru 4e-05
3uqa_A209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 4e-05
2vn1_A129 Crystal Structure Of The Fk506-Binding Domain Of Pl 8e-05
2ofn_A135 Solution Structure Of Fk506-Binding Domain (Fkbd)of 8e-05
2ke0_A117 Solution Structure Of Peptidyl-Prolyl Cis-Trans Iso 1e-04
2y78_A133 Crystal Structure Of Bpss1823, A Mip-Like Chaperone 1e-04
3uf8_A209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 1e-04
3uqb_A209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 2e-04
2pbc_A102 Fk506-Binding Protein 2 Length = 102 2e-04
3vaw_A209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 2e-04
4ggq_C209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 2e-04
2f4e_A180 N-Terminal Domain Of Fkbp42 From Arabidopsis Thalia 2e-04
1pbk_A116 Homologous Domain Of Human Fkbp25 Length = 116 3e-04
3kz7_A119 C-Terminal Domain Of Murine Fkbp25 Rapamycin Comple 4e-04
3b7x_A134 Crystal Structure Of Human Fk506-Binding Protein 6 7e-04
>pdb|3JYM|A Chain A, Crystal Structure Of The 3 Fkbp Domains Of Wheat Fkbp73 Length = 377 Back     alignment and structure 
Iteration: 1

 Score =  128 bits (322), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 100/344 (29%), Positives = 166/344 (48%), Gaps = 25/344 (7%)
Query: 50  QVAYHCTVRTLDGVIVESTRSEYGGKGIPIRHVLGKSKILLGLLEGIPTMLKGEVSMFKM 109
           +V  H T   LDG   +S+R     +    +  LG+ +++ G  +GI TM KGE ++F +
Sbjct: 48  EVEVHYTGTLLDGKKFDSSRD----RDDTFKFKLGQGQVIKGWDQGIKTMKKGENALFTI 103
Query: 110 KPQMHYGEDDCPVAAPSTFPKDEELHFEIEMIDFAKAKIIADDFGVVKKVINEGQGWETP 169
            P++ YGE      +P T P +  L F++E++ +   + IA D G+ KK++ EG  WE P
Sbjct: 104 PPELAYGES----GSPPTIPANATLQFDVELLSWTSVRDIAKDGGIFKKILKEGDKWENP 159
Query: 170 RAPYEVKAWISAKTGDGKLILSHREGEPYFFTFGKSEVPKGLEMGIGTMTREEKAVIYVT 229
           + P EV     A+  DG  ++S  EG    FT     +   L   + TM + EK ++ V 
Sbjct: 160 KDPDEVFVKYEARLEDG-TVVSKSEG--VEFTVKDGHLCPALAKAVKTMKKGEKVLLAVK 216
Query: 230 SQYLTPSPLMPVVEGCXXXXXXXXXXXXIQ------VRDMLGDGRLIKRRIRDGKGEFPM 283
            QY       P                 ++      V ++  D +++K+ +++ +G    
Sbjct: 217 PQYGFGEMGRPAAGEGGAVPPNASLVIDLELVSWKTVTEIGDDKKILKKVLKEXEG---Y 273
Query: 284 DCPLHDSLLCVHYKGMLLNEEKKVFYDTRVDNDGQPLEFSSGEGLVPEGFEMCVRLMLPG 343
           + P   +++ V   G L  ++  VF     D   +P EF + E  V EG +  V  M  G
Sbjct: 274 ERPNEGAVVTVKITGKL--QDGTVFLKKGHDEQ-EPFEFKTDEEAVIEGLDRAVLNMKKG 330
Query: 344 EIALVTCPPDYAY--DKFLRPANVPEGAHIQWEIELLGFEKPKD 385
           E+ALVT PP+YAY   +  + A VP  + + +E+EL+ F K K+
Sbjct: 331 EVALVTIPPEYAYGSTESKQDAIVPPNSTVIYEVELVSFVKDKE 374
>pdb|3JYM|A Chain A, Crystal Structure Of The 3 Fkbp Domains Of Wheat Fkbp73 Length = 377 Back     alignment and structure
>pdb|3JXV|A Chain A, Crystal Structure Of The 3 Fkbp Domains Of Wheat Fkbp73 Length = 356 Back     alignment and structure
>pdb|3JXV|A Chain A, Crystal Structure Of The 3 Fkbp Domains Of Wheat Fkbp73 Length = 356 Back     alignment and structure
>pdb|1KT1|A Chain A, Structure Of The Large Fkbp-Like Protein, Fkbp51, Involved In Steroid Receptor Complexes Length = 457 Back     alignment and structure
>pdb|1KT0|A Chain A, Structure Of The Large Fkbp-like Protein, Fkbp51, Involved In Steroid Receptor Complexes Length = 457 Back     alignment and structure
>pdb|3O5D|A Chain A, Crystal Structure Of A Fragment Of Fkbp51 Comprising The Fk1 And Fk2 Domains Length = 264 Back     alignment and structure
>pdb|3O5D|A Chain A, Crystal Structure Of A Fragment Of Fkbp51 Comprising The Fk1 And Fk2 Domains Length = 264 Back     alignment and structure
>pdb|4DRH|A Chain A, Co-crystal Structure Of The Ppiase Domain Of Fkbp51, Rapamycin And The Frb Fragment Of Mtor At Low Ph Length = 144 Back     alignment and structure
>pdb|3O5G|A Chain A, Fk1 Domain Of Fkbp51, Crystal Form I Length = 128 Back     alignment and structure
>pdb|3O5L|A Chain A, Fk1 Domain Mutant A19t Of Fkbp51, Crystal Form I Length = 128 Back     alignment and structure
>pdb|3O5E|A Chain A, Fk1 Domain Of Fkbp51, Crystal Form Vi Length = 144 Back     alignment and structure
>pdb|2IF4|A Chain A, Crystal Structure Of A Multi-Domain Immunophilin From Arabidopsis Thaliana Length = 338 Back     alignment and structure
>pdb|1QZ2|A Chain A, Crystal Structure Of Fkbp52 C-Terminal Domain Complex With The C-Terminal Peptide Meevd Of Hsp90 Length = 336 Back     alignment and structure
>pdb|1N1A|A Chain A, Crystal Structure Of The N-Terminal Domain Of Human Fkbp52 Length = 140 Back     alignment and structure
>pdb|4DRJ|A Chain A, O-crystal Structure Of The Ppiase Domain Of Fkbp52, Rapamycin And The Frb Fragment Of Mtor Length = 144 Back     alignment and structure
>pdb|1ROT|A Chain A, Structure Of Fkbp59-I, The N-Terminal Domain Of A 59 Kda Fk506-Binding Protein, Nmr, Minimized Average Structure Length = 149 Back     alignment and structure
>pdb|1R9H|A Chain A, Structural Genomics Of C.Elegans: Fkbp-Type Peptidylprolyl Isomerase Length = 135 Back     alignment and structure
>pdb|1Q1C|A Chain A, Crystal Structure Of N(1-260) Of Human Fkbp52 Length = 280 Back     alignment and structure
>pdb|1C9H|A Chain A, Crystal Structure Of Fkbp12.6 In Complex With Rapamycin Length = 107 Back     alignment and structure
>pdb|3UQI|A Chain A, Crystallographic Structure Of Fkbp12 From Aedes Aegypti Length = 108 Back     alignment and structure
>pdb|2DG4|A Chain A, Fk506-Binding Protein Mutant Wf59 Complexed With Rapamycin Length = 107 Back     alignment and structure
>pdb|1P5Q|A Chain A, Crystal Structure Of Fkbp52 C-Terminal Domain Length = 336 Back     alignment and structure
>pdb|1FKK|A Chain A, Atomic Structure Of Fkbp12, An Immunophilin Binding Protein Length = 107 Back     alignment and structure
>pdb|2FAP|A Chain A, The Structure Of The Immunophilin-Immunosuppressant Fkbp12- (C16)-Ethoxy Rapamycin Complex Interacting With Huma Length = 107 Back     alignment and structure
>pdb|3H9R|B Chain B, Crystal Structure Of The Kinase Domain Of Type I Activin Receptor (Acvr1) In Complex With Fkbp12 And Dorsomorphin Length = 109 Back     alignment and structure
>pdb|1FKB|A Chain A, Atomic Structure Of The Rapamycin Human Immunophilin Fkbp- 12 Complex Length = 107 Back     alignment and structure
>pdb|2DG9|A Chain A, Fk506-Binding Protein Mutant Wl59 Complexed With Rapamycin Length = 107 Back     alignment and structure
>pdb|1BKF|A Chain A, Fk506 Binding Protein Fkbp Mutant R42kH87V COMPLEX WITH Immunosuppressant Fk506 Length = 107 Back     alignment and structure
>pdb|1TCO|C Chain C, Ternary Complex Of A Calcineurin A Fragment, Calcineurin B, Fkbp12 And The Immunosuppressant Drug Fk506 (tacrolimus) Length = 107 Back     alignment and structure
>pdb|2PPP|A Chain A, Crystal Structure Of E60q Mutant Of Fkbp12 Length = 107 Back     alignment and structure
>pdb|2PPO|A Chain A, Crystal Structure Of E60a Mutant Of Fkbp12 Length = 107 Back     alignment and structure
>pdb|1BL4|A Chain A, Fkbp Mutant F36v Complexed With Remodeled Synthetic Ligand Length = 107 Back     alignment and structure
>pdb|2KI3|A Chain A, Structural And Biochemical Characterization Of Fk506 Binding Domain From Plasmodium Vivax Length = 126 Back     alignment and structure
>pdb|1EYM|A Chain A, Fk506 Binding Protein Mutant, Homodimeric Complex Length = 107 Back     alignment and structure
>pdb|2LGO|A Chain A, Solution Nmr Structure Of A Fkbp-Type Peptidyl-Prolyl Cis-Trans Isomerase From Giardia Lamblia, Seattle Structural Genomics Center For Infectious Disease Target Gilaa.00840.A Length = 130 Back     alignment and structure
>pdb|2LGO|A Chain A, Solution Nmr Structure Of A Fkbp-Type Peptidyl-Prolyl Cis-Trans Isomerase From Giardia Lamblia, Seattle Structural Genomics Center For Infectious Disease Target Gilaa.00840.A Length = 130 Back     alignment and structure
>pdb|1YAT|A Chain A, Improved Calcineurin Inhibition By Yeast Fkbp12-Drug Complexes. Crystallographic And Functional Analysis Length = 113 Back     alignment and structure
>pdb|3UQA|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation A54e From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 Back     alignment and structure
>pdb|2VN1|A Chain A, Crystal Structure Of The Fk506-Binding Domain Of Plasmodium Falciparum Fkbp35 In Complex With Fk506 Length = 129 Back     alignment and structure
>pdb|2OFN|A Chain A, Solution Structure Of Fk506-Binding Domain (Fkbd)of Fkbp35 From Plasmodium Falciparum Length = 135 Back     alignment and structure
>pdb|2KE0|A Chain A, Solution Structure Of Peptidyl-Prolyl Cis-Trans Isomerase From Burkholderia Pseudomallei Length = 117 Back     alignment and structure
>pdb|2Y78|A Chain A, Crystal Structure Of Bpss1823, A Mip-Like Chaperone From Burkholderia Pseudomallei Length = 133 Back     alignment and structure
>pdb|3UF8|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With A G95a Surface Mutation From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 Back     alignment and structure
>pdb|3UQB|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation D44g From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 Back     alignment and structure
>pdb|2PBC|A Chain A, Fk506-Binding Protein 2 Length = 102 Back     alignment and structure
>pdb|3VAW|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation V3i From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 Back     alignment and structure
>pdb|4GGQ|C Chain C, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase From Burkholderia Pseudomallei Complexed With Cj40 Length = 209 Back     alignment and structure
>pdb|2F4E|A Chain A, N-Terminal Domain Of Fkbp42 From Arabidopsis Thaliana Length = 180 Back     alignment and structure
>pdb|1PBK|A Chain A, Homologous Domain Of Human Fkbp25 Length = 116 Back     alignment and structure
>pdb|3KZ7|A Chain A, C-Terminal Domain Of Murine Fkbp25 Rapamycin Complex Length = 119 Back     alignment and structure
>pdb|3B7X|A Chain A, Crystal Structure Of Human Fk506-Binding Protein 6 Length = 134 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query434
3jxv_A356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 8e-86
3jxv_A 356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 8e-17
3jxv_A356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 9e-13
1kt0_A 457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 3e-53
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 4e-27
1p5q_A 336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 2e-34
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 4e-13
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 3e-12
2if4_A 338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 6e-33
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 6e-13
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 7e-12
1q1c_A280 FK506-binding protein 4; rotamase, TPR repeat, nuc 2e-31
1q1c_A280 FK506-binding protein 4; rotamase, TPR repeat, nuc 2e-27
1q1c_A280 FK506-binding protein 4; rotamase, TPR repeat, nuc 5e-15
2d9f_A135 FK506-binding protein 8 variant; FKBP, rapamycin, 2e-23
2d9f_A135 FK506-binding protein 8 variant; FKBP, rapamycin, 2e-15
2d9f_A135 FK506-binding protein 8 variant; FKBP, rapamycin, 3e-11
2awg_A118 38 kDa FK-506 binding protein; FKBP-type, ppiase, 1e-20
2awg_A118 38 kDa FK-506 binding protein; FKBP-type, ppiase, 3e-14
2awg_A118 38 kDa FK-506 binding protein; FKBP-type, ppiase, 6e-10
2jwx_A157 FKBP38NTD, FK506-binding protein 8 variant; apopto 9e-20
2jwx_A157 FKBP38NTD, FK506-binding protein 8 variant; apopto 2e-15
2jwx_A157 FKBP38NTD, FK506-binding protein 8 variant; apopto 7e-09
3b7x_A134 FK506-binding protein 6; isomerase, repeat, rotama 4e-17
3b7x_A134 FK506-binding protein 6; isomerase, repeat, rotama 4e-14
3b7x_A134 FK506-binding protein 6; isomerase, repeat, rotama 3e-06
2f4e_A180 ATFKBP42; FKBP-like, alpha-beta, signaling protein 2e-16
2f4e_A180 ATFKBP42; FKBP-like, alpha-beta, signaling protein 6e-14
2f4e_A180 ATFKBP42; FKBP-like, alpha-beta, signaling protein 2e-07
1r9h_A135 FKB-6, FK506 binding protein family; structural ge 4e-16
1r9h_A135 FKB-6, FK506 binding protein family; structural ge 1e-14
1r9h_A135 FKB-6, FK506 binding protein family; structural ge 1e-09
3o5q_A128 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 5e-16
3o5q_A128 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 9e-15
3o5q_A128 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 3e-08
2vn1_A129 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR 2e-15
2vn1_A129 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR 2e-11
2vn1_A129 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR 6e-07
2ppn_A107 FK506-binding protein 1A; high resolution protein 3e-15
2ppn_A107 FK506-binding protein 1A; high resolution protein 2e-13
2ppn_A107 FK506-binding protein 1A; high resolution protein 5e-08
3o5e_A144 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 3e-15
3o5e_A144 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 6e-14
3o5e_A144 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 6e-09
3kz7_A119 FK506-binding protein 3; FKPB ppiase rapamycin, is 5e-15
3kz7_A119 FK506-binding protein 3; FKPB ppiase rapamycin, is 9e-14
3kz7_A119 FK506-binding protein 3; FKPB ppiase rapamycin, is 9e-09
2pbc_A102 FK506-binding protein 2; endoplasmic reticulum, is 7e-15
2pbc_A102 FK506-binding protein 2; endoplasmic reticulum, is 8e-09
2pbc_A102 FK506-binding protein 2; endoplasmic reticulum, is 5e-04
1yat_A113 FK506 binding protein; HET: FK5; 2.50A {Saccharomy 4e-14
1yat_A113 FK506 binding protein; HET: FK5; 2.50A {Saccharomy 5e-13
1yat_A113 FK506 binding protein; HET: FK5; 2.50A {Saccharomy 5e-08
2lgo_A130 FKBP; infectious disease, isomerase, giardiasis, s 3e-13
2lgo_A130 FKBP; infectious disease, isomerase, giardiasis, s 5e-13
2lgo_A130 FKBP; infectious disease, isomerase, giardiasis, s 4e-08
4dip_A125 Peptidyl-prolyl CIS-trans isomerase FKBP14; struct 1e-12
4dip_A125 Peptidyl-prolyl CIS-trans isomerase FKBP14; struct 2e-06
3uf8_A209 Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- 4e-11
3uf8_A209 Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- 1e-07
3uf8_A209 Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- 3e-04
2y78_A133 Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, 4e-11
2y78_A133 Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, 1e-07
2y78_A133 Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, 6e-04
1jvw_A167 Macrophage infectivity potentiator; chagas disease 1e-09
1jvw_A167 Macrophage infectivity potentiator; chagas disease 4e-07
1fd9_A213 Protein (macrophage infectivity potentiator prote; 2e-09
1fd9_A213 Protein (macrophage infectivity potentiator prote; 3e-06
3oe2_A219 Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, 3e-09
3oe2_A219 Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, 4e-05
1u79_A129 FKBP-type peptidyl-prolyl CIS-trans isomerase 3; T 4e-09
1u79_A129 FKBP-type peptidyl-prolyl CIS-trans isomerase 3; T 2e-06
2fbn_A 198 70 kDa peptidylprolyl isomerase, putative; sulfur 5e-09
1q6h_A224 FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; 8e-08
1q6h_A224 FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; 2e-04
3rkv_A 162 Putative peptidylprolyl isomerase; structural geno 5e-06
2kr7_A151 FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; 3e-05
4dt4_A169 FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; 3e-05
4dt4_A169 FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; 4e-04
2l6j_A111 TPR repeat-containing protein associated with HSP; 7e-05
1ihg_A 370 Cyclophilin 40; ppiase immunophilin tetratricopept 9e-05
1ix5_A151 FKBP; ppiase, isomerase; NMR {Methanothermococcust 2e-04
1ix5_A151 FKBP; ppiase, isomerase; NMR {Methanothermococcust 6e-04
2k8i_A171 SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, 3e-04
2kfw_A196 FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD 4e-04
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Length = 356 Back     alignment and structure
 Score =  265 bits (679), Expect = 8e-86
 Identities = 107/367 (29%), Positives = 176/367 (47%), Gaps = 25/367 (6%)

Query: 24  MKIVPGSLMKAVMRPGGGDSTPSDGDQVAYHCTVRTLDGVIVESTRSEYGGKGIPIRHVL 83
            +I    L K +++ G G  TP  GD+V  H T   LDG   +S+R     +    +  L
Sbjct: 6   NEIGKQGLKKKLLKEGEGWDTPEVGDEVEVHYTGTLLDGKKFDSSRD----RDDTFKFKL 61

Query: 84  GKSKILLGLLEGIPTMLKGEVSMFKMKPQMHYGEDDCPVAAPSTFPKDEELHFEIEMIDF 143
           G+ +++ G  +GI TM KGE ++F + P++ YGE   P     T P +  L F++E++ +
Sbjct: 62  GQGQVIKGWDQGIKTMKKGENALFTIPPELAYGESGSPP----TIPANATLQFDVELLSW 117

Query: 144 AKAKIIADDFGVVKKVINEGQGWETPRAPYEVKAWISAKTGDGKLILSHREGEPYFFTFG 203
              + IA D G+ KK++ EG  WE P+ P EV     A+  DG ++          FT  
Sbjct: 118 TSVRDIAKDGGIFKKILKEGDKWENPKDPDEVFVKYEARLEDGTVVSKSE---GVEFTVK 174

Query: 204 KSEVPKGLEMGIGTMTREEKAVIYVTSQY------LTPSPLMPVVEGCEEVHFEVELVHL 257
              +   L   + TM + EK ++ V  QY         +     V     +  ++ELV  
Sbjct: 175 DGHLCPALAKAVKTMKKGEKVLLAVKPQYGFGEMGRPAAGEGGAVPPNASLVIDLELVSW 234

Query: 258 IQVRDMLGDGRLIKRRIRDGKGEFPMDCPLHDSLLCVHYKGMLLNEEKKVFYDTRVDNDG 317
             V ++  D +++K+ +++ +     + P   +++ V   G L +    VF     D + 
Sbjct: 235 KTVTEIGDDKKILKKVLKEXE---GYERPNEGAVVTVKITGKLQD--GTVFLKKGHD-EQ 288

Query: 318 QPLEFSSGEGLVPEGFEMCVRLMLPGEIALVTCPPDYAYDK--FLRPANVPEGAHIQWEI 375
           +P EF + E  V EG +  V  M  GE+ALVT PP+YAY      + A VP  + + +E+
Sbjct: 289 EPFEFKTDEEAVIEGLDRAVLNMKKGEVALVTIPPEYAYGSTESKQDAIVPPNSTVIYEV 348

Query: 376 ELLGFEK 382
           EL+ F K
Sbjct: 349 ELVSFVK 355
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Length = 356 Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Length = 356 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Length = 338 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Length = 338 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Length = 338 Back     alignment and structure
>1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Length = 280 Back     alignment and structure
>1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Length = 280 Back     alignment and structure
>1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Length = 280 Back     alignment and structure
>2d9f_A FK506-binding protein 8 variant; FKBP, rapamycin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 135 Back     alignment and structure
>2d9f_A FK506-binding protein 8 variant; FKBP, rapamycin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 135 Back     alignment and structure
>2d9f_A FK506-binding protein 8 variant; FKBP, rapamycin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 135 Back     alignment and structure
>2awg_A 38 kDa FK-506 binding protein; FKBP-type, ppiase, BCL-2 inhibitor, SHH signalling antagonist, structural genomics consortium, SGC; 1.60A {Homo sapiens} PDB: 2f2d_A 3ey6_A Length = 118 Back     alignment and structure
>2awg_A 38 kDa FK-506 binding protein; FKBP-type, ppiase, BCL-2 inhibitor, SHH signalling antagonist, structural genomics consortium, SGC; 1.60A {Homo sapiens} PDB: 2f2d_A 3ey6_A Length = 118 Back     alignment and structure
>2awg_A 38 kDa FK-506 binding protein; FKBP-type, ppiase, BCL-2 inhibitor, SHH signalling antagonist, structural genomics consortium, SGC; 1.60A {Homo sapiens} PDB: 2f2d_A 3ey6_A Length = 118 Back     alignment and structure
>2jwx_A FKBP38NTD, FK506-binding protein 8 variant; apoptosis, beta barrel, central helix, with flexible N-terminal extension, isomerase; NMR {Homo sapiens} Length = 157 Back     alignment and structure
>2jwx_A FKBP38NTD, FK506-binding protein 8 variant; apoptosis, beta barrel, central helix, with flexible N-terminal extension, isomerase; NMR {Homo sapiens} Length = 157 Back     alignment and structure
>2jwx_A FKBP38NTD, FK506-binding protein 8 variant; apoptosis, beta barrel, central helix, with flexible N-terminal extension, isomerase; NMR {Homo sapiens} Length = 157 Back     alignment and structure
>3b7x_A FK506-binding protein 6; isomerase, repeat, rotamase, TPR repeat, williams-beuren syndrome, structural genomics consortium, SGC; 2.10A {Homo sapiens} Length = 134 Back     alignment and structure
>3b7x_A FK506-binding protein 6; isomerase, repeat, rotamase, TPR repeat, williams-beuren syndrome, structural genomics consortium, SGC; 2.10A {Homo sapiens} Length = 134 Back     alignment and structure
>3b7x_A FK506-binding protein 6; isomerase, repeat, rotamase, TPR repeat, williams-beuren syndrome, structural genomics consortium, SGC; 2.10A {Homo sapiens} Length = 134 Back     alignment and structure
>2f4e_A ATFKBP42; FKBP-like, alpha-beta, signaling protein; 2.32A {Arabidopsis thaliana} Length = 180 Back     alignment and structure
>2f4e_A ATFKBP42; FKBP-like, alpha-beta, signaling protein; 2.32A {Arabidopsis thaliana} Length = 180 Back     alignment and structure
>2f4e_A ATFKBP42; FKBP-like, alpha-beta, signaling protein; 2.32A {Arabidopsis thaliana} Length = 180 Back     alignment and structure
>1r9h_A FKB-6, FK506 binding protein family; structural genomics, peptidylprolyl isomerase, PSI, protein structure initiative; 1.80A {Caenorhabditis elegans} SCOP: d.26.1.1 Length = 135 Back     alignment and structure
>1r9h_A FKB-6, FK506 binding protein family; structural genomics, peptidylprolyl isomerase, PSI, protein structure initiative; 1.80A {Caenorhabditis elegans} SCOP: d.26.1.1 Length = 135 Back     alignment and structure
>1r9h_A FKB-6, FK506 binding protein family; structural genomics, peptidylprolyl isomerase, PSI, protein structure initiative; 1.80A {Caenorhabditis elegans} SCOP: d.26.1.1 Length = 135 Back     alignment and structure
>3o5q_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 0.96A {Homo sapiens} PDB: 3o5m_A 3o5l_A 3o5o_A 3o5p_A 3o5r_A* 4drq_A* 3o5j_A 3o5g_A 3o5i_A 3o5k_A Length = 128 Back     alignment and structure
>3o5q_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 0.96A {Homo sapiens} PDB: 3o5m_A 3o5l_A 3o5o_A 3o5p_A 3o5r_A* 4drq_A* 3o5j_A 3o5g_A 3o5i_A 3o5k_A Length = 128 Back     alignment and structure
>3o5q_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 0.96A {Homo sapiens} PDB: 3o5m_A 3o5l_A 3o5o_A 3o5p_A 3o5r_A* 4drq_A* 3o5j_A 3o5g_A 3o5i_A 3o5k_A Length = 128 Back     alignment and structure
>2vn1_A 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR repeat; HET: FK5; 2.35A {Plasmodium falciparum} PDB: 2ofn_A 2ki3_A 3ihz_A* 3ni6_A 3pa7_A Length = 129 Back     alignment and structure
>2vn1_A 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR repeat; HET: FK5; 2.35A {Plasmodium falciparum} PDB: 2ofn_A 2ki3_A 3ihz_A* 3ni6_A 3pa7_A Length = 129 Back     alignment and structure
>2vn1_A 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR repeat; HET: FK5; 2.35A {Plasmodium falciparum} PDB: 2ofn_A 2ki3_A 3ihz_A* 3ni6_A 3pa7_A Length = 129 Back     alignment and structure
>2ppn_A FK506-binding protein 1A; high resolution protein structure, isomerase; 0.92A {Homo sapiens} SCOP: d.26.1.1 PDB: 1b6c_A 1a7x_A 1d7h_A 1d7i_A 1d7j_A* 1f40_A* 1fap_A* 1d6o_A* 1fkd_A* 1fkf_A* 1fkg_A* 1fkh_A* 1fki_A* 1fkj_A* 1fkr_A 1fks_A 1fkt_A 1j4h_A* 1j4i_A* 1j4r_A* ... Length = 107 Back     alignment and structure
>2ppn_A FK506-binding protein 1A; high resolution protein structure, isomerase; 0.92A {Homo sapiens} SCOP: d.26.1.1 PDB: 1b6c_A 1a7x_A 1d7h_A 1d7i_A 1d7j_A* 1f40_A* 1fap_A* 1d6o_A* 1fkd_A* 1fkf_A* 1fkg_A* 1fkh_A* 1fki_A* 1fkj_A* 1fkr_A 1fks_A 1fkt_A 1j4h_A* 1j4i_A* 1j4r_A* ... Length = 107 Back     alignment and structure
>2ppn_A FK506-binding protein 1A; high resolution protein structure, isomerase; 0.92A {Homo sapiens} SCOP: d.26.1.1 PDB: 1b6c_A 1a7x_A 1d7h_A 1d7i_A 1d7j_A* 1f40_A* 1fap_A* 1d6o_A* 1fkd_A* 1fkf_A* 1fkg_A* 1fkh_A* 1fki_A* 1fkj_A* 1fkr_A 1fks_A 1fkt_A 1j4h_A* 1j4i_A* 1j4r_A* ... Length = 107 Back     alignment and structure
>3o5e_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 1.60A {Homo sapiens} PDB: 3o5f_A Length = 144 Back     alignment and structure
>3o5e_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 1.60A {Homo sapiens} PDB: 3o5f_A Length = 144 Back     alignment and structure
>3o5e_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 1.60A {Homo sapiens} PDB: 3o5f_A Length = 144 Back     alignment and structure
>3kz7_A FK506-binding protein 3; FKPB ppiase rapamycin, isomerase, nucleus, phosphoprotein, R isomerase-inhibitor complex; HET: RAP; 1.95A {Mus musculus} PDB: 1pbk_A* Length = 119 Back     alignment and structure
>3kz7_A FK506-binding protein 3; FKPB ppiase rapamycin, isomerase, nucleus, phosphoprotein, R isomerase-inhibitor complex; HET: RAP; 1.95A {Mus musculus} PDB: 1pbk_A* Length = 119 Back     alignment and structure
>3kz7_A FK506-binding protein 3; FKPB ppiase rapamycin, isomerase, nucleus, phosphoprotein, R isomerase-inhibitor complex; HET: RAP; 1.95A {Mus musculus} PDB: 1pbk_A* Length = 119 Back     alignment and structure
>2pbc_A FK506-binding protein 2; endoplasmic reticulum, isomerase, polymorphism, rotamase, structural genomics, structural genomics consortium, SGC; 1.80A {Homo sapiens} Length = 102 Back     alignment and structure
>2pbc_A FK506-binding protein 2; endoplasmic reticulum, isomerase, polymorphism, rotamase, structural genomics, structural genomics consortium, SGC; 1.80A {Homo sapiens} Length = 102 Back     alignment and structure
>2pbc_A FK506-binding protein 2; endoplasmic reticulum, isomerase, polymorphism, rotamase, structural genomics, structural genomics consortium, SGC; 1.80A {Homo sapiens} Length = 102 Back     alignment and structure
>1yat_A FK506 binding protein; HET: FK5; 2.50A {Saccharomyces cerevisiae} SCOP: d.26.1.1 Length = 113 Back     alignment and structure
>1yat_A FK506 binding protein; HET: FK5; 2.50A {Saccharomyces cerevisiae} SCOP: d.26.1.1 Length = 113 Back     alignment and structure
>1yat_A FK506 binding protein; HET: FK5; 2.50A {Saccharomyces cerevisiae} SCOP: d.26.1.1 Length = 113 Back     alignment and structure
>2lgo_A FKBP; infectious disease, isomerase, giardiasis, ssgcid, structura genomics, seattle structural genomics center for infectious; NMR {Giardia lamblia} Length = 130 Back     alignment and structure
>2lgo_A FKBP; infectious disease, isomerase, giardiasis, ssgcid, structura genomics, seattle structural genomics center for infectious; NMR {Giardia lamblia} Length = 130 Back     alignment and structure
>2lgo_A FKBP; infectious disease, isomerase, giardiasis, ssgcid, structura genomics, seattle structural genomics center for infectious; NMR {Giardia lamblia} Length = 130 Back     alignment and structure
>4dip_A Peptidyl-prolyl CIS-trans isomerase FKBP14; structural genomics, structural genomics consortium, SGC, PE prolyl CIS-trans isomerase; 1.82A {Homo sapiens} Length = 125 Back     alignment and structure
>4dip_A Peptidyl-prolyl CIS-trans isomerase FKBP14; structural genomics, structural genomics consortium, SGC, PE prolyl CIS-trans isomerase; 1.82A {Homo sapiens} Length = 125 Back     alignment and structure
>3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 1euv_B 3v60_A 3v61_A 3v62_A* Length = 209 Back     alignment and structure
>3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 1euv_B 3v60_A 3v61_A 3v62_A* Length = 209 Back     alignment and structure
>3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 1euv_B 3v60_A 3v61_A 3v62_A* Length = 209 Back     alignment and structure
>2y78_A Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, virulence; HET: SO4 GOL; 0.91A {Burkholderia pseudomallei} PDB: 2ke0_A 2ko7_A* 2l2s_A* 4dz2_A* 4dz3_A* Length = 133 Back     alignment and structure
>2y78_A Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, virulence; HET: SO4 GOL; 0.91A {Burkholderia pseudomallei} PDB: 2ke0_A 2ko7_A* 2l2s_A* 4dz2_A* 4dz3_A* Length = 133 Back     alignment and structure
>2y78_A Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, virulence; HET: SO4 GOL; 0.91A {Burkholderia pseudomallei} PDB: 2ke0_A 2ko7_A* 2l2s_A* 4dz2_A* 4dz3_A* Length = 133 Back     alignment and structure
>1jvw_A Macrophage infectivity potentiator; chagas disease, X-RAY rotamase, isomeras; 1.70A {Trypanosoma cruzi} SCOP: d.26.1.1 Length = 167 Back     alignment and structure
>1jvw_A Macrophage infectivity potentiator; chagas disease, X-RAY rotamase, isomeras; 1.70A {Trypanosoma cruzi} SCOP: d.26.1.1 Length = 167 Back     alignment and structure
>1fd9_A Protein (macrophage infectivity potentiator prote; FKBP domain, long alpha helix, dimerisation VIA helical INTE isomerase; 2.41A {Legionella pneumophila} SCOP: d.26.1.1 PDB: 2uz5_A 2vcd_A* Length = 213 Back     alignment and structure
>1fd9_A Protein (macrophage infectivity potentiator prote; FKBP domain, long alpha helix, dimerisation VIA helical INTE isomerase; 2.41A {Legionella pneumophila} SCOP: d.26.1.1 PDB: 2uz5_A 2vcd_A* Length = 213 Back     alignment and structure
>3oe2_A Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, FK506; HET: TAR SRT; 1.60A {Pseudomonas syringae PV} Length = 219 Back     alignment and structure
>3oe2_A Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, FK506; HET: TAR SRT; 1.60A {Pseudomonas syringae PV} Length = 219 Back     alignment and structure
>1u79_A FKBP-type peptidyl-prolyl CIS-trans isomerase 3; TFKBP13, FK-506 binding protein; 1.85A {Arabidopsis thaliana} SCOP: d.26.1.1 PDB: 1y0o_A Length = 129 Back     alignment and structure
>1u79_A FKBP-type peptidyl-prolyl CIS-trans isomerase 3; TFKBP13, FK-506 binding protein; 1.85A {Arabidopsis thaliana} SCOP: d.26.1.1 PDB: 1y0o_A Length = 129 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Length = 198 Back     alignment and structure
>1q6h_A FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; chaperone, peptidyl-prolyl isomerase, heat shock protein, FK family; HET: MSE; 1.97A {Escherichia coli} SCOP: d.26.1.1 PDB: 1q6i_A* 1q6u_A Length = 224 Back     alignment and structure
>1q6h_A FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; chaperone, peptidyl-prolyl isomerase, heat shock protein, FK family; HET: MSE; 1.97A {Escherichia coli} SCOP: d.26.1.1 PDB: 1q6i_A* 1q6u_A Length = 224 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Length = 162 Back     alignment and structure
>2kr7_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; protein, rotamase; NMR {Helicobacter pylori} Length = 151 Back     alignment and structure
>4dt4_A FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; FKBP domain, IF domain, chaperone, peptidyl-prolyl isomerase isomerase; 1.35A {Escherichia coli} Length = 169 Back     alignment and structure
>4dt4_A FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; FKBP domain, IF domain, chaperone, peptidyl-prolyl isomerase isomerase; 1.35A {Escherichia coli} Length = 169 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Length = 111 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Length = 370 Back     alignment and structure
>1ix5_A FKBP; ppiase, isomerase; NMR {Methanothermococcusthermolithotrophicus} SCOP: d.26.1.1 Length = 151 Back     alignment and structure
>1ix5_A FKBP; ppiase, isomerase; NMR {Methanothermococcusthermolithotrophicus} SCOP: d.26.1.1 Length = 151 Back     alignment and structure
>2k8i_A SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, chaperone, rotamase; NMR {Escherichia coli} Length = 171 Back     alignment and structure
>2kfw_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD; protein, cobalt, copper, cytoplasm, metal- binding, nickel, rotamase, zinc; NMR {Escherichia coli} Length = 196 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query434
3jxv_A356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 100.0
1q1c_A280 FK506-binding protein 4; rotamase, TPR repeat, nuc 100.0
1q1c_A280 FK506-binding protein 4; rotamase, TPR repeat, nuc 100.0
1kt0_A 457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 100.0
3jxv_A356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 100.0
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 100.0
2if4_A 338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.93
1yat_A113 FK506 binding protein; HET: FK5; 2.50A {Saccharomy 99.92
3kz7_A119 FK506-binding protein 3; FKPB ppiase rapamycin, is 99.92
1r9h_A135 FKB-6, FK506 binding protein family; structural ge 99.92
2f4e_A180 ATFKBP42; FKBP-like, alpha-beta, signaling protein 99.92
3o5e_A144 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 99.92
3o5q_A128 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 99.92
2y78_A133 Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, 99.91
2ppn_A107 FK506-binding protein 1A; high resolution protein 99.91
3o5e_A144 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 99.91
2lkn_A165 AH receptor-interacting protein; FKBP-type domain, 99.91
1jvw_A167 Macrophage infectivity potentiator; chagas disease 99.91
4dip_A125 Peptidyl-prolyl CIS-trans isomerase FKBP14; struct 99.91
3o5q_A128 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 99.91
2vn1_A129 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR 99.9
2lgo_A130 FKBP; infectious disease, isomerase, giardiasis, s 99.9
2f4e_A180 ATFKBP42; FKBP-like, alpha-beta, signaling protein 99.9
1u79_A129 FKBP-type peptidyl-prolyl CIS-trans isomerase 3; T 99.9
3b7x_A134 FK506-binding protein 6; isomerase, repeat, rotama 99.9
3oe2_A219 Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, 99.9
1fd9_A213 Protein (macrophage infectivity potentiator prote; 99.9
2lkn_A165 AH receptor-interacting protein; FKBP-type domain, 99.9
3b7x_A134 FK506-binding protein 6; isomerase, repeat, rotama 99.9
2jwx_A157 FKBP38NTD, FK506-binding protein 8 variant; apopto 99.9
3uf8_A209 Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- 99.89
1r9h_A135 FKB-6, FK506 binding protein family; structural ge 99.89
3kz7_A119 FK506-binding protein 3; FKPB ppiase rapamycin, is 99.89
2vn1_A129 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR 99.89
2awg_A118 38 kDa FK-506 binding protein; FKBP-type, ppiase, 99.89
1yat_A113 FK506 binding protein; HET: FK5; 2.50A {Saccharomy 99.89
2ppn_A107 FK506-binding protein 1A; high resolution protein 99.89
1q6h_A224 FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; 99.89
2d9f_A135 FK506-binding protein 8 variant; FKBP, rapamycin, 99.88
2awg_A118 38 kDa FK-506 binding protein; FKBP-type, ppiase, 99.88
2d9f_A135 FK506-binding protein 8 variant; FKBP, rapamycin, 99.88
4dip_A125 Peptidyl-prolyl CIS-trans isomerase FKBP14; struct 99.88
3uf8_A209 Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- 99.88
1jvw_A167 Macrophage infectivity potentiator; chagas disease 99.88
2y78_A133 Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, 99.88
2jwx_A157 FKBP38NTD, FK506-binding protein 8 variant; apopto 99.87
2lgo_A130 FKBP; infectious disease, isomerase, giardiasis, s 99.87
2pbc_A102 FK506-binding protein 2; endoplasmic reticulum, is 99.85
1p5q_A 336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.85
3oe2_A219 Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, 99.85
1fd9_A213 Protein (macrophage infectivity potentiator prote; 99.84
1u79_A129 FKBP-type peptidyl-prolyl CIS-trans isomerase 3; T 99.84
2pbc_A102 FK506-binding protein 2; endoplasmic reticulum, is 99.83
1q6h_A224 FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; 99.82
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.79
1hxv_A113 Trigger factor; FKBP fold, ppiase, chaperone; NMR 99.63
2kr7_A151 FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; 99.61
4dt4_A169 FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; 99.6
4dt4_A169 FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; 99.6
1hxv_A113 Trigger factor; FKBP fold, ppiase, chaperone; NMR 99.58
2k8i_A171 SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, 99.57
2kr7_A151 FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; 99.56
3pr9_A157 FKBP-type peptidyl-prolyl CIS-trans isomerase; FKB 99.56
3prb_A231 FKBP-type peptidyl-prolyl CIS-trans isomerase; cha 99.56
2k8i_A171 SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, 99.54
3prb_A231 FKBP-type peptidyl-prolyl CIS-trans isomerase; cha 99.54
2kfw_A196 FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD 99.54
3pr9_A157 FKBP-type peptidyl-prolyl CIS-trans isomerase; FKB 99.53
2kfw_A196 FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD 99.52
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.51
1ix5_A151 FKBP; ppiase, isomerase; NMR {Methanothermococcust 99.51
1ix5_A151 FKBP; ppiase, isomerase; NMR {Methanothermococcust 99.5
3cgm_A158 SLYD, peptidyl-prolyl CIS-trans isomerase; chapero 99.4
3cgm_A158 SLYD, peptidyl-prolyl CIS-trans isomerase; chapero 99.38
1w26_A432 Trigger factor, TF; chaperone, protein folding, ri 99.22
1w26_A 432 Trigger factor, TF; chaperone, protein folding, ri 99.13
1t11_A392 Trigger factor, TF; helix-turn-helix, four-helix-b 99.13
1t11_A392 Trigger factor, TF; helix-turn-helix, four-helix-b 98.97
3gty_X433 Trigger factor, TF; chaperone-client complex, cell 97.72
3gty_X 433 Trigger factor, TF; chaperone-client complex, cell 97.61
2fbn_A 198 70 kDa peptidylprolyl isomerase, putative; sulfur 96.2
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 95.12
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 95.1
2v6y_A83 AAA family ATPase, P60 katanin; MIT, VPS4, archaea 94.2
2w2u_A83 Hypothetical P60 katanin; hydrolase transport comp 92.17
1ihg_A 370 Cyclophilin 40; ppiase immunophilin tetratricopept 91.87
2cpt_A117 SKD1 protein, vacuolar sorting protein 4B; MIT, he 91.5
2v6x_A85 Vacuolar protein sorting-associated protein 4; pro 90.67
2crb_A97 Nuclear receptor binding factor 2; NRBF-2, MIT dom 90.04
1wfd_A93 Hypothetical protein 1500032H18; MIT domain, struc 87.34
2l6j_A111 TPR repeat-containing protein associated with HSP; 83.57
4a5x_A86 MITD1, MIT domain-containing protein 1; protein tr 81.82
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Back     alignment and structure
Probab=100.00  E-value=1.4e-68  Score=530.79  Aligned_cols=344  Identities=32%  Similarity=0.533  Sum_probs=213.6

Q ss_pred             cCeeecCCceEEEEEecCCCCCCCCCCCEEEEEEEEEECCCcEEEeeccCCCCCCccEEEEcCCCcccccHHHhhcCCCC
Q 013896           22 RRMKIVPGSLMKAVMRPGGGDSTPSDGDQVAYHCTVRTLDGVIVESTRSEYGGKGIPIRHVLGKSKILLGLLEGIPTMLK  101 (434)
Q Consensus        22 ~~~~~~~~gl~~~i~~~G~g~~~~~~gd~V~v~y~~~~~dg~~~~st~~~~~~~~~p~~~~lG~~~~i~g~~~al~~m~~  101 (434)
                      +...++++||+|+++++|+|..+|+.||.|.+||++++.||++|++|+.    ++.|+.|.+|.+++++||+++|.+|++
T Consensus         4 ~~~~~~~~Gl~~~i~~~G~G~~~~~~gd~V~v~Y~g~~~dG~~fdss~~----~~~p~~~~lG~g~~i~g~e~~l~gm~~   79 (356)
T 3jxv_A            4 EENEIGKQGLKKKLLKEGEGWDTPEVGDEVEVHYTGTLLDGKKFDSSRD----RDDTFKFKLGQGQVIKGWDQGIKTMKK   79 (356)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             ccceECCCCeEEEEEEeecCCccCCCCCEEEEEEEEEECCCCEEEEccc----CCCcEEEEeCCCccchHHHHHHhcCCC
Confidence            4466899999999999999965699999999999999999999999987    678999999999999999999999999


Q ss_pred             CcEEEEEEecccccCCCCCCCCCCCCCCCcceEEEEEEEEeeeecccccccccEEEEeeecCCCCCCCCCCCeEEEEEEE
Q 013896          102 GEVSMFKMKPQMHYGEDDCPVAAPSTFPKDEELHFEIEMIDFAKAKIIADDFGVVKKVINEGQGWETPRAPYEVKAWISA  181 (434)
Q Consensus       102 Ge~~~i~ip~~~ayG~~g~~~~~~~~ip~~~~lv~~i~l~~i~~~~~~~~d~g~~k~i~~~G~g~~~p~~gd~V~v~y~~  181 (434)
                      ||+++|+|||++|||+.+.+    +.|||+++|+|+|+|++|.++.++..|.++.+++++.|.|+.+|..||.|++||++
T Consensus        80 Ge~~~~~ip~~~aYG~~g~~----~~Ip~~~~l~f~vel~~~~~~~di~~D~~~~k~i~~~G~g~~~p~~g~~V~v~y~g  155 (356)
T 3jxv_A           80 GENALFTIPPELAYGESGSP----PTIPANATLQFDVELLSWTSVRDIAKDGGIFKKILKEGDKWENPKDPDEVFVKYEA  155 (356)
T ss_dssp             ------------------------------------------CCEEETTSSSSEEEEEEECCBSSCCCCTTCEEEEEEEE
T ss_pred             CCEEEEEEChHHhCCCCCCC----CCcCCCCEEEEEeeEEeeecccccccCceeEEEEEecCcccCCCCCCCEEEEEEEE
Confidence            99999999999999999975    68999999999999999999999999999999999999999999999999999999


Q ss_pred             EeCCCcEEeecCCCCCeEEEeCCCCccchHHHHHhcCccccEEEEEEeeeccCCCCCCC------CcCCCceEEEEEEeE
Q 013896          182 KTGDGKLILSHREGEPYFFTFGKSEVPKGLEMGIGTMTREEKAVIYVTSQYLTPSPLMP------VVEGCEEVHFEVELV  255 (434)
Q Consensus       182 ~~~dg~~~~s~~~~~p~~~~~g~~~~~~gl~~~l~~mk~Ge~~~~~v~~~~~~~~~~~~------~ip~~~~l~~~vel~  255 (434)
                      ++.||++|+++.   ++.|.+|++++++||++||.+|++||+++|+|||+++||..+.+      .||+++.|+|+|+|+
T Consensus       156 ~l~dgt~~~~~~---~~~f~~g~~~v~~gl~~~l~~m~~GE~~~~~v~p~~~yg~~G~~~~~~~~~ip~~~~l~~~vel~  232 (356)
T 3jxv_A          156 RLEDGTVVSKSE---GVEFTVKDGHLCPALAKAVKTMKKGEKVLLAVKPQYGFGEMGRPAAGEGGAVPPNASLVIDLELV  232 (356)
T ss_dssp             EETTSCEEEEEE---EEEEEGGGCSSSHHHHHHHTTCCBTCEEEEEECGGGTTTTTCBCCCC--CCBCTTCCEEEEEEEE
T ss_pred             EECCCCEEeccC---CEEEEeCCCCcchHHHHHHhhCCCCCEEEEEEChHhhcCCCCCCcccccccCCCCcEEEEEEEEE
Confidence            999999999973   78999999999999999999999999999999999999975332      599999999999999


Q ss_pred             EEEEeeeccCCcceEEEEEeCCCCCCCCCCCCCCCeEEEEEEEEEecCCCcEEEeccCCCCCCcEEEEeCCCCcchHHHH
Q 013896          256 HLIQVRDMLGDGRLIKRRIRDGKGEFPMDCPLHDSLLCVHYKGMLLNEEKKVFYDTRVDNDGQPLEFSSGEGLVPEGFEM  335 (434)
Q Consensus       256 ~~~~~~d~~~d~~~~k~il~~G~g~~~~~~P~~g~~V~v~y~~~~~~~~g~~~~ds~~~~~~~p~~~~lG~~~~~~gle~  335 (434)
                      +|....|++.|++++++++++|+|.   .+|..|+.|+|||++++.|  |++|+++... +++|+.|.+|.+++++||+.
T Consensus       233 ~~~~v~dv~~d~~~~~~i~~~g~g~---~~~~~gd~V~v~y~g~l~d--G~~fd~~~~~-~~~p~~f~~G~g~~i~G~e~  306 (356)
T 3jxv_A          233 SWKTVTEIGDDKKILKKVLKEXEGY---ERPNEGAVVTVKITGKLQD--GTVFLKKGHD-EQEPFEFKTDEEAVIEGLDR  306 (356)
T ss_dssp             EEECEEEESTTCCEEEEEEECCBSS---CCCCTTCEEEEEEEEEESS--SCEEEEESCT-TSCCCEEETTTTSSCHHHHH
T ss_pred             EEecccccccccceeEEeeeccccc---CCCCCCCEEEEEEEEEECC--CCEEeecccc-CCcCEEEEECCCccchHHHH
Confidence            9999999999999999999999996   3479999999999999987  9999665444 47899999999999999999


Q ss_pred             HHhcCCcccEEEEEecCCcccccCCC--CCCCCCCceEEEEEEEeeeec
Q 013896          336 CVRLMLPGEIALVTCPPDYAYDKFLR--PANVPEGAHIQWEIELLGFEK  382 (434)
Q Consensus       336 ~l~~M~~Ge~~~v~v~~~~ayg~~g~--~~~ip~~~~l~f~ieLl~v~~  382 (434)
                      +|.+|++||+++|+|||++|||+.+.  .+.|||+++|+|+|+|++|.+
T Consensus       307 ~l~gm~~Ge~~~v~ip~~~aYG~~~~~~~~~Ip~~~~l~f~vel~~~~~  355 (356)
T 3jxv_A          307 AVLNMKKGEVALVTIPPEYAYGSTESKQDAIVPPNSTVIYEVELVSFVK  355 (356)
T ss_dssp             HHTTCCBTCEEEEEECGGGTTTTSCEESSSEECTTCCEEEEEEEEEEEC
T ss_pred             HHhCCCCCCEEEEEEChHHccCCCCcCCCCcCCcCCeEEEEEEEEEEEc
Confidence            99999999999999999999999874  347999999999999999975
>1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Back     alignment and structure
>1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1yat_A FK506 binding protein; HET: FK5; 2.50A {Saccharomyces cerevisiae} SCOP: d.26.1.1 Back     alignment and structure
>3kz7_A FK506-binding protein 3; FKPB ppiase rapamycin, isomerase, nucleus, phosphoprotein, R isomerase-inhibitor complex; HET: RAP; 1.95A {Mus musculus} SCOP: d.26.1.1 PDB: 1pbk_A* Back     alignment and structure
>1r9h_A FKB-6, FK506 binding protein family; structural genomics, peptidylprolyl isomerase, PSI, protein structure initiative; 1.80A {Caenorhabditis elegans} SCOP: d.26.1.1 Back     alignment and structure
>2f4e_A ATFKBP42; FKBP-like, alpha-beta, signaling protein; 2.32A {Arabidopsis thaliana} Back     alignment and structure
>3o5e_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 1.60A {Homo sapiens} PDB: 3o5f_A Back     alignment and structure
>3o5q_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 0.96A {Homo sapiens} PDB: 3o5m_A 3o5l_A 3o5o_A 3o5p_A 3o5r_A* 4drk_A* 4drm_A* 4drn_A* 4dro_A* 4drp_A* 4drq_A* 3o5j_A 3o5g_A 3o5i_A 3o5k_A Back     alignment and structure
>2y78_A Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, virulence; HET: SO4 GOL; 0.91A {Burkholderia pseudomallei} PDB: 2ke0_A 2ko7_A* 2l2s_A* 4dz2_A* 4dz3_A* Back     alignment and structure
>2ppn_A FK506-binding protein 1A; high resolution protein structure, isomerase; 0.92A {Homo sapiens} SCOP: d.26.1.1 PDB: 1b6c_A 1a7x_A 1d7h_A 1d7i_A 1d7j_A* 1f40_A* 1fap_A* 1d6o_A* 1fkd_A* 1fkf_A* 1fkg_A* 1fkh_A* 1fki_A* 1fkj_A* 1fkr_A 1fks_A 1fkt_A 1j4h_A* 1j4i_A* 1j4r_A* ... Back     alignment and structure
>3o5e_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 1.60A {Homo sapiens} PDB: 3o5f_A Back     alignment and structure
>2lkn_A AH receptor-interacting protein; FKBP-type domain, immunophilin homolog, protein binding; NMR {Homo sapiens} Back     alignment and structure
>1jvw_A Macrophage infectivity potentiator; chagas disease, X-RAY rotamase, isomeras; 1.70A {Trypanosoma cruzi} SCOP: d.26.1.1 Back     alignment and structure
>4dip_A Peptidyl-prolyl CIS-trans isomerase FKBP14; structural genomics, structural genomics consortium, SGC, PE prolyl CIS-trans isomerase; 1.82A {Homo sapiens} Back     alignment and structure
>3o5q_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 0.96A {Homo sapiens} PDB: 3o5m_A 3o5l_A 3o5o_A 3o5p_A 3o5r_A* 4drk_A* 4drm_A* 4drn_A* 4dro_A* 4drp_A* 4drq_A* 3o5j_A 3o5g_A 3o5i_A 3o5k_A Back     alignment and structure
>2vn1_A 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR repeat; HET: FK5; 2.35A {Plasmodium falciparum} PDB: 2ofn_A 2ki3_A 3ihz_A* 3ni6_A 3pa7_A Back     alignment and structure
>2lgo_A FKBP; infectious disease, isomerase, giardiasis, ssgcid, structura genomics, seattle structural genomics center for infectious; NMR {Giardia lamblia} Back     alignment and structure
>2f4e_A ATFKBP42; FKBP-like, alpha-beta, signaling protein; 2.32A {Arabidopsis thaliana} Back     alignment and structure
>1u79_A FKBP-type peptidyl-prolyl CIS-trans isomerase 3; TFKBP13, FK-506 binding protein; 1.85A {Arabidopsis thaliana} SCOP: d.26.1.1 PDB: 1y0o_A Back     alignment and structure
>3b7x_A FK506-binding protein 6; isomerase, repeat, rotamase, TPR repeat, williams-beuren syndrome, structural genomics consortium, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>3oe2_A Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, FK506; HET: TAR SRT; 1.60A {Pseudomonas syringae PV} SCOP: d.26.1.0 Back     alignment and structure
>1fd9_A Protein (macrophage infectivity potentiator prote; FKBP domain, long alpha helix, dimerisation VIA helical INTE isomerase; 2.41A {Legionella pneumophila} SCOP: d.26.1.1 PDB: 2uz5_A 2vcd_A* Back     alignment and structure
>2lkn_A AH receptor-interacting protein; FKBP-type domain, immunophilin homolog, protein binding; NMR {Homo sapiens} Back     alignment and structure
>3b7x_A FK506-binding protein 6; isomerase, repeat, rotamase, TPR repeat, williams-beuren syndrome, structural genomics consortium, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>2jwx_A FKBP38NTD, FK506-binding protein 8 variant; apoptosis, beta barrel, central helix, with flexible N-terminal extension, isomerase; NMR {Homo sapiens} Back     alignment and structure
>3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 4giv_A* 1euv_B 3v60_A 3v61_A 3v62_A* Back     alignment and structure
>1r9h_A FKB-6, FK506 binding protein family; structural genomics, peptidylprolyl isomerase, PSI, protein structure initiative; 1.80A {Caenorhabditis elegans} SCOP: d.26.1.1 Back     alignment and structure
>3kz7_A FK506-binding protein 3; FKPB ppiase rapamycin, isomerase, nucleus, phosphoprotein, R isomerase-inhibitor complex; HET: RAP; 1.95A {Mus musculus} SCOP: d.26.1.1 PDB: 1pbk_A* Back     alignment and structure
>2vn1_A 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR repeat; HET: FK5; 2.35A {Plasmodium falciparum} PDB: 2ofn_A 2ki3_A 3ihz_A* 3ni6_A 3pa7_A Back     alignment and structure
>2awg_A 38 kDa FK-506 binding protein; FKBP-type, ppiase, BCL-2 inhibitor, SHH signalling antagonist, structural genomics consortium, SGC; 1.60A {Homo sapiens} PDB: 2f2d_A 3ey6_A Back     alignment and structure
>1yat_A FK506 binding protein; HET: FK5; 2.50A {Saccharomyces cerevisiae} SCOP: d.26.1.1 Back     alignment and structure
>2ppn_A FK506-binding protein 1A; high resolution protein structure, isomerase; 0.92A {Homo sapiens} SCOP: d.26.1.1 PDB: 1b6c_A 1a7x_A 1d7h_A 1d7i_A 1d7j_A* 1f40_A* 1fap_A* 1d6o_A* 1fkd_A* 1fkf_A* 1fkg_A* 1fkh_A* 1fki_A* 1fkj_A* 1fkr_A 1fks_A 1fkt_A 1j4h_A* 1j4i_A* 1j4r_A* ... Back     alignment and structure
>1q6h_A FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; chaperone, peptidyl-prolyl isomerase, heat shock protein, FK family; HET: MSE; 1.97A {Escherichia coli} SCOP: d.26.1.1 PDB: 1q6i_A* 1q6u_A Back     alignment and structure
>2d9f_A FK506-binding protein 8 variant; FKBP, rapamycin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2awg_A 38 kDa FK-506 binding protein; FKBP-type, ppiase, BCL-2 inhibitor, SHH signalling antagonist, structural genomics consortium, SGC; 1.60A {Homo sapiens} PDB: 2f2d_A 3ey6_A Back     alignment and structure
>2d9f_A FK506-binding protein 8 variant; FKBP, rapamycin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4dip_A Peptidyl-prolyl CIS-trans isomerase FKBP14; structural genomics, structural genomics consortium, SGC, PE prolyl CIS-trans isomerase; 1.82A {Homo sapiens} Back     alignment and structure
>3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 4giv_A* 1euv_B 3v60_A 3v61_A 3v62_A* Back     alignment and structure
>1jvw_A Macrophage infectivity potentiator; chagas disease, X-RAY rotamase, isomeras; 1.70A {Trypanosoma cruzi} SCOP: d.26.1.1 Back     alignment and structure
>2y78_A Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, virulence; HET: SO4 GOL; 0.91A {Burkholderia pseudomallei} PDB: 2ke0_A 2ko7_A* 2l2s_A* 4dz2_A* 4dz3_A* Back     alignment and structure
>2jwx_A FKBP38NTD, FK506-binding protein 8 variant; apoptosis, beta barrel, central helix, with flexible N-terminal extension, isomerase; NMR {Homo sapiens} Back     alignment and structure
>2lgo_A FKBP; infectious disease, isomerase, giardiasis, ssgcid, structura genomics, seattle structural genomics center for infectious; NMR {Giardia lamblia} Back     alignment and structure
>2pbc_A FK506-binding protein 2; endoplasmic reticulum, isomerase, polymorphism, rotamase, structural genomics, structural genomics consortium, SGC; 1.80A {Homo sapiens} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3oe2_A Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, FK506; HET: TAR SRT; 1.60A {Pseudomonas syringae PV} SCOP: d.26.1.0 Back     alignment and structure
>1fd9_A Protein (macrophage infectivity potentiator prote; FKBP domain, long alpha helix, dimerisation VIA helical INTE isomerase; 2.41A {Legionella pneumophila} SCOP: d.26.1.1 PDB: 2uz5_A 2vcd_A* Back     alignment and structure
>1u79_A FKBP-type peptidyl-prolyl CIS-trans isomerase 3; TFKBP13, FK-506 binding protein; 1.85A {Arabidopsis thaliana} SCOP: d.26.1.1 PDB: 1y0o_A Back     alignment and structure
>2pbc_A FK506-binding protein 2; endoplasmic reticulum, isomerase, polymorphism, rotamase, structural genomics, structural genomics consortium, SGC; 1.80A {Homo sapiens} Back     alignment and structure
>1q6h_A FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; chaperone, peptidyl-prolyl isomerase, heat shock protein, FK family; HET: MSE; 1.97A {Escherichia coli} SCOP: d.26.1.1 PDB: 1q6i_A* 1q6u_A Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1hxv_A Trigger factor; FKBP fold, ppiase, chaperone; NMR {Mycoplasma genitalium} SCOP: d.26.1.1 Back     alignment and structure
>2kr7_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; protein, rotamase; NMR {Helicobacter pylori} Back     alignment and structure
>4dt4_A FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; FKBP domain, IF domain, chaperone, peptidyl-prolyl isomerase isomerase; 1.35A {Escherichia coli} Back     alignment and structure
>4dt4_A FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; FKBP domain, IF domain, chaperone, peptidyl-prolyl isomerase isomerase; 1.35A {Escherichia coli} Back     alignment and structure
>1hxv_A Trigger factor; FKBP fold, ppiase, chaperone; NMR {Mycoplasma genitalium} SCOP: d.26.1.1 Back     alignment and structure
>2k8i_A SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, chaperone, rotamase; NMR {Escherichia coli} Back     alignment and structure
>2kr7_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; protein, rotamase; NMR {Helicobacter pylori} Back     alignment and structure
>3pr9_A FKBP-type peptidyl-prolyl CIS-trans isomerase; FKBP protein, chaperone; 1.95A {Methanocaldococcus jannaschii} SCOP: d.26.1.0 PDB: 3pra_A Back     alignment and structure
>3prb_A FKBP-type peptidyl-prolyl CIS-trans isomerase; chaperone; 2.20A {Methanocaldococcus jannaschii} PDB: 3prd_A Back     alignment and structure
>2k8i_A SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, chaperone, rotamase; NMR {Escherichia coli} Back     alignment and structure
>3prb_A FKBP-type peptidyl-prolyl CIS-trans isomerase; chaperone; 2.20A {Methanocaldococcus jannaschii} PDB: 3prd_A Back     alignment and structure
>2kfw_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD; protein, cobalt, copper, cytoplasm, metal- binding, nickel, rotamase, zinc; NMR {Escherichia coli} Back     alignment and structure
>3pr9_A FKBP-type peptidyl-prolyl CIS-trans isomerase; FKBP protein, chaperone; 1.95A {Methanocaldococcus jannaschii} SCOP: d.26.1.0 PDB: 3pra_A Back     alignment and structure
>2kfw_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD; protein, cobalt, copper, cytoplasm, metal- binding, nickel, rotamase, zinc; NMR {Escherichia coli} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>1ix5_A FKBP; ppiase, isomerase; NMR {Methanothermococcusthermolithotrophicus} SCOP: d.26.1.1 Back     alignment and structure
>1ix5_A FKBP; ppiase, isomerase; NMR {Methanothermococcusthermolithotrophicus} SCOP: d.26.1.1 Back     alignment and structure
>3cgm_A SLYD, peptidyl-prolyl CIS-trans isomerase; chaperone function, two domain P rotamase; 2.41A {Thermus thermophilus} PDB: 3cgn_A 3luo_A* Back     alignment and structure
>3cgm_A SLYD, peptidyl-prolyl CIS-trans isomerase; chaperone function, two domain P rotamase; 2.41A {Thermus thermophilus} PDB: 3cgn_A 3luo_A* Back     alignment and structure
>1w26_A Trigger factor, TF; chaperone, protein folding, ribosome associated protein, nascent chain, cell division, isomerase; 2.7A {Escherichia coli} SCOP: a.223.1.1 d.241.2.1 d.26.1.1 PDB: 2vrh_A 1w2b_5 Back     alignment and structure
>1w26_A Trigger factor, TF; chaperone, protein folding, ribosome associated protein, nascent chain, cell division, isomerase; 2.7A {Escherichia coli} SCOP: a.223.1.1 d.241.2.1 d.26.1.1 PDB: 2vrh_A 1w2b_5 Back     alignment and structure
>1t11_A Trigger factor, TF; helix-turn-helix, four-helix-bundle, ppiase, chaperone; 2.50A {Vibrio cholerae} SCOP: a.223.1.1 d.241.2.1 d.26.1.1 PDB: 1l1p_A Back     alignment and structure
>1t11_A Trigger factor, TF; helix-turn-helix, four-helix-bundle, ppiase, chaperone; 2.50A {Vibrio cholerae} SCOP: a.223.1.1 d.241.2.1 d.26.1.1 PDB: 1l1p_A Back     alignment and structure
>3gty_X Trigger factor, TF; chaperone-client complex, cell cycle, cell division, chapero isomerase, rotamase, ribonucleoprotein, binding; 3.40A {Thermotoga maritima} PDB: 3gu0_A Back     alignment and structure
>3gty_X Trigger factor, TF; chaperone-client complex, cell cycle, cell division, chapero isomerase, rotamase, ribonucleoprotein, binding; 3.40A {Thermotoga maritima} PDB: 3gu0_A Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2v6y_A AAA family ATPase, P60 katanin; MIT, VPS4, archaea, AAA-ATPase, ATP-binding, microtubule INT and trafficking domain, nucleotide-binding; HET: SRT; 2.40A {Sulfolobus solfataricus} PDB: 2v6y_B* Back     alignment and structure
>2w2u_A Hypothetical P60 katanin; hydrolase transport complex, nucleotide-binding, ESCRT, AAA-ATPase, cytokinesis, ATP-binding; 2.20A {Sulfolobus acidocaldarius} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2cpt_A SKD1 protein, vacuolar sorting protein 4B; MIT, helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.7.14.1 Back     alignment and structure
>2v6x_A Vacuolar protein sorting-associated protein 4; protein transport, vacuole, endosome, transport, ESCRT-III, VPS2, VPS4, SKD1, VPS4B, VPS4A; 1.98A {Saccharomyces cerevisiae} Back     alignment and structure
>2crb_A Nuclear receptor binding factor 2; NRBF-2, MIT domain, helix bundle, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.7.16.1 Back     alignment and structure
>1wfd_A Hypothetical protein 1500032H18; MIT domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: a.7.14.1 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>4a5x_A MITD1, MIT domain-containing protein 1; protein transport, ESCRT, cytokinesis, midbody; HET: P15; 1.91A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 434
d1kt1a3115 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {M 9e-14
d1kt1a3115 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {M 3e-11
d1kt1a3115 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {M 2e-08
d1r9ha_118 d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabd 3e-13
d1r9ha_118 d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabd 3e-12
d1r9ha_118 d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabd 4e-08
d1q1ca2117 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {H 2e-12
d1q1ca2117 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {H 6e-11
d1q1ca2117 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {H 9e-10
d1pbka_116 d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 7e-12
d1pbka_116 d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 6e-10
d1pbka_116 d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 7e-05
d1q1ca1120 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Hu 9e-12
d1q1ca1120 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Hu 2e-10
d1q1ca1120 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Hu 2e-07
d1kt1a2111 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Mo 2e-11
d1kt1a2111 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Mo 8e-11
d1kt1a2111 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Mo 5e-09
d1yata_113 d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeas 7e-11
d1yata_113 d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeas 1e-08
d1yata_113 d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeas 2e-05
d1fd9a_204 d.26.1.1 (A:) Macrophage infectivity potentiator p 4e-10
d1fd9a_204 d.26.1.1 (A:) Macrophage infectivity potentiator p 8e-08
d1q6ha_210 d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase 7e-09
d1q6ha_210 d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase 8e-08
d1u79a_125 d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis tha 8e-09
d1u79a_125 d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis tha 4e-04
d2ppna1107 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12) 1e-08
d2ppna1107 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12) 7e-08
d2ppna1107 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12) 3e-07
d1jvwa_160 d.26.1.1 (A:) Macrophage infectivity potentiator p 2e-07
d1jvwa_160 d.26.1.1 (A:) Macrophage infectivity potentiator p 3e-05
d1ix5a_151 d.26.1.1 (A:) Archaeal FKBP {Archaeon Methanococcu 9e-06
d1ix5a_151 d.26.1.1 (A:) Archaeal FKBP {Archaeon Methanococcu 0.003
d1p5qa1 170 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal d 0.001
d2fbna1153 a.118.8.1 (A:22-174) Putative 70 kda peptidylproly 0.002
d2c2la1 201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 0.002
d1elwa_117 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 0.004
>d1kt1a3 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 115 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: FKBP-like
superfamily: FKBP-like
family: FKBP immunophilin/proline isomerase
domain: FKBP51, N-terminal domains
species: Monkey (Saimiri boliviensis) [TaxId: 27679]

 Score = 65.5 bits (159), Expect = 9e-14
 Identities = 25/122 (20%), Positives = 46/122 (37%), Gaps = 11/122 (9%)

Query: 262 DMLGDGRLIKRRIRDGKGEFPMDCPLHDSLLCVHYKGMLLNEEKKVFYDTRVDNDGQPLE 321
           D+L DG +I+R  R G+G      P   + + +H +G                 +G+   
Sbjct: 3   DLLEDGGIIRRTKRRGEGY---SNPNEGARVQIHLEGRCGGRVFDCRDVAFTVGEGED-- 57

Query: 322 FSSGEGLVPEGFEMCVRLMLPGEIALVTCPPDYAY-DKFLRPANVPEGAHIQWEIELLGF 380
                  +P G +  +  M   E  ++   P Y + +       +   A + +E+ L  F
Sbjct: 58  -----HDIPIGIDKALEKMQREEQCILHLGPRYGFGEAGKPKFGIEPNAELIYEVTLKSF 112

Query: 381 EK 382
           EK
Sbjct: 113 EK 114
>d1kt1a3 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 115 Back     information, alignment and structure
>d1kt1a3 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 115 Back     information, alignment and structure
>d1r9ha_ d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabditis elegans [TaxId: 6239]} Length = 118 Back     information, alignment and structure
>d1r9ha_ d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabditis elegans [TaxId: 6239]} Length = 118 Back     information, alignment and structure
>d1r9ha_ d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabditis elegans [TaxId: 6239]} Length = 118 Back     information, alignment and structure
>d1q1ca2 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1q1ca2 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1q1ca2 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1pbka_ d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 9606]} Length = 116 Back     information, alignment and structure
>d1pbka_ d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 9606]} Length = 116 Back     information, alignment and structure
>d1pbka_ d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 9606]} Length = 116 Back     information, alignment and structure
>d1q1ca1 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 120 Back     information, alignment and structure
>d1q1ca1 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 120 Back     information, alignment and structure
>d1q1ca1 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 120 Back     information, alignment and structure
>d1kt1a2 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 111 Back     information, alignment and structure
>d1kt1a2 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 111 Back     information, alignment and structure
>d1kt1a2 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 111 Back     information, alignment and structure
>d1yata_ d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 113 Back     information, alignment and structure
>d1yata_ d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 113 Back     information, alignment and structure
>d1yata_ d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 113 Back     information, alignment and structure
>d1fd9a_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Legionella pneumophila [TaxId: 446]} Length = 204 Back     information, alignment and structure
>d1fd9a_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Legionella pneumophila [TaxId: 446]} Length = 204 Back     information, alignment and structure
>d1q6ha_ d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase FkpA {Escherichia coli [TaxId: 562]} Length = 210 Back     information, alignment and structure
>d1q6ha_ d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase FkpA {Escherichia coli [TaxId: 562]} Length = 210 Back     information, alignment and structure
>d1u79a_ d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 125 Back     information, alignment and structure
>d1u79a_ d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 125 Back     information, alignment and structure
>d2ppna1 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d2ppna1 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d2ppna1 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1jvwa_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Trypanosoma cruzi [TaxId: 5693]} Length = 160 Back     information, alignment and structure
>d1jvwa_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Trypanosoma cruzi [TaxId: 5693]} Length = 160 Back     information, alignment and structure
>d1ix5a_ d.26.1.1 (A:) Archaeal FKBP {Archaeon Methanococcus thermolithotrophicus [TaxId: 2186]} Length = 151 Back     information, alignment and structure
>d1ix5a_ d.26.1.1 (A:) Archaeal FKBP {Archaeon Methanococcus thermolithotrophicus [TaxId: 2186]} Length = 151 Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Length = 153 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query434
d1q1ca1120 FKBP52, N-terminal domains {Human (Homo sapiens) [ 99.94
d1r9ha_118 FKB-6, N-terminal domain {Caenorhabditis elegans [ 99.94
d2ppna1107 FK-506 binding protein (FKBP12), an immunophilin { 99.94
d1yata_113 Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyc 99.94
d1q1ca1120 FKBP52, N-terminal domains {Human (Homo sapiens) [ 99.94
d1kt1a2111 FKBP51, N-terminal domains {Monkey (Saimiri bolivi 99.93
d1r9ha_118 FKB-6, N-terminal domain {Caenorhabditis elegans [ 99.93
d1fd9a_204 Macrophage infectivity potentiator protein (MIP) { 99.93
d1q6ha_210 Peptidyl-prolyl cis-trans isomerase FkpA {Escheric 99.93
d1kt1a2111 FKBP51, N-terminal domains {Monkey (Saimiri bolivi 99.92
d1yata_113 Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyc 99.92
d2ppna1107 FK-506 binding protein (FKBP12), an immunophilin { 99.92
d1pbka_116 FKBP25 {Human (Homo sapiens) [TaxId: 9606]} 99.92
d1jvwa_160 Macrophage infectivity potentiator protein (MIP) { 99.91
d1pbka_116 FKBP25 {Human (Homo sapiens) [TaxId: 9606]} 99.91
d1u79a_125 FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 99.91
d1kt1a3115 FKBP51, N-terminal domains {Monkey (Saimiri bolivi 99.9
d1jvwa_160 Macrophage infectivity potentiator protein (MIP) { 99.89
d1fd9a_204 Macrophage infectivity potentiator protein (MIP) { 99.88
d1kt1a3115 FKBP51, N-terminal domains {Monkey (Saimiri bolivi 99.88
d1q6ha_210 Peptidyl-prolyl cis-trans isomerase FkpA {Escheric 99.87
d1q1ca2117 FKBP52, N-terminal domains {Human (Homo sapiens) [ 99.87
d1q1ca2117 FKBP52, N-terminal domains {Human (Homo sapiens) [ 99.85
d1u79a_125 FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 99.85
d1ix5a_151 Archaeal FKBP {Archaeon Methanococcus thermolithot 99.53
d1ix5a_151 Archaeal FKBP {Archaeon Methanococcus thermolithot 99.49
d1hxva_85 Trigger factor PPIase domain {Mycoplasma genitaliu 99.49
d1hxva_85 Trigger factor PPIase domain {Mycoplasma genitaliu 99.41
d1l1pa_106 Trigger factor PPIase domain {Escherichia coli [Ta 98.98
d1t11a3113 Trigger factor PPIase domain {Vibrio cholerae [Tax 98.89
d1l1pa_106 Trigger factor PPIase domain {Escherichia coli [Ta 98.79
d1t11a3113 Trigger factor PPIase domain {Vibrio cholerae [Tax 98.68
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.01
d1ihga1 169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 95.65
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 95.62
d2crba183 Nuclear receptor binding factor 2, NRBF2, N-termin 93.24
d1wfda_93 Hypothetical protein 1500032H18Rik {Mouse (Mus mus 91.47
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 87.29
d1wr0a177 Vacuolar sorting protein 4b (VPS4B, SKD1 protein) 86.25
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 86.17
>d1q1ca1 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: FKBP-like
superfamily: FKBP-like
family: FKBP immunophilin/proline isomerase
domain: FKBP52, N-terminal domains
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.94  E-value=8.5e-27  Score=192.18  Aligned_cols=110  Identities=31%  Similarity=0.494  Sum_probs=104.6

Q ss_pred             CCceEEEEEecCCCCCCCCCCCEEEEEEEEEECCCcEEEeeccCCCCCCccEEEEcCCCcccccHHHhhcCCCCCcEEEE
Q 013896           28 PGSLMKAVMRPGGGDSTPSDGDQVAYHCTVRTLDGVIVESTRSEYGGKGIPIRHVLGKSKILLGLLEGIPTMLKGEVSMF  107 (434)
Q Consensus        28 ~~gl~~~i~~~G~g~~~~~~gd~V~v~y~~~~~dg~~~~st~~~~~~~~~p~~~~lG~~~~i~g~~~al~~m~~Ge~~~i  107 (434)
                      ++||+|+++++|+|...|..||.|.+||++++.||++|++|++    .+.|+.|.+|.+++++||+++|.+|++||+++|
T Consensus        10 d~gv~~~i~~~G~G~~~P~~gd~V~v~y~~~l~dG~~fdss~~----~~~p~~f~~g~~~~i~G~~~~l~~M~~Ge~~~~   85 (120)
T d1q1ca1          10 DEGVLKVIKREGTGTEMPMIGDRVFVHYTGWLLDGTKFDSSLD----RKDKFSFDLGKGEVIKAWDIAIATMKVGEVCHI   85 (120)
T ss_dssp             SSSEEEEEEECCSSSCCCCTTCEEEEEEEEEETTSCEEEESTT----SSSCEEEETTTTSSCHHHHHHHTTCCTTCEEEE
T ss_pred             CCCEEEEEEEcccCCcCCCCCCEEEEEEEEEEcCCCEEEeccc----cccceeeecCCCceeeeeeeeeccccCCcEEEE
Confidence            5999999999999987799999999999999999999999998    788999999999999999999999999999999


Q ss_pred             EEecccccCCCCCCCCCCCCCCCcceEEEEEEEEeeee
Q 013896          108 KMKPQMHYGEDDCPVAAPSTFPKDEELHFEIEMIDFAK  145 (434)
Q Consensus       108 ~ip~~~ayG~~g~~~~~~~~ip~~~~lv~~i~l~~i~~  145 (434)
                      +|||++|||++|++    +.|||+++|+|+|+|++|+.
T Consensus        86 ~ip~~laYG~~g~~----~~IPp~s~LifeIeLl~v~~  119 (120)
T d1q1ca1          86 TCKPEYAYGSAGSP----PKIPPNATLVFEVELFEFKG  119 (120)
T ss_dssp             EECGGGTTTTTCBT----TTBCTTCCEEEEEEEEEEEC
T ss_pred             EECHHHhCCCcCCC----CCCCcCCcEEEEEEEEEEeC
Confidence            99999999999975    68999999999999999974
>d1r9ha_ d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2ppna1 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yata_ d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q1ca1 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a2 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1r9ha_ d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1fd9a_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1q6ha_ d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase FkpA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kt1a2 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1yata_ d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ppna1 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pbka_ d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jvwa_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1pbka_ d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u79a_ d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1kt1a3 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1jvwa_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1fd9a_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1kt1a3 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1q6ha_ d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase FkpA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q1ca2 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q1ca2 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u79a_ d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ix5a_ d.26.1.1 (A:) Archaeal FKBP {Archaeon Methanococcus thermolithotrophicus [TaxId: 2186]} Back     information, alignment and structure
>d1ix5a_ d.26.1.1 (A:) Archaeal FKBP {Archaeon Methanococcus thermolithotrophicus [TaxId: 2186]} Back     information, alignment and structure
>d1hxva_ d.26.1.1 (A:) Trigger factor PPIase domain {Mycoplasma genitalium [TaxId: 2097]} Back     information, alignment and structure
>d1hxva_ d.26.1.1 (A:) Trigger factor PPIase domain {Mycoplasma genitalium [TaxId: 2097]} Back     information, alignment and structure
>d1l1pa_ d.26.1.1 (A:) Trigger factor PPIase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t11a3 d.26.1.1 (A:135-247) Trigger factor PPIase domain {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1l1pa_ d.26.1.1 (A:) Trigger factor PPIase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t11a3 d.26.1.1 (A:135-247) Trigger factor PPIase domain {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crba1 a.7.16.1 (A:8-90) Nuclear receptor binding factor 2, NRBF2, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wfda_ a.7.14.1 (A:) Hypothetical protein 1500032H18Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wr0a1 a.7.14.1 (A:5-81) Vacuolar sorting protein 4b (VPS4B, SKD1 protein) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure