Citrus Sinensis ID: 013909

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430----
MARFDHHNKHTYTKTGCWFLCVLGLLGAALIADFMWASSSSSFSSSSAHLSVASNWALEKSGVVVIPHVNATKIDRQRESVAVIDKKGQDAERFLSATFADLPAPDLEWEQMPSAPVPRLDGAAIQIKNLFYVFAGYGSLDYVHSHVDVYNFTDNKWVDRFDMPKDMAHSHLGVVSDGRYIYIVSGQYGPQCRGPTSRTFVLDSETRKWDSIPPLPSPRYSPATQLWRGRLHVMGGSKENRHTPGLEHWSIAVKDGKALEKAWRTEIPIPRGGPHRACFVFNDRLFVVGGQEGDFMAKPGSPIFKCSRRHEVVYGDVYMLDDEMKWKVLPPMPKPNSHIECAWVIVNNSIIITGGTTEKHPMTKRMILVGEVFQFHLDSLTWSVIGKLPYRIKTTLTGFWDGWLYFTSGQRDRGPENPQPRKVIGEMWRTKLHL
ccccccccccccEEEEEEHHHHHHHHcEEEEEcEEEEEcccccccccccccccccccccccccEEccccccccccccccEEEEEEccccccccccEEEEEEcccccccEEEcccccccccccEEEEEccEEEEEEccccccccccEEEEEEcccccEEccccccccccccEEEEEEEccEEEEEccccccccccccccEEEEEcccccEEccccccccccccEEEEEccEEEEEcccccccccccEEEEEccccccccccccEEEccccccccccEEEEEEccEEEEEcccccccccccccccccccccEEEEEEEEEEccccccEEEccccccccccccEEEEEEccEEEEEcccccccccccccEEEcEEEEEEcccccEEEEcccccccccEEEEEEccEEEEEEccccccccccEEEEcccccEEEcccc
cccccccccccccccEEEEEHHHHHHHHHHHHHHHHHccccccccccEEEcccccccccccccEEEccccccccccccccEEEcccccccccccHcHHHcccccccccccccccccccccccEEEEEccEEEEEEccccccccccEEEEEcccccccccccccccccccccEEEEEcccEEEEEEccccccccccccEEEEEccccccccccccccccccccEEEEEccEEEEEEccccccccccEEEEEEEEcccccccccccccccccccccccEEEEEccEEEEEEccccccccccccccEEcccccccEcccEEEcccccccEEccccccccccccEEEEEEccEEEEEEcccccccccccEEEEEEEEEEccccccEEEccccccccccEEEEEEccEEEEEEcccccccccccccEEEccEEEEEccc
marfdhhnkhtytktgCWFLCVLGLLGAALIADFmwasssssfssssahLSVASNWALEKSGVvviphvnatkidrqrESVAVIDKKGQDAERFLSAtfadlpapdleweqmpsapvprldgaAIQIKNLFYVFAGygsldyvhshvdvynftdnkwvdrfdmpkdmahshlgvvsDGRYIYIVsgqygpqcrgptsrtfvldsetrkwdsipplpspryspatqlwrgrlhvmggskenrhtpglehwsiAVKDGKALEKAWrteipiprggphracfvfndrlfvvggqegdfmakpgspifkcsrrhevvygdvymlddemkwkvlppmpkpnshieCAWVIVNNSIiitggttekhpmtkRMILVGEVFQFHLDSLtwsvigklpyrikttltgfwdgwlyftsgqrdrgpenpqprkvIGEMWRTKLHL
marfdhhnkhtytktgCWFLCVLGLLGAALIADFMWASSSSSFSSSSAHLSVASNWALEKSGVVVIPHvnatkidrqresvAVIDKKGQDAERFLSATFADLPAPDLEWEQMPSAPVPRLDGAAIQIKNLFYVFAGYGSLDYVHSHVDVYNFTDNKWVDRFDMPKDMAHSHLGVVSDGRYIYIVSGqygpqcrgptSRTFVLDsetrkwdsipplpspryspATQLWRGRLHVMGGSkenrhtpglehwsiAVKDGKALEKAWRTeipiprggphRACFVFNDRLFVVGGQEGDFMAkpgspifkcsrrhEVVYGDVYMLDDEMKWKVLPPMPKPNSHIECAWVIVNNSIIITGGTTEKHPMTKRMILVGEVFQFHLDSLTWSVIGKLPYRIKTTLTGFWDGWLYFTsgqrdrgpenpqprkvigemwrtklhl
MARFDHHNKHTYTKTGCWFLCVLGLLGAALIADFMWasssssfssssahlsvasNWALEKSGVVVIPHVNATKIDRQRESVAVIDKKGQDAERFLSATFADLPAPDLEWEQMPSAPVPRLDGAAIQIKNLFYVFAGYGSLDYVHSHVDVYNFTDNKWVDRFDMPKDMAHSHLGVVSDGRYIYIVSGQYGPQCRGPTSRTFVLDSETRKWDSIPPLPSPRYSPATQLWRGRLHVMGGSKENRHTPGLEHWSIAVKDGKALEKAWRTEIPIPRGGPHRACFVFNDRLFVVGGQEGDFMAKPGSPIFKCSRRHEVVYGDVYMLDDEMKWKVLPPMPKPNSHIECAWVIVNNSIIITGGTTEKHPMTKRMILVGEVFQFHLDSLTWSVIGKLPYRIKTTLTGFWDGWLYFTSGQRDRGPENPQPRKVIGEMWRTKLHL
*********HTYTKTGCWFLCVLGLLGAALIADFMWA************LSVASNWALEKSGVVVIPHVNATKIDRQRESVAVIDK*****ERFLSATFADLPAPDLEWE*****PVPRLDGAAIQIKNLFYVFAGYGSLDYVHSHVDVYNFTDNKWVDRFDMPKDMAHSHLGVVSDGRYIYIVSGQYGPQCRGPTSRTFVLD********************TQLWRGRLHVM*********PGLEHWSIAVKDGKALEKAWRTEIPIPRGGPHRACFVFNDRLFVVGGQEGDFMAKPGSPIFKCSRRHEVVYGDVYMLDDEMKWKVLPPMPKPNSHIECAWVIVNNSIIITGGTTEKHPMTKRMILVGEVFQFHLDSLTWSVIGKLPYRIKTTLTGFWDGWLYFT***************************
*********H*YTKTGCWFLCVLGLLGAALIADFMWASSSSSFSSSSAHLSVASNWALEKSGV*************QRESVAVIDKKGQDAERFLSATFADLPAPDLEWEQMPSAPVPRLDGAAIQIKNLFYVFAGYGSLDYVHSHVDVYNFTDNKWVDRFDMPKDMAHSHLGVVSDGRYIYIVSGQYGPQCRGPTSRTFVLDSETRKWDSIPPLPSPRYSPATQLWRGRLHVMGGSKENRHTPGLEHWSIAVKDGKALEKAWRTEIPIPRGGPHRACFVFNDRLFVVGGQEGDFMAKPGSPIFKCSRRHEVVYGDVYMLDDEMKWKVLPPMPKPNSHIECAWVIVNNSIIITGGTTEKHPMTKRMILVGEVFQFHLDSLTWSVIGKLPYRIKTTLTGFWDGWLYFTSGQRDRGPENPQPRKVIGEMWRTKLHL
MARFDHHNKHTYTKTGCWFLCVLGLLGAALIADFMWAS*************VASNWALEKSGVVVIPHVNATKIDRQRESVAVIDKKGQDAERFLSATFADLPAPDLEWEQMPSAPVPRLDGAAIQIKNLFYVFAGYGSLDYVHSHVDVYNFTDNKWVDRFDMPKDMAHSHLGVVSDGRYIYIVSGQYGPQCRGPTSRTFVLDSETRKWDSIPPLPSPRYSPATQLWRGRLHVMGGSKENRHTPGLEHWSIAVKDGKALEKAWRTEIPIPRGGPHRACFVFNDRLFVVGGQEGDFMAKPGSPIFKCSRRHEVVYGDVYMLDDEMKWKVLPPMPKPNSHIECAWVIVNNSIIITGGTTEKHPMTKRMILVGEVFQFHLDSLTWSVIGKLPYRIKTTLTGFWDGWLYFTSGQ********QPRKVIGEMWRTKLHL
*************KTGCWFLCVLGLLGAALIADFMWASSSSSFSSSSAHLSVASNWALEKSGVVVIPHVNATKI*R*RESVAVIDKKGQDAERFLSATFADLPAPDLEWEQMPSAPVPRLDGAAIQIKNLFYVFAGYGSLDYVHSHVDVYNFTDNKWVDRFDMPKDMAHSHLGVVSDGRYIYIVSGQYGPQCRGPTSRTFVLDSETRKWDSIPPLPSPRYSPATQLWRGRLHVMGGSKENRHTPGLEHWSIAVKDGKALEKAWRTEIPIPRGGPHRACFVFNDRLFVVGGQEGDFMAKPGSPIFKCSRRHEVVYGDVYMLDDEMKWKVLPPMPKPNSHIECAWVIVNNSIIITGGTTEKHPMTKRMILVGEVFQFHLDSLTWSVIGKLPYRIKTTLTGFWDGWLYFTSGQRDRGPENPQPRKVIGEMWRTKLHL
iiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MARFDHHNKHTYTKTGCWFLCVLGLLGAALIADFMWASSSSSFSSSSAHLSVASNWALEKSGVVVIPHVNATKIDRQRESVAVIDKKGQDAERFLSATFADLPAPDLEWEQMPSAPVPRLDGAAIQIKNLFYVFAGYGSLDYVHSHVDVYNFTDNKWVDRFDMPKDMAHSHLGVVSDGRYIYIVSGQYGPQCRGPTSRTFVLDSETRKWDSIPPLPSPRYSPATQLWRGRLHVMGGSKENRHTPGLEHWSIAVKDGKALEKAWRTEIPIPRGGPHRACFVFNDRLFVVGGQEGDFMAKPGSPIFKCSRRHEVVYGDVYMLDDEMKWKVLPPMPKPNSHIECAWVIVNNSIIITGGTTEKHPMTKRMILVGEVFQFHLDSLTWSVIGKLPYRIKTTLTGFWDGWLYFTSGQRDRGPENPQPRKVIGEMWRTKLHL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query434 2.2.26 [Sep-21-2011]
Q9LK31426 Kelch repeat-containing p no no 0.933 0.950 0.672 1e-166
Q5ZKD9610 Kelch-like protein 20 OS= yes no 0.398 0.283 0.254 1e-09
Q6DFF6604 Kelch-like protein 20 OS= N/A no 0.398 0.286 0.254 1e-09
D3Z8N4609 Kelch-like protein 20 OS= yes no 0.398 0.284 0.248 3e-09
Q8VCK5604 Kelch-like protein 20 OS= yes no 0.398 0.286 0.248 3e-09
Q9Y2M5609 Kelch-like protein 20 OS= yes no 0.398 0.284 0.248 3e-09
Q08DK3609 Kelch-like protein 20 OS= yes no 0.398 0.284 0.248 3e-09
Q5R7B8609 Kelch-like protein 20 OS= yes no 0.398 0.284 0.248 3e-09
Q91XA8350 Kelch domain-containing p no no 0.546 0.677 0.211 4e-09
B4J045624 Kelch-like protein diablo N/A no 0.398 0.277 0.232 9e-09
>sp|Q9LK31|Y3272_ARATH Kelch repeat-containing protein At3g27220 OS=Arabidopsis thaliana GN=At3g27220 PE=1 SV=1 Back     alignment and function desciption
 Score =  585 bits (1509), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 279/415 (67%), Positives = 334/415 (80%), Gaps = 10/415 (2%)

Query: 20  LCVLGLLGAALIADFMWASSSSSFSSSSAHLSVASNWALEKSGVVVIPHVNATKIDRQRE 79
           L    +LG   IA F+    SSS  S SA  S+   W       + IP +++  +  Q+ 
Sbjct: 22  LYFTSVLGIGFIAAFL--CLSSSIPSVSAVFSI---WVPVNRPEIQIPIIDSKIV--QKR 74

Query: 80  SVAVIDKKGQDAERFLSATFADLPAPDLEWEQMPSAPVPRLDGAAIQIKNLFYVFAGYGS 139
           S    D K  D  RFLSA FAD+PAP+L+WE+M SAPVPRLDG ++QI NL YVF+GYGS
Sbjct: 75  SKQSNDTK--DHVRFLSAIFADIPAPELKWEEMESAPVPRLDGYSVQINNLLYVFSGYGS 132

Query: 140 LDYVHSHVDVYNFTDNKWVDRFDMPKDMAHSHLGVVSDGRYIYIVSGQYGPQCRGPTSRT 199
           LDYVHSHVDV+NFTDNKW DRF  PK+MA+SHLG+V+DGRY+Y+VSGQ GPQCRGPTSR+
Sbjct: 133 LDYVHSHVDVFNFTDNKWCDRFHTPKEMANSHLGIVTDGRYVYVVSGQLGPQCRGPTSRS 192

Query: 200 FVLDSETRKWDSIPPLPSPRYSPATQLWRGRLHVMGGSKENRHTPGLEHWSIAVKDGKAL 259
           FVLDS T+ W   P LP+PRY+PATQ+WRGRLHVMGGSKENR+    +HWSIAVKDGKAL
Sbjct: 193 FVLDSFTKTWLEFPSLPAPRYAPATQIWRGRLHVMGGSKENRNAVAFDHWSIAVKDGKAL 252

Query: 260 EKAWRTEIPIPRGGPHRACFVFNDRLFVVGGQEGDFMAKPGSPIFKCSRRHEVVYGDVYM 319
           ++ WR E+PIPRGGPHRAC V ND+L V+GGQEGDFMAKP SPIFKCSRR E+  G+VYM
Sbjct: 253 DE-WREEVPIPRGGPHRACVVANDKLLVIGGQEGDFMAKPNSPIFKCSRRREIFNGEVYM 311

Query: 320 LDDEMKWKVLPPMPKPNSHIECAWVIVNNSIIITGGTTEKHPMTKRMILVGEVFQFHLDS 379
           +D+EMKWK+LPPMPK NSHIE AW+IVNNSI+I GGTT+ HP+TKR++LVGE+F+F LD+
Sbjct: 312 MDEEMKWKMLPPMPKNNSHIESAWIIVNNSIVIVGGTTDWHPVTKRLVLVGEIFRFQLDT 371

Query: 380 LTWSVIGKLPYRIKTTLTGFWDGWLYFTSGQRDRGPENPQPRKVIGEMWRTKLHL 434
           LTWSVIG+LPYR+KT + GFW+G+LYFTSGQRDRGP+NPQP KVIGEMWRTKL  
Sbjct: 372 LTWSVIGRLPYRVKTAMAGFWNGYLYFTSGQRDRGPDNPQPGKVIGEMWRTKLKF 426

Arabidopsis thaliana (taxid: 3702)
>sp|Q5ZKD9|KLH20_CHICK Kelch-like protein 20 OS=Gallus gallus GN=KLHL20 PE=2 SV=1 Back     alignment and function description
>sp|Q6DFF6|KLH20_XENLA Kelch-like protein 20 OS=Xenopus laevis GN=klhl20 PE=2 SV=1 Back     alignment and function description
>sp|D3Z8N4|KLH20_RAT Kelch-like protein 20 OS=Rattus norvegicus GN=Klhl20 PE=3 SV=1 Back     alignment and function description
>sp|Q8VCK5|KLH20_MOUSE Kelch-like protein 20 OS=Mus musculus GN=Klhl20 PE=2 SV=2 Back     alignment and function description
>sp|Q9Y2M5|KLH20_HUMAN Kelch-like protein 20 OS=Homo sapiens GN=KLHL20 PE=1 SV=4 Back     alignment and function description
>sp|Q08DK3|KLH20_BOVIN Kelch-like protein 20 OS=Bos taurus GN=KLHL20 PE=2 SV=3 Back     alignment and function description
>sp|Q5R7B8|KLH20_PONAB Kelch-like protein 20 OS=Pongo abelii GN=KLHL20 PE=2 SV=3 Back     alignment and function description
>sp|Q91XA8|KLD8A_MOUSE Kelch domain-containing protein 8A OS=Mus musculus GN=Klhdc8a PE=2 SV=1 Back     alignment and function description
>sp|B4J045|KLHDB_DROGR Kelch-like protein diablo OS=Drosophila grimshawi GN=dbo PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query434
296090252431 unnamed protein product [Vitis vinifera] 0.958 0.965 0.761 0.0
225452169423 PREDICTED: kelch repeat-containing prote 0.953 0.978 0.762 0.0
255536987430 conserved hypothetical protein [Ricinus 0.988 0.997 0.763 0.0
449449581418 PREDICTED: kelch repeat-containing prote 0.956 0.992 0.725 0.0
449479719418 PREDICTED: LOW QUALITY PROTEIN: kelch re 0.956 0.992 0.723 0.0
225443351426 PREDICTED: kelch repeat-containing prote 0.956 0.974 0.735 0.0
356560517434 PREDICTED: kelch repeat-containing prote 0.937 0.937 0.713 0.0
363814328436 uncharacterized protein LOC100777575 [Gl 0.979 0.974 0.695 0.0
255561818425 conserved hypothetical protein [Ricinus 0.926 0.945 0.732 1e-180
224113255424 predicted protein [Populus trichocarpa] 0.944 0.966 0.713 1e-178
>gi|296090252|emb|CBI40071.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  685 bits (1767), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/427 (76%), Positives = 366/427 (85%), Gaps = 11/427 (2%)

Query: 9   KHTYTKTGCWFLCVLGLLGAALIADFMWASSSSSFSSSSAHLSVASNWALEKSGVVVIPH 68
           KH  +K        +G LGA L+AD++WAS+S       A+LS+ASNWAL KS  VVIP 
Sbjct: 7   KHYTSKKLVLLASFVGFLGAILVADYLWASASF------AYLSIASNWALTKSSTVVIP- 59

Query: 69  VNATKIDRQ-RESVAVIDKKGQDAERFLSATFADLPAPDLEWEQMPSAPVPRLDGAAIQI 127
              T  D + ++ V V DKK + + R LSATFADLPAP+L+WE+M  APVPRLDGA+IQI
Sbjct: 60  ---TNFDEKLQQRVDVKDKKNRTSGRILSATFADLPAPELKWEEMQPAPVPRLDGASIQI 116

Query: 128 KNLFYVFAGYGSLDYVHSHVDVYNFTDNKWVDRFDMPKDMAHSHLGVVSDGRYIYIVSGQ 187
           KNL YVFAGYG+L+YVHSHVD+YN TDN W  RFDMPK+MAHSHLG+ +DGRYIYIVSGQ
Sbjct: 117 KNLLYVFAGYGTLNYVHSHVDIYNITDNAWGGRFDMPKEMAHSHLGMATDGRYIYIVSGQ 176

Query: 188 YGPQCRGPTSRTFVLDSETRKWDSIPPLPSPRYSPATQLWRGRLHVMGGSKENRHTPGLE 247
           YGPQCRGPT+R FVLD+ET+KW  +P LP+PRY+PATQLWRGRLHVMGG KENRHTPGLE
Sbjct: 177 YGPQCRGPTARCFVLDTETKKWQDLPTLPAPRYAPATQLWRGRLHVMGGGKENRHTPGLE 236

Query: 248 HWSIAVKDGKALEKAWRTEIPIPRGGPHRACFVFNDRLFVVGGQEGDFMAKPGSPIFKCS 307
           HWS+AVK+GKALEK WR+EIPIPRGGPHRAC V +DRLFV+GGQEGDFMAKPGSPIFKCS
Sbjct: 237 HWSLAVKNGKALEKEWRSEIPIPRGGPHRACVVVDDRLFVIGGQEGDFMAKPGSPIFKCS 296

Query: 308 RRHEVVYGDVYMLDDEMKWKVLPPMPKPNSHIECAWVIVNNSIIITGGTTEKHPMTKRMI 367
           RRHEVVY DVYMLDDEMKWKVLPPMPKP+SHIE AWV+VNNSIII GGTTEKHP+TKRMI
Sbjct: 297 RRHEVVYEDVYMLDDEMKWKVLPPMPKPDSHIEFAWVVVNNSIIIVGGTTEKHPVTKRMI 356

Query: 368 LVGEVFQFHLDSLTWSVIGKLPYRIKTTLTGFWDGWLYFTSGQRDRGPENPQPRKVIGEM 427
           LVGEVFQFHLDSL WSVIGK+P+R KTTL  FWDGWLYFTSGQRDRGP+NPQPRKVIG+M
Sbjct: 357 LVGEVFQFHLDSLKWSVIGKMPFRAKTTLAAFWDGWLYFTSGQRDRGPDNPQPRKVIGDM 416

Query: 428 WRTKLHL 434
           WRTKL L
Sbjct: 417 WRTKLFL 423

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225452169|ref|XP_002270625.1| PREDICTED: kelch repeat-containing protein At3g27220 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255536987|ref|XP_002509560.1| conserved hypothetical protein [Ricinus communis] gi|223549459|gb|EEF50947.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|449449581|ref|XP_004142543.1| PREDICTED: kelch repeat-containing protein At3g27220-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449479719|ref|XP_004155687.1| PREDICTED: LOW QUALITY PROTEIN: kelch repeat-containing protein At3g27220-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|225443351|ref|XP_002265018.1| PREDICTED: kelch repeat-containing protein At3g27220 [Vitis vinifera] gi|297735771|emb|CBI18458.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356560517|ref|XP_003548538.1| PREDICTED: kelch repeat-containing protein At3g27220-like [Glycine max] Back     alignment and taxonomy information
>gi|363814328|ref|NP_001242294.1| uncharacterized protein LOC100777575 [Glycine max] gi|255635360|gb|ACU18033.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|255561818|ref|XP_002521918.1| conserved hypothetical protein [Ricinus communis] gi|223538843|gb|EEF40442.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|224113255|ref|XP_002316438.1| predicted protein [Populus trichocarpa] gi|222865478|gb|EEF02609.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query434
TAIR|locus:2033944415 AT1G51540 [Arabidopsis thalian 0.919 0.961 0.685 1.4e-158
TAIR|locus:2086528426 AT3G27220 "AT3G27220" [Arabido 0.960 0.978 0.644 2.7e-155
UNIPROTKB|G4N9D1338 MGG_10013 "Uncharacterized pro 0.679 0.872 0.238 1.3e-11
UNIPROTKB|B4L0G9617 dbo "Kelch-like protein diablo 0.389 0.273 0.275 2.5e-09
UNIPROTKB|B4J045624 dbo "Kelch-like protein diablo 0.389 0.270 0.275 2.6e-09
UNIPROTKB|B4LIG6624 dbo "Kelch-like protein diablo 0.389 0.270 0.275 2.6e-09
UNIPROTKB|B4DUR0420 KLHL20 "Kelch-like protein 20" 0.398 0.411 0.248 4.5e-09
UNIPROTKB|B0WWP2582 dbo "Kelch-like protein diablo 0.389 0.290 0.275 5e-09
UNIPROTKB|Q7QGL0582 dbo "Kelch-like protein diablo 0.389 0.290 0.275 5e-09
UNIPROTKB|Q16RL8589 dbo "Kelch-like protein diablo 0.389 0.286 0.275 5.1e-09
TAIR|locus:2033944 AT1G51540 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1545 (548.9 bits), Expect = 1.4e-158, P = 1.4e-158
 Identities = 284/414 (68%), Positives = 332/414 (80%)

Query:    21 CVLGLLGAALIADFMWXXXXXXXXXXXXXXXXXXNWALEKSGVVVIPHVNATKIDRQRES 80
             C+  LL   LIADF+W                    +L  S   VI  V   + D ++  
Sbjct:    15 CI-ALLATGLIADFLWATSHRFSSAAISAGL-----SLPSSLTTVI--VPGQEKDTKK-- 64

Query:    81 VAVIDKKGQDAERFLSATFADLPAPDLEWEQMPSAPVPRLDGAAIQIKNLFYVFAGYGSL 140
                  KK    ER LS TF DLPAP+L+WE+M ++PVPRLDGAAIQI++L YVFAGYG++
Sbjct:    65 -----KKDSVKERKLSNTFQDLPAPELKWEKMAASPVPRLDGAAIQIRDLLYVFAGYGTI 119

Query:   141 DYVHSHVDVYNFTDNKWVDRFDMPKDMAHSHLGVVSDGRYIYIVSGQYGPQCRGPTSRTF 200
             D VHSHVD+YNFTDN W  RF+MPKDMAHSHLG+V+DGRYIYIV+GQ+GPQCRGPT++TF
Sbjct:   120 DLVHSHVDIYNFTDNSWGGRFNMPKDMAHSHLGMVTDGRYIYIVTGQFGPQCRGPTAKTF 179

Query:   201 VLDSETRKWDSIPPLPSPRYSPATQLWRGRLHVMGGSKENRHTPGLEHWSIAVKDGKALE 260
             VLD++T  W    PLP PRY+PATQLWRGRLHVMGGSKENR TPGLEHWSIAVKDGK+LE
Sbjct:   180 VLDTDTNTWKDFVPLPVPRYAPATQLWRGRLHVMGGSKENRFTPGLEHWSIAVKDGKSLE 239

Query:   261 KAWRTEIPIPRGGPHRACFVFNDRLFVVGGQEGDFMAKPGSPIFKCSRRHEVVYGDVYML 320
               WR+EIPIPRGGPHRAC V +DRLFV+GGQEGDFMAKPGSPIFKCSRR EVV+ DVYML
Sbjct:   240 NEWRSEIPIPRGGPHRACVVVDDRLFVIGGQEGDFMAKPGSPIFKCSRRMEVVFSDVYML 299

Query:   321 DDEMKWKVLPPMPKPNSHIECAWVIVNNSIIITGGTTEKHPMTKRMILVGEVFQFHLDSL 380
             D+EMKWKV+PPMPKP+SHIE AW +VNNSI+I GGTTEKHP TK+M+LVGE+FQF+L++L
Sbjct:   300 DEEMKWKVMPPMPKPDSHIEFAWKVVNNSIVIVGGTTEKHPETKKMVLVGEIFQFNLNTL 359

Query:   381 TWSVIGKLPYRIKTTLTGFWDGWLYFTSGQRDRGPENPQPRKVIGEMWRTKLHL 434
              W VIGKLPYR+KTTL G+WDG LYFTSGQRD+GP++P PRKV+ EMWRTKL L
Sbjct:   360 KWYVIGKLPYRVKTTLAGYWDGQLYFTSGQRDKGPDDPAPRKVMAEMWRTKLIL 413
GO:0005886 "plasma membrane" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0005794 "Golgi apparatus" evidence=IDA
GO:0006869 "lipid transport" evidence=RCA
GO:0005768 "endosome" evidence=IDA
GO:0005802 "trans-Golgi network" evidence=IDA
TAIR|locus:2086528 AT3G27220 "AT3G27220" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|G4N9D1 MGG_10013 "Uncharacterized protein" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
UNIPROTKB|B4L0G9 dbo "Kelch-like protein diablo" [Drosophila mojavensis (taxid:7230)] Back     alignment and assigned GO terms
UNIPROTKB|B4J045 dbo "Kelch-like protein diablo" [Drosophila grimshawi (taxid:7222)] Back     alignment and assigned GO terms
UNIPROTKB|B4LIG6 dbo "Kelch-like protein diablo" [Drosophila virilis (taxid:7244)] Back     alignment and assigned GO terms
UNIPROTKB|B4DUR0 KLHL20 "Kelch-like protein 20" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|B0WWP2 dbo "Kelch-like protein diablo" [Culex quinquefasciatus (taxid:7176)] Back     alignment and assigned GO terms
UNIPROTKB|Q7QGL0 dbo "Kelch-like protein diablo" [Anopheles gambiae (taxid:7165)] Back     alignment and assigned GO terms
UNIPROTKB|Q16RL8 dbo "Kelch-like protein diablo" [Aedes aegypti (taxid:7159)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer5.1.3.n1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query434
PHA03098534 PHA03098, PHA03098, kelch-like protein; Provisiona 4e-10
pfam1341849 pfam13418, Kelch_4, Galactose oxidase, central dom 3e-08
PHA03098534 PHA03098, PHA03098, kelch-like protein; Provisiona 1e-07
PHA03098534 PHA03098, PHA03098, kelch-like protein; Provisiona 4e-06
pfam1396450 pfam13964, Kelch_6, Kelch motif 4e-06
pfam1341548 pfam13415, Kelch_3, Galactose oxidase, central dom 3e-05
PHA03098534 PHA03098, PHA03098, kelch-like protein; Provisiona 5e-05
TIGR03548323 TIGR03548, mutarot_permut, cyclically-permuted mut 3e-04
pfam0134446 pfam01344, Kelch_1, Kelch motif 9e-04
TIGR03548 323 TIGR03548, mutarot_permut, cyclically-permuted mut 0.003
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information 
 Score = 61.3 bits (149), Expect = 4e-10
 Identities = 58/275 (21%), Positives = 97/275 (35%), Gaps = 41/275 (14%)

Query: 123 AAIQIKNLFYVFAGYGSLDYVHSHVDVYNFTDNKWVDRFDMPKDMAHSHLGVVSDGRYIY 182
            ++ + N+ Y   G    +   + V  Y+     W    ++       + GV      IY
Sbjct: 289 GSVVLNNVIYFIGGMNKNNLSVNSVVSYDTKTKSWNKVPEL--IYPRKNPGVTVFNNRIY 346

Query: 183 IVSGQYGPQCRGPTSRTFVLDSETRKWDSIPPLPSPRYSPATQLWRGRLHVMGGSKEN-R 241
           ++ G Y        +          KW   PPL  PRY+P        ++V+GG  +N  
Sbjct: 347 VIGGIYN---SISLNTVESWKPGESKWREEPPLIFPRYNPCVVNVNNLIYVIGGISKNDE 403

Query: 242 HTPGLEHWSIAVKDGKALEKAWRTEIPIPRGGPHRACFVFNDRLFVVGGQEGDFMAKPGS 301
               +E +S+           W    P+P           + +++V+GG          S
Sbjct: 404 LLKTVECFSL-------NTNKWSKGSPLPISHYGGCAIYHDGKIYVIGGI---------S 447

Query: 302 PIFKCSRRHEVVYGDVYMLD-DEMKWKVLPPM--PKPNSHIECAWVIVNNSIIITGGTTE 358
            I      +  VY  V   +    KW  L  +  P+ N+ + C   I NN I + GG   
Sbjct: 448 YI-----DNIKVYNIVESYNPVTNKWTELSSLNFPRINASL-C---IFNNKIYVVGGD-- 496

Query: 359 KHPMTKRMILVGEVFQFHLDSLTWSVIGKLPYRIK 393
                +  I   EV+    +  TW++  K P  I 
Sbjct: 497 ---KYEYYINEIEVYDDKTN--TWTLFCKFPKVIG 526

Length = 534
>gnl|CDD|205596 pfam13418, Kelch_4, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information
>gnl|CDD|206134 pfam13964, Kelch_6, Kelch motif Back     alignment and domain information
>gnl|CDD|222113 pfam13415, Kelch_3, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information
>gnl|CDD|211835 TIGR03548, mutarot_permut, cyclically-permuted mutarotase family protein Back     alignment and domain information
>gnl|CDD|201739 pfam01344, Kelch_1, Kelch motif Back     alignment and domain information
>gnl|CDD|211835 TIGR03548, mutarot_permut, cyclically-permuted mutarotase family protein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 434
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 100.0
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 100.0
PLN02153341 epithiospecifier protein 100.0
PHA02713557 hypothetical protein; Provisional 100.0
PLN02193470 nitrile-specifier protein 100.0
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 100.0
TIGR03547346 muta_rot_YjhT mutatrotase, YjhT family. Members of 100.0
PHA02713557 hypothetical protein; Provisional 100.0
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 100.0
PLN02153341 epithiospecifier protein 100.0
PLN02193470 nitrile-specifier protein 100.0
PHA03098534 kelch-like protein; Provisional 100.0
KOG4693392 consensus Uncharacterized conserved protein, conta 100.0
TIGR03547346 muta_rot_YjhT mutatrotase, YjhT family. Members of 100.0
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 100.0
KOG4693392 consensus Uncharacterized conserved protein, conta 100.0
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 100.0
PHA02790480 Kelch-like protein; Provisional 100.0
PHA03098534 kelch-like protein; Provisional 100.0
PHA02790480 Kelch-like protein; Provisional 100.0
KOG0379 482 consensus Kelch repeat-containing proteins [Genera 99.97
KOG1230 521 consensus Protein containing repeated kelch motifs 99.97
KOG4152 830 consensus Host cell transcription factor HCFC1 [Ce 99.96
KOG0379 482 consensus Kelch repeat-containing proteins [Genera 99.96
KOG4152 830 consensus Host cell transcription factor HCFC1 [Ce 99.95
KOG1230521 consensus Protein containing repeated kelch motifs 99.95
COG3055381 Uncharacterized protein conserved in bacteria [Fun 99.93
COG3055381 Uncharacterized protein conserved in bacteria [Fun 99.84
KOG2437 723 consensus Muskelin [Signal transduction mechanisms 99.68
PF1396450 Kelch_6: Kelch motif 99.36
KOG2437 723 consensus Muskelin [Signal transduction mechanisms 99.31
PF1396450 Kelch_6: Kelch motif 99.31
PF0134447 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is 99.15
PF0134447 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is 99.09
PF1341549 Kelch_3: Galactose oxidase, central domain 99.06
PF0764649 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is 99.04
PF1341849 Kelch_4: Galactose oxidase, central domain; PDB: 2 99.02
PF0764649 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is 99.0
PF1341549 Kelch_3: Galactose oxidase, central domain 98.99
PF1341849 Kelch_4: Galactose oxidase, central domain; PDB: 2 98.92
smart0061247 Kelch Kelch domain. 98.83
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 98.76
smart0061247 Kelch Kelch domain. 98.71
PLN02772398 guanylate kinase 98.7
PF1385442 Kelch_5: Kelch motif 98.66
PF1385442 Kelch_5: Kelch motif 98.5
PLN02772 398 guanylate kinase 98.45
PF03089337 RAG2: Recombination activating protein 2; InterPro 98.33
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 98.3
TIGR01640230 F_box_assoc_1 F-box protein interaction domain. Th 98.29
TIGR01640230 F_box_assoc_1 F-box protein interaction domain. Th 98.27
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 98.21
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 97.98
PF03089 337 RAG2: Recombination activating protein 2; InterPro 97.74
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 97.65
PF07893342 DUF1668: Protein of unknown function (DUF1668); In 97.6
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 97.2
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 97.14
PRK13684334 Ycf48-like protein; Provisional 96.3
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 96.29
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 96.15
PF12768281 Rax2: Cortical protein marker for cell polarity 96.12
PF07893342 DUF1668: Protein of unknown function (DUF1668); In 95.98
PRK13684334 Ycf48-like protein; Provisional 95.91
KOG2055514 consensus WD40 repeat protein [General function pr 95.6
PF12768281 Rax2: Cortical protein marker for cell polarity 95.44
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 95.33
smart00284255 OLF Olfactomedin-like domains. 95.17
KOG0310 487 consensus Conserved WD40 repeat-containing protein 95.15
PF02191250 OLF: Olfactomedin-like domain; InterPro: IPR003112 94.5
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 93.72
PF12217367 End_beta_propel: Catalytic beta propeller domain o 93.58
KOG2055514 consensus WD40 repeat protein [General function pr 93.22
cd00094194 HX Hemopexin-like repeats.; Hemopexin is a heme-bi 93.17
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 92.87
PLN00033398 photosystem II stability/assembly factor; Provisio 92.76
cd00094194 HX Hemopexin-like repeats.; Hemopexin is a heme-bi 92.46
PRK04792448 tolB translocation protein TolB; Provisional 92.1
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 92.03
PRK04922433 tolB translocation protein TolB; Provisional 91.66
PRK11028330 6-phosphogluconolactonase; Provisional 91.44
PRK05137435 tolB translocation protein TolB; Provisional 90.73
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 90.54
PF09910339 DUF2139: Uncharacterized protein conserved in arch 90.36
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 89.97
PF02191250 OLF: Olfactomedin-like domain; InterPro: IPR003112 89.81
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 89.54
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 89.43
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 89.28
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 89.08
TIGR03075 527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 88.55
PLN00181793 protein SPA1-RELATED; Provisional 88.45
PRK00178430 tolB translocation protein TolB; Provisional 88.35
PRK05137435 tolB translocation protein TolB; Provisional 88.23
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 88.12
PRK00178430 tolB translocation protein TolB; Provisional 87.98
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 87.78
PRK04922433 tolB translocation protein TolB; Provisional 87.69
PF08268129 FBA_3: F-box associated domain; InterPro: IPR01318 87.68
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 87.44
PF03178 321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 86.98
KOG0296 399 consensus Angio-associated migratory cell protein 86.12
KOG0310 487 consensus Conserved WD40 repeat-containing protein 85.52
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 85.35
PF13088275 BNR_2: BNR repeat-like domain; PDB: 2F11_A 2F0Z_A 85.2
TIGR03075 527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 84.96
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 84.46
COG1520370 FOG: WD40-like repeat [Function unknown] 84.03
PRK04792448 tolB translocation protein TolB; Provisional 83.66
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 83.55
PLN00181793 protein SPA1-RELATED; Provisional 82.93
PF13859310 BNR_3: BNR repeat-like domain; PDB: 3B69_A. 82.8
PF08268129 FBA_3: F-box associated domain; InterPro: IPR01318 82.74
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 81.93
COG1520370 FOG: WD40-like repeat [Function unknown] 81.7
PRK02889427 tolB translocation protein TolB; Provisional 81.39
PRK03629429 tolB translocation protein TolB; Provisional 80.51
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information 
Probab=100.00  E-value=2.1e-46  Score=377.45  Aligned_cols=281  Identities=21%  Similarity=0.358  Sum_probs=246.9

Q ss_pred             eeEEEccCCcchhhhhccceeeccCCCCcEEEcCCCCCCCCceeEEEECCEEEEEeccCCCCCceeeEEEEECCCCceEe
Q 013909           80 SVAVIDKKGQDAERFLSATFADLPAPDLEWEQMPSAPVPRLDGAAIQIKNLFYVFAGYGSLDYVHSHVDVYNFTDNKWVD  159 (434)
Q Consensus        80 g~~v~~~~~~~~~~~~~~~~~~~~~~~~~W~~~~~~p~~R~~~~~~~~~~~iyv~GG~~~~~~~~~~v~~yd~~t~~W~~  159 (434)
                      +..+..++........+ .++.||+.+++|..+++||.+|..+++++++++||++||.+.....++++|+||+.+++|+.
T Consensus       285 ~~l~~vGG~~~~~~~~~-~ve~yd~~~~~w~~~a~m~~~r~~~~~~~~~~~lYv~GG~~~~~~~l~~ve~YD~~~~~W~~  363 (571)
T KOG4441|consen  285 GKLVAVGGYNRQGQSLR-SVECYDPKTNEWSSLAPMPSPRCRVGVAVLNGKLYVVGGYDSGSDRLSSVERYDPRTNQWTP  363 (571)
T ss_pred             CeEEEECCCCCCCcccc-eeEEecCCcCcEeecCCCCcccccccEEEECCEEEEEccccCCCcccceEEEecCCCCceec
Confidence            33343333332233344 89999999999999999999999999999999999999999533457889999999999999


Q ss_pred             cCCCCCCCCceeeEEEEeCCEEEEEeccCCCCCCCCCceeEEEECCCCceEecCCCCCCcccceEEEECCEEEEEcCCCC
Q 013909          160 RFDMPKDMAHSHLGVVSDGRYIYIVSGQYGPQCRGPTSRTFVLDSETRKWDSIPPLPSPRYSPATQLWRGRLHVMGGSKE  239 (434)
Q Consensus       160 ~~~~~~~~~r~~~~~~~~~~~lyv~GG~~~~~~~~~~~~~~~yd~~t~~W~~~~~~p~~r~~~~~~~~~~~iyv~GG~~~  239 (434)
                      +++|+.  +|..+++++++|.||++||.++...   ++++++|||.+++|+.+++|+.+|.+|++++++++||++||.++
T Consensus       364 ~a~M~~--~R~~~~v~~l~g~iYavGG~dg~~~---l~svE~YDp~~~~W~~va~m~~~r~~~gv~~~~g~iYi~GG~~~  438 (571)
T KOG4441|consen  364 VAPMNT--KRSDFGVAVLDGKLYAVGGFDGEKS---LNSVECYDPVTNKWTPVAPMLTRRSGHGVAVLGGKLYIIGGGDG  438 (571)
T ss_pred             cCCccC--ccccceeEEECCEEEEEeccccccc---cccEEEecCCCCcccccCCCCcceeeeEEEEECCEEEEEcCcCC
Confidence            999998  8999999999999999999997544   78999999999999999999999999999999999999999988


Q ss_pred             CC-CCCCcceEEEEeeccccccCceEEccCCCCCCCceeEEEECCEEEEEcCCCCCCCCCCCCCccccccccceeeCcEE
Q 013909          240 NR-HTPGLEHWSIAVKDGKALEKAWRTEIPIPRGGPHRACFVFNDRLFVVGGQEGDFMAKPGSPIFKCSRRHEVVYGDVY  318 (434)
Q Consensus       240 ~~-~~~~~~~~~~~~~~~~~~~~~W~~~~~~p~~~~~~~~~~~~~~iyv~GG~~~~~~~~~~~~~~~~~~~~~~~~~~v~  318 (434)
                      .. .++++++||       |.+++|+.++||+.+|.++++++++++||++||+++..                 .+..|+
T Consensus       439 ~~~~l~sve~YD-------P~t~~W~~~~~M~~~R~~~g~a~~~~~iYvvGG~~~~~-----------------~~~~VE  494 (571)
T KOG4441|consen  439 SSNCLNSVECYD-------PETNTWTLIAPMNTRRSGFGVAVLNGKIYVVGGFDGTS-----------------ALSSVE  494 (571)
T ss_pred             CccccceEEEEc-------CCCCceeecCCcccccccceEEEECCEEEEECCccCCC-----------------ccceEE
Confidence            77 889999998       89999999999999999999999999999999998732                 355699


Q ss_pred             EeC-CCCCeEEcCCCCCCCCccceeEEEECCEEEEEcCcCCCCCCccceeeeccEEEEECCCCceEEeccCCCceeeeee
Q 013909          319 MLD-DEMKWKVLPPMPKPNSHIECAWVIVNNSIIITGGTTEKHPMTKRMILVGEVFQFHLDSLTWSVIGKLPYRIKTTLT  397 (434)
Q Consensus       319 ~yd-~~~~W~~~~~~p~~r~~~~~~~~~~~~~i~v~GG~~~~~~~~~~~~~~~~v~~yd~~~~~W~~~~~lp~~r~~~~~  397 (434)
                      +|| .+++|+.+++|+.+|..+++  ++.++++|++||+++..       ++++++.|||++++|+..+++...|....+
T Consensus       495 ~ydp~~~~W~~v~~m~~~rs~~g~--~~~~~~ly~vGG~~~~~-------~l~~ve~ydp~~d~W~~~~~~~~~~~~~~~  565 (571)
T KOG4441|consen  495 RYDPETNQWTMVAPMTSPRSAVGV--VVLGGKLYAVGGFDGNN-------NLNTVECYDPETDTWTEVTEPESGRGGAGV  565 (571)
T ss_pred             EEcCCCCceeEcccCccccccccE--EEECCEEEEEecccCcc-------ccceeEEcCCCCCceeeCCCccccccCcce
Confidence            999 89999999999999998765  99999999999988877       789999999999999999885555555555


Q ss_pred             EE
Q 013909          398 GF  399 (434)
Q Consensus       398 ~~  399 (434)
                      ++
T Consensus       566 ~~  567 (571)
T KOG4441|consen  566 AV  567 (571)
T ss_pred             EE
Confidence            44

>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>KOG4693 consensus Uncharacterized conserved protein, contains kelch repeat [General function prediction only] Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>KOG4693 consensus Uncharacterized conserved protein, contains kelch repeat [General function prediction only] Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>KOG0379 consensus Kelch repeat-containing proteins [General function prediction only] Back     alignment and domain information
>KOG1230 consensus Protein containing repeated kelch motifs [General function prediction only] Back     alignment and domain information
>KOG4152 consensus Host cell transcription factor HCFC1 [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG0379 consensus Kelch repeat-containing proteins [General function prediction only] Back     alignment and domain information
>KOG4152 consensus Host cell transcription factor HCFC1 [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG1230 consensus Protein containing repeated kelch motifs [General function prediction only] Back     alignment and domain information
>COG3055 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG3055 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2437 consensus Muskelin [Signal transduction mechanisms] Back     alignment and domain information
>PF13964 Kelch_6: Kelch motif Back     alignment and domain information
>KOG2437 consensus Muskelin [Signal transduction mechanisms] Back     alignment and domain information
>PF13964 Kelch_6: Kelch motif Back     alignment and domain information
>PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF13415 Kelch_3: Galactose oxidase, central domain Back     alignment and domain information
>PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B Back     alignment and domain information
>PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF13415 Kelch_3: Galactose oxidase, central domain Back     alignment and domain information
>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B Back     alignment and domain information
>smart00612 Kelch Kelch domain Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>smart00612 Kelch Kelch domain Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>PF13854 Kelch_5: Kelch motif Back     alignment and domain information
>PF13854 Kelch_5: Kelch motif Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>PF03089 RAG2: Recombination activating protein 2; InterPro: IPR004321 The variable portion of the genes encoding immunoglobulins and T cell receptors are assembled from component V, D, and J DNA segments by a site-specific recombination reaction termed V(D)J recombination Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>TIGR01640 F_box_assoc_1 F-box protein interaction domain Back     alignment and domain information
>TIGR01640 F_box_assoc_1 F-box protein interaction domain Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PF03089 RAG2: Recombination activating protein 2; InterPro: IPR004321 The variable portion of the genes encoding immunoglobulins and T cell receptors are assembled from component V, D, and J DNA segments by a site-specific recombination reaction termed V(D)J recombination Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>smart00284 OLF Olfactomedin-like domains Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PF02191 OLF: Olfactomedin-like domain; InterPro: IPR003112 The olfactomedin-domain was first identified in olfactomedin, an extracellular matrix protein of the olfactory neuroepithelium [] Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>PF12217 End_beta_propel: Catalytic beta propeller domain of bacteriophage endosialidase; InterPro: IPR024428 This entry represents the beta propeller domain of endosialidases, which consists of catalytically active part of the enzymes Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>cd00094 HX Hemopexin-like repeats Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>PLN00033 photosystem II stability/assembly factor; Provisional Back     alignment and domain information
>cd00094 HX Hemopexin-like repeats Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PF09910 DUF2139: Uncharacterized protein conserved in archaea (DUF2139); InterPro: IPR016675 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PF02191 OLF: Olfactomedin-like domain; InterPro: IPR003112 The olfactomedin-domain was first identified in olfactomedin, an extracellular matrix protein of the olfactory neuroepithelium [] Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF08268 FBA_3: F-box associated domain; InterPro: IPR013187 This domain occurs in a diverse superfamily of genes in plants Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>PF13088 BNR_2: BNR repeat-like domain; PDB: 2F11_A 2F0Z_A 1VCU_B 2F25_B 1SO7_A 2F29_A 1SNT_A 2F13_A 2F28_A 2F27_A Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>COG1520 FOG: WD40-like repeat [Function unknown] Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>PF13859 BNR_3: BNR repeat-like domain; PDB: 3B69_A Back     alignment and domain information
>PF08268 FBA_3: F-box associated domain; InterPro: IPR013187 This domain occurs in a diverse superfamily of genes in plants Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>COG1520 FOG: WD40-like repeat [Function unknown] Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query434
2woz_A318 The Novel Beta-Propeller Of The Btb-Kelch Protein K 1e-06
3ii7_A306 Crystal Structure Of The Kelch Domain Of Human Klhl 4e-06
2vpj_A301 Crystal Structure Of The Kelch Domain Of Human Klhl 1e-04
3vng_A309 Crystal Structure Of Keap1 In Complex With Syntheti 2e-04
2xn4_A302 Crystal Structure Of The Kelch Domain Of Human Klhl 2e-04
>pdb|2WOZ|A Chain A, The Novel Beta-Propeller Of The Btb-Kelch Protein Krp1 Provides The Binding Site For Lasp-1 That Is Necessary For Pseudopodia Extension Length = 318 Back     alignment and structure 
Iteration: 1

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 61/251 (24%), Positives = 100/251 (39%), Gaps = 34/251 (13%)
Query: 163 MPKDMAHSHLGVVSDGRYIYIVSGQYGPQCRGP---TSRTFVLDSETRKWDSIPPLPSPR 219
           + + +  +H  +V+    +Y+V G Y  +        S  F LD+ + +W  +PPLPS R
Sbjct: 41  LAEQIPRNHSSIVTQQNQVYVVGGLYVDEENKDQPLQSYFFQLDNVSSEWVGLPPLPSAR 100
Query: 220 YSPATQLWRGRLHVMGGSKENRHTPGLEHWSIAVKDGKALEKAWRTEIPIPRGGPHRACF 279
                     +++V+ G K+ +    L+  S+   D  A + +    +PI   G +    
Sbjct: 101 CLFGLGEVDDKIYVVAG-KDLQTEASLD--SVLCYDPVAAKWSEVKNLPIKVYGHN--VI 155
Query: 280 VFNDRLFVVGGQEGDFMAKPGSPIFKCSRRHEVVYGDVYMLD-DEMKWKVLPPMPKPNSH 338
             N  ++ +GG+  D          KC+ R       V++ +  +  WK L PM  P S 
Sbjct: 156 SHNGMIYCLGGKTDD---------KKCTNR-------VFIYNPKKGDWKDLAPMKTPRSM 199
Query: 339 IECAWVIVNNSIIITGGTTEKHPMTKRMILVGEVFQFHLDSLTWSVIGKLPYRIKTTLTG 398
              A  I    I+I GG TE         L   V  F L +  W V+ + P    +    
Sbjct: 200 FGVA--IHKGKIVIAGGVTEDG-------LSASVEAFDLKTNKWEVMTEFPQERSSISLV 250
Query: 399 FWDGWLYFTSG 409
              G LY   G
Sbjct: 251 SLAGSLYAIGG 261
>pdb|3II7|A Chain A, Crystal Structure Of The Kelch Domain Of Human Klhl7 Length = 306 Back     alignment and structure
>pdb|2VPJ|A Chain A, Crystal Structure Of The Kelch Domain Of Human Klhl12 Length = 301 Back     alignment and structure
>pdb|3VNG|A Chain A, Crystal Structure Of Keap1 In Complex With Synthetic Small Molecular Based On A Co-crystallization Length = 309 Back     alignment and structure
>pdb|2XN4|A Chain A, Crystal Structure Of The Kelch Domain Of Human Klhl2 (mayven) Length = 302 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query434
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 2e-37
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 4e-18
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 3e-11
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 3e-27
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 5e-21
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 4e-18
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 3e-12
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 7e-27
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 8e-22
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 1e-21
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 2e-26
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 4e-18
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 4e-26
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 6e-21
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 1e-25
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 1e-23
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 3e-19
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 9e-13
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 1e-09
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 2e-25
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 3e-23
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 1e-17
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 2e-15
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 4e-04
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 5e-14
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 6e-12
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 2e-08
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
 Score =  138 bits (349), Expect = 2e-37
 Identities = 63/345 (18%), Positives = 103/345 (29%), Gaps = 58/345 (16%)

Query: 111 QMPSAPVPRLDGAAIQIKNLFYVFAGYGSLDYVHSHVDVYNFTDNKWVDRFDMPKDMAHS 170
            +P  PVP   G      +  Y+  G         +       D KW      P      
Sbjct: 2   VLPETPVPFKSGTGAIDNDTVYIGLGSAG---TAWYKLDTQAKDKKWTALAAFPGGPRDQ 58

Query: 171 HLGVVSDGRYIYIVSGQYGPQCRGPTSRT--FVLDSETRKWDSI-PPLPSPRYSPATQLW 227
                 DG  +Y+  G                  + +T  W  +    P       T + 
Sbjct: 59  ATSAFIDGN-LYVFGGIGKNSEGLTQVFNDVHKYNPKTNSWVKLMSHAPMGMAGHVTFVH 117

Query: 228 RGRLHVMGGSKENRHTPGLEHWSIAVKDGKALEKA------------------------- 262
            G+ +V GG  +N      E  + A KD  A++K                          
Sbjct: 118 NGKAYVTGGVNQNIFNGYFEDLNEAGKDSTAIDKINAHYFDKKAEDYFFNKFLLSFDPST 177

Query: 263 --WRTEIPIPRGGPHRAC-FVFNDRLFVVGGQEGDFMAKPGSPIFKCSRRHEVVYGDVYM 319
             W      P  G   A      D+ +++ G+     AKPG        R + V+ ++  
Sbjct: 178 QQWSYAGESPWYGTAGAAVVNKGDKTWLINGE-----AKPGL-------RTDAVF-ELDF 224

Query: 320 LDDEMKWKVLPPMPKPNSHIECAWVIVNNSIIITG-----GTTEKHPMTKRMILVGEVFQ 374
             + +KW  L P+  P+        I N+S+I  G     G+ E +   K     G    
Sbjct: 225 TGNNLKWNKLAPVSSPDGVAGGFAGISNDSLIFAGGAGFKGSRENYQNGKNYAHEGLKKS 284

Query: 375 FH-----LDSLTWSVIGKLPYRIKTTLTGFWDGWLYFTSGQRDRG 414
           +        +  W   G+L       ++  W+  L    G+   G
Sbjct: 285 YSTDIHLWHNGKWDKSGELSQGRAYGVSLPWNNSLLIIGGETAGG 329
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Length = 656 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query434
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 100.0
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 100.0
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 100.0
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 100.0
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 100.0
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 100.0
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 100.0
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 100.0
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 100.0
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 100.0
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 100.0
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 100.0
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 100.0
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 100.0
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 100.0
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 100.0
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 100.0
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 100.0
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 98.19
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 98.1
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 97.85
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 97.8
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 97.69
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 97.59
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 97.48
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 97.38
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 97.36
3jrp_A379 Fusion protein of protein transport protein SEC13 97.28
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 97.25
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 97.21
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 97.19
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 97.1
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 97.09
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 97.05
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 97.04
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 97.02
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 96.97
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 96.94
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 96.93
3jrp_A379 Fusion protein of protein transport protein SEC13 96.9
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 96.85
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 96.82
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 96.72
3v9f_A 781 Two-component system sensor histidine kinase/RESP 96.62
3jro_A 753 Fusion protein of protein transport protein SEC13 96.61
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 96.61
1qhu_A460 Protein (hemopexin); beta propeller, HAEM binding 96.6
4a2l_A 795 BT_4663, two-component system sensor histidine kin 96.58
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 96.58
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 96.57
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 96.56
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 96.55
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 96.54
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 96.52
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 96.49
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 96.49
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 96.46
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 96.44
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 96.43
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 96.33
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 96.28
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 96.28
3ow8_A321 WD repeat-containing protein 61; structural genomi 96.22
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 96.22
3ow8_A321 WD repeat-containing protein 61; structural genomi 96.21
3jro_A 753 Fusion protein of protein transport protein SEC13 96.18
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 96.14
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 96.11
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 96.11
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 96.07
4a2l_A 795 BT_4663, two-component system sensor histidine kin 96.05
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 95.97
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 95.89
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 95.88
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 95.82
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 95.78
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 95.78
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 95.77
3b7f_A394 Glycosyl hydrolase, BNR repeat; 7-bladed beta-prop 95.76
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 95.71
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 95.71
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 95.67
3fm0_A 345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 95.64
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 95.54
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 95.52
3v9f_A 781 Two-component system sensor histidine kinase/RESP 95.5
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 95.49
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 95.33
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 95.32
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 95.2
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 95.16
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 95.06
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 95.03
2pm7_B297 Protein transport protein SEC13, protein transport 94.99
2ad6_A 571 Methanol dehydrogenase subunit 1; PQQ configuratio 94.97
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 94.94
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 94.94
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 94.91
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 94.85
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 94.79
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 94.76
4g56_B357 MGC81050 protein; protein arginine methyltransfera 94.75
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 94.74
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 94.71
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 94.68
4g56_B357 MGC81050 protein; protein arginine methyltransfera 94.54
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 94.54
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 94.53
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 94.49
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 94.47
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 94.41
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 94.41
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 94.26
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 94.19
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 94.14
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 94.11
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 94.11
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 94.08
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 94.06
2pm7_B297 Protein transport protein SEC13, protein transport 94.0
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 93.96
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 93.94
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 93.91
4e54_B435 DNA damage-binding protein 2; beta barrel, double 93.89
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 93.84
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 93.76
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 93.7
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 93.66
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 93.63
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 93.61
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 93.58
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 93.51
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 93.47
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 93.37
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 93.3
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 93.23
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 93.2
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 93.17
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 93.04
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 92.97
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 92.84
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 92.8
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 92.77
3b7f_A394 Glycosyl hydrolase, BNR repeat; 7-bladed beta-prop 92.76
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 92.69
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 92.6
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 92.58
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 92.49
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 92.46
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 92.44
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 92.38
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 92.37
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 92.21
1w6s_A 599 Methanol dehydrogenase subunit 1; anisotropic, ele 92.01
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 91.92
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 91.88
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 91.82
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 91.81
1pex_A207 Collagenase-3, MMP-13; C-terminal hemopexin-like d 91.74
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 91.64
1qhu_A460 Protein (hemopexin); beta propeller, HAEM binding 91.59
2ad6_A 571 Methanol dehydrogenase subunit 1; PQQ configuratio 91.52
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 91.46
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 91.17
4e54_B435 DNA damage-binding protein 2; beta barrel, double 91.03
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 90.97
2p4o_A306 Hypothetical protein; putative lactonase, structur 90.92
1itv_A195 MMP9; adaptive molecular recognition, beta propell 90.71
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 90.61
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 90.12
1nir_A 543 Nitrite reductase; hemoprotein, denitrification, d 90.11
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 89.92
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 89.72
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 89.62
2ymu_A577 WD-40 repeat protein; unknown function, two domain 89.45
1flg_A 582 Protein (quinoprotein ethanol dehydrogenase); supe 89.42
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 89.37
3ju4_A 670 Endo-N-acetylneuraminidase; endonf, polysia, high- 89.27
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 89.2
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 89.18
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 89.09
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 89.03
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 88.84
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 88.56
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 88.39
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 88.3
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 88.25
2p4o_A306 Hypothetical protein; putative lactonase, structur 88.21
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 88.19
3i2n_A 357 WD repeat-containing protein 92; WD40 repeats, str 88.11
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 87.88
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 87.66
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 87.65
3v65_B386 Low-density lipoprotein receptor-related protein; 87.56
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 87.46
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 87.45
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 86.56
1k32_A 1045 Tricorn protease; protein degradation, substrate g 86.46
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 86.44
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 86.32
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 85.99
1su3_A450 Interstitial collagenase; prodomain, hemopexin dom 85.89
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 85.85
3oyo_A225 Hemopexin fold protein CP4; seeds, plant protein; 85.8
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 85.65
1sqj_A 789 OXG-RCBH, oligoxyloglucan reducing-END-specific ce 85.58
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 85.14
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 85.07
1qks_A 567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 84.69
3p5b_L400 Low density lipoprotein receptor variant; B-propel 84.42
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 84.28
2cn3_A 737 Xyloglucanase, beta-1,4-xyloglucan hydrolase; glyc 83.73
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 83.7
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 83.53
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 83.48
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 83.22
1hxn_A219 Hemopexin, HPX; heme, binding protein; 1.80A {Oryc 83.16
2xyi_A430 Probable histone-binding protein CAF1; transcripti 82.86
2fp8_A322 Strictosidine synthase; six bladed beta propeller 82.76
1itv_A195 MMP9; adaptive molecular recognition, beta propell 82.29
1sqj_A 789 OXG-RCBH, oligoxyloglucan reducing-END-specific ce 82.26
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 82.25
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 82.02
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 81.58
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 81.1
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 80.76
1pex_A207 Collagenase-3, MMP-13; C-terminal hemopexin-like d 80.36
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 80.33
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 80.31
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
Probab=100.00  E-value=1.3e-49  Score=377.20  Aligned_cols=265  Identities=19%  Similarity=0.310  Sum_probs=230.9

Q ss_pred             ceeeccCCCCcEEEcCCCCCCCCceeEEEECCEEEEEeccC---CCCCceeeEEEEECCCCceEecCCCCCCCCceeeEE
Q 013909           98 TFADLPAPDLEWEQMPSAPVPRLDGAAIQIKNLFYVFAGYG---SLDYVHSHVDVYNFTDNKWVDRFDMPKDMAHSHLGV  174 (434)
Q Consensus        98 ~~~~~~~~~~~W~~~~~~p~~R~~~~~~~~~~~iyv~GG~~---~~~~~~~~v~~yd~~t~~W~~~~~~~~~~~r~~~~~  174 (434)
                      +++.||+.+++|+.++++|.+|.+|++++++++|||+||..   ......+++++||+.+++|++++++|.  +|..|++
T Consensus        40 ~~~~~d~~~~~W~~~~~~p~~r~~~~~~~~~~~lyv~GG~~~~~~~~~~~~~~~~~d~~~~~W~~~~~~p~--~r~~~~~  117 (308)
T 1zgk_A           40 YLEAYNPSNGTWLRLADLQVPRSGLAGCVVGGLLYAVGGRNNSPDGNTDSSALDCYNPMTNQWSPCAPMSV--PRNRIGV  117 (308)
T ss_dssp             CEEEEETTTTEEEECCCCSSCCBSCEEEEETTEEEEECCEEEETTEEEECCCEEEEETTTTEEEECCCCSS--CCBTCEE
T ss_pred             eEEEEcCCCCeEeECCCCCcccccceEEEECCEEEEECCCcCCCCCCeecceEEEECCCCCeEeECCCCCc--CccccEE
Confidence            44555555666777777888999999999999999999983   233356789999999999999999887  7999999


Q ss_pred             EEeCCEEEEEeccCCCCCCCCCceeEEEECCCCceEecCCCCCCcccceEEEECCEEEEEcCCCCCCCCCCcceEEEEee
Q 013909          175 VSDGRYIYIVSGQYGPQCRGPTSRTFVLDSETRKWDSIPPLPSPRYSPATQLWRGRLHVMGGSKENRHTPGLEHWSIAVK  254 (434)
Q Consensus       175 ~~~~~~lyv~GG~~~~~~~~~~~~~~~yd~~t~~W~~~~~~p~~r~~~~~~~~~~~iyv~GG~~~~~~~~~~~~~~~~~~  254 (434)
                      ++++++||++||.+...   .++++++||+.+++|+.++++|.+|..|+++.++++|||+||..+....+.+++|+    
T Consensus       118 ~~~~~~iyv~GG~~~~~---~~~~~~~yd~~~~~W~~~~~~p~~r~~~~~~~~~~~iyv~GG~~~~~~~~~~~~yd----  190 (308)
T 1zgk_A          118 GVIDGHIYAVGGSHGCI---HHNSVERYEPERDEWHLVAPMLTRRIGVGVAVLNRLLYAVGGFDGTNRLNSAECYY----  190 (308)
T ss_dssp             EEETTEEEEECCEETTE---ECCCEEEEETTTTEEEECCCCSSCCBSCEEEEETTEEEEECCBCSSCBCCCEEEEE----
T ss_pred             EEECCEEEEEcCCCCCc---ccccEEEECCCCCeEeECCCCCccccceEEEEECCEEEEEeCCCCCCcCceEEEEe----
Confidence            99999999999987643   36899999999999999999999999999999999999999998766667777776    


Q ss_pred             ccccccCceEEccCCCCCCCceeEEEECCEEEEEcCCCCCCCCCCCCCccccccccceeeCcEEEeC-CCCCeEEcCCCC
Q 013909          255 DGKALEKAWRTEIPIPRGGPHRACFVFNDRLFVVGGQEGDFMAKPGSPIFKCSRRHEVVYGDVYMLD-DEMKWKVLPPMP  333 (434)
Q Consensus       255 ~~~~~~~~W~~~~~~p~~~~~~~~~~~~~~iyv~GG~~~~~~~~~~~~~~~~~~~~~~~~~~v~~yd-~~~~W~~~~~~p  333 (434)
                         +.+++|+.++++|.++..++++.++++|||+||.+...                 .++++++|| .+++|+.++++|
T Consensus       191 ---~~~~~W~~~~~~p~~r~~~~~~~~~~~iyv~GG~~~~~-----------------~~~~v~~yd~~~~~W~~~~~~p  250 (308)
T 1zgk_A          191 ---PERNEWRMITAMNTIRSGAGVCVLHNCIYAAGGYDGQD-----------------QLNSVERYDVETETWTFVAPMK  250 (308)
T ss_dssp             ---TTTTEEEECCCCSSCCBSCEEEEETTEEEEECCBCSSS-----------------BCCCEEEEETTTTEEEECCCCS
T ss_pred             ---CCCCeEeeCCCCCCccccceEEEECCEEEEEeCCCCCC-----------------ccceEEEEeCCCCcEEECCCCC
Confidence               78999999999999998899999999999999987542                 367899999 888999999999


Q ss_pred             CCCCccceeEEEECCEEEEEcCcCCCCCCccceeeeccEEEEECCCCceEEeccCCCceeeeeeEEE
Q 013909          334 KPNSHIECAWVIVNNSIIITGGTTEKHPMTKRMILVGEVFQFHLDSLTWSVIGKLPYRIKTTLTGFW  400 (434)
Q Consensus       334 ~~r~~~~~~~~~~~~~i~v~GG~~~~~~~~~~~~~~~~v~~yd~~~~~W~~~~~lp~~r~~~~~~~~  400 (434)
                      .+|..+++  ++++++|||+||.+...       .++++++||+++++|+.+++||.+|..++++++
T Consensus       251 ~~r~~~~~--~~~~~~i~v~GG~~~~~-------~~~~v~~yd~~~~~W~~~~~~p~~r~~~~~~~l  308 (308)
T 1zgk_A          251 HRRSALGI--TVHQGRIYVLGGYDGHT-------FLDSVECYDPDTDTWSEVTRMTSGRSGVGVAVT  308 (308)
T ss_dssp             SCCBSCEE--EEETTEEEEECCBCSSC-------BCCEEEEEETTTTEEEEEEECSSCCBSCEEEEC
T ss_pred             CCccceEE--EEECCEEEEEcCcCCCc-------ccceEEEEcCCCCEEeecCCCCCCcccceeEeC
Confidence            99987654  78899999999987654       678999999999999999999999999988763
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>1qhu_A Protein (hemopexin); beta propeller, HAEM binding and transport, iron metabolism, binding protein; HET: HEM; 2.30A {Oryctolagus cuniculus} SCOP: b.66.1.1 b.66.1.1 PDB: 1qjs_A* Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>3b7f_A Glycosyl hydrolase, BNR repeat; 7-bladed beta-propeller fold, structural genomics, joint CEN structural genomics, JCSG; 2.20A {Ralstonia eutropha} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>3b7f_A Glycosyl hydrolase, BNR repeat; 7-bladed beta-propeller fold, structural genomics, joint CEN structural genomics, JCSG; 2.20A {Ralstonia eutropha} Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>1pex_A Collagenase-3, MMP-13; C-terminal hemopexin-like domain of matrix- metalloproteinase, metalloprotease; 2.70A {Homo sapiens} SCOP: b.66.1.1 Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>1qhu_A Protein (hemopexin); beta propeller, HAEM binding and transport, iron metabolism, binding protein; HET: HEM; 2.30A {Oryctolagus cuniculus} SCOP: b.66.1.1 b.66.1.1 PDB: 1qjs_A* Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>1itv_A MMP9; adaptive molecular recognition, beta propeller, dimer, hydrolase; 1.95A {Homo sapiens} SCOP: b.66.1.1 Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3ju4_A Endo-N-acetylneuraminidase; endonf, polysia, high-resolution, glycosidase, hydrolase; HET: SLB; 0.98A {Enterobacteria phage K1F} PDB: 3gvl_A* 3gvj_A* 3gvk_A* 1v0e_A 1v0f_A* Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>1su3_A Interstitial collagenase; prodomain, hemopexin domain, exocite, structural proteomics in europe, spine, structural genomics, hydrolase; HET: EPE; 2.20A {Homo sapiens} SCOP: a.20.1.2 b.66.1.1 d.92.1.11 PDB: 2clt_A 1fbl_A* Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3oyo_A Hemopexin fold protein CP4; seeds, plant protein; 2.10A {Vigna unguiculata} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>1sqj_A OXG-RCBH, oligoxyloglucan reducing-END-specific cellobiohydrolase; beta-propeller; 2.20A {Geotrichum SP} SCOP: b.69.13.1 b.69.13.1 PDB: 2ebs_A* Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>1hxn_A Hemopexin, HPX; heme, binding protein; 1.80A {Oryctolagus cuniculus} SCOP: b.66.1.1 Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>1itv_A MMP9; adaptive molecular recognition, beta propeller, dimer, hydrolase; 1.95A {Homo sapiens} SCOP: b.66.1.1 Back     alignment and structure
>1sqj_A OXG-RCBH, oligoxyloglucan reducing-END-specific cellobiohydrolase; beta-propeller; 2.20A {Geotrichum SP} SCOP: b.69.13.1 b.69.13.1 PDB: 2ebs_A* Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>1pex_A Collagenase-3, MMP-13; C-terminal hemopexin-like domain of matrix- metalloproteinase, metalloprotease; 2.70A {Homo sapiens} SCOP: b.66.1.1 Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 434
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 1e-07
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 7e-06
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 1e-04
d1k3ia3387 b.69.1.1 (A:151-537) Galactose oxidase, central do 2e-06
d1k3ia3387 b.69.1.1 (A:151-537) Galactose oxidase, central do 7e-06
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure

class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: Kelch motif
family: Kelch motif
domain: Kelch-like ECH-associated protein 1, KEAP1
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 50.7 bits (119), Expect = 1e-07
 Identities = 33/282 (11%), Positives = 67/282 (23%), Gaps = 34/282 (12%)

Query: 108 EWEQMPSAPVPRLDGAAIQIKNLFYVFAGYGSLDYVHSHVDVYNFTDNKWVDRFDMPKDM 167
            W ++    VPR   A   +  L Y   G  +    ++     +  +             
Sbjct: 30  TWLRLADLQVPRSGLAGCVVGGLLYAVGGRNNSPDGNTDSSALDCYNPMTNQWSPCAPMS 89

Query: 168 AHSHLGVVSDGRYIYIVSGQYGPQCRGPTSRTFVLDSETRKWDSIPPLPSPRYSPATQLW 227
              +   V          G          +     + E  +W  + P+ + R      + 
Sbjct: 90  VPRNRIGVGVIDGHIYAVGGS--HGCIHHNSVERYEPERDEWHLVAPMLTRRIGVGVAVL 147

Query: 228 RGRLHVMGGSKENRHTPGLEHWSIAVKDGKALEKAWRTEIPIPRGGPHRACFVFNDRLFV 287
              L+ +GG          E +             WR    +          V ++ ++ 
Sbjct: 148 NRLLYAVGGFDGTNRLNSAECYYPE-------RNEWRMITAMNTIRSGAGVCVLHNCIYA 200

Query: 288 VGGQEGDFMAKPGSPIFKCSRRHEVVYGDVYMLDDEMKWKVLPPMPKPNSHIECAWVIVN 347
            GG                         +     D          P  +        +  
Sbjct: 201 AGGY------------------DGQDQLNSVERYDVETETWTFVAPMKHRRSALGITVHQ 242

Query: 348 NSIIITGGTTEKHPMTKRMILVGEVFQFHLDSLTWSVIGKLP 389
             I + GG      +         V  +  D+ TWS + ++ 
Sbjct: 243 GRIYVLGGYDGHTFLD-------SVECYDPDTDTWSEVTRMT 277
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query434
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 100.0
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 100.0
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 100.0
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 100.0
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 96.75
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 96.35
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 96.21
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 95.88
d1tbga_340 beta1-subunit of the signal-transducing G protein 95.6
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 95.46
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 95.41
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 95.17
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 95.02
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 94.88
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 94.76
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 94.55
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 94.49
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 94.21
d1su3a2195 Collagenase (MMP1), C-terminal domain {Human (Homo 94.03
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 93.94
d1pexa_192 Collagenase-3 (MMP-13), C-terminal domain {Human ( 93.72
d1pexa_192 Collagenase-3 (MMP-13), C-terminal domain {Human ( 93.0
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 92.86
d1itva_195 Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 92.49
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 92.25
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 92.06
d1su3a2195 Collagenase (MMP1), C-terminal domain {Human (Homo 91.9
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 91.64
d1tbga_340 beta1-subunit of the signal-transducing G protein 91.59
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 91.41
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 90.61
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 90.44
d1itva_195 Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 89.82
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 89.75
d1kv9a2 560 Quinoprotein alcohol dehydrogenase, N-terminal dom 89.26
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 89.22
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 88.81
d1k32a3 360 Tricorn protease domain 2 {Archaeon Thermoplasma a 88.49
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 87.84
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 87.07
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 86.57
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 86.49
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 84.67
d1kv9a2 560 Quinoprotein alcohol dehydrogenase, N-terminal dom 84.05
d1gena_200 Gelatinase A (MMP-2), C-terminal domain {Human (Ho 83.99
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 82.61
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 82.04
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 81.12
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 80.89
d1qhua1192 Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 80.34
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: Kelch motif
family: Kelch motif
domain: Kelch-like ECH-associated protein 1, KEAP1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=8.2e-45  Score=337.78  Aligned_cols=263  Identities=19%  Similarity=0.323  Sum_probs=227.7

Q ss_pred             eeeccCCCCcEEEcCCCCCCCCceeEEEECCEEEEEeccCCC---CCceeeEEEEECCCCceEecCCCCCCCCceeeEEE
Q 013909           99 FADLPAPDLEWEQMPSAPVPRLDGAAIQIKNLFYVFAGYGSL---DYVHSHVDVYNFTDNKWVDRFDMPKDMAHSHLGVV  175 (434)
Q Consensus        99 ~~~~~~~~~~W~~~~~~p~~R~~~~~~~~~~~iyv~GG~~~~---~~~~~~v~~yd~~t~~W~~~~~~~~~~~r~~~~~~  175 (434)
                      ++.||+.+++|++++++|.+|.+|++++++++|||+||....   ...++++|+||+.+++|++++++|.  +|..|+++
T Consensus        21 ~~~yd~~t~~W~~~~~~p~~R~~~~~~~~~~~iyv~GG~~~~~~~~~~~~~~~~yd~~~~~w~~~~~~p~--~r~~~~~~   98 (288)
T d1zgka1          21 LEAYNPSNGTWLRLADLQVPRSGLAGCVVGGLLYAVGGRNNSPDGNTDSSALDCYNPMTNQWSPCAPMSV--PRNRIGVG   98 (288)
T ss_dssp             EEEEETTTTEEEECCCCSSCCBSCEEEEETTEEEEECCEEEETTEEEECCCEEEEETTTTEEEECCCCSS--CCBTCEEE
T ss_pred             EEEEECCCCeEEECCCCCCccceeEEEEECCEEEEEeCcccCCCCccccchhhhcccccccccccccccc--eecceecc
Confidence            344444555666666678899999999999999999997432   2356789999999999999999987  79999999


Q ss_pred             EeCCEEEEEeccCCCCCCCCCceeEEEECCCCceEecCCCCCCcccceEEEECCEEEEEcCCCCCCCCCCcceEEEEeec
Q 013909          176 SDGRYIYIVSGQYGPQCRGPTSRTFVLDSETRKWDSIPPLPSPRYSPATQLWRGRLHVMGGSKENRHTPGLEHWSIAVKD  255 (434)
Q Consensus       176 ~~~~~lyv~GG~~~~~~~~~~~~~~~yd~~t~~W~~~~~~p~~r~~~~~~~~~~~iyv~GG~~~~~~~~~~~~~~~~~~~  255 (434)
                      +++++||++||..+..   .+++++.||+.+++|...+.++.+|..|+++..++++|++||.........++.|+     
T Consensus        99 ~~~~~i~~~gg~~~~~---~~~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~~~~GG~~~~~~~~~~~~~d-----  170 (288)
T d1zgka1          99 VIDGHIYAVGGSHGCI---HHNSVERYEPERDEWHLVAPMLTRRIGVGVAVLNRLLYAVGGFDGTNRLNSAECYY-----  170 (288)
T ss_dssp             EETTEEEEECCEETTE---ECCCEEEEETTTTEEEECCCCSSCCBSCEEEEETTEEEEECCBCSSCBCCCEEEEE-----
T ss_pred             ccceeeEEecceeccc---ccceeeeeccccCccccccccccccccceeeeeeecceEecCcccccccceEEEee-----
Confidence            9999999999987653   36889999999999999999999999999999999999999998766666677776     


Q ss_pred             cccccCceEEccCCCCCCCceeEEEECCEEEEEcCCCCCCCCCCCCCccccccccceeeCcEEEeC-CCCCeEEcCCCCC
Q 013909          256 GKALEKAWRTEIPIPRGGPHRACFVFNDRLFVVGGQEGDFMAKPGSPIFKCSRRHEVVYGDVYMLD-DEMKWKVLPPMPK  334 (434)
Q Consensus       256 ~~~~~~~W~~~~~~p~~~~~~~~~~~~~~iyv~GG~~~~~~~~~~~~~~~~~~~~~~~~~~v~~yd-~~~~W~~~~~~p~  334 (434)
                        +.+++|...+..+..+..++++..+++|+++||.....                 .+++.+.|| .+++|+.++++|.
T Consensus       171 --~~~~~~~~~~~~~~~~~~~~~~~~~~~i~i~GG~~~~~-----------------~~~~~~~~~~~~~~~~~~~~~p~  231 (288)
T d1zgka1         171 --PERNEWRMITAMNTIRSGAGVCVLHNCIYAAGGYDGQD-----------------QLNSVERYDVETETWTFVAPMKH  231 (288)
T ss_dssp             --TTTTEEEECCCCSSCCBSCEEEEETTEEEEECCBCSSS-----------------BCCCEEEEETTTTEEEECCCCSS
T ss_pred             --ccccccccccccccccccccccceeeeEEEecCccccc-----------------cccceeeeeecceeeecccCccC
Confidence              78999999988888888889999999999999987653                 467899999 8899999999999


Q ss_pred             CCCccceeEEEECCEEEEEcCcCCCCCCccceeeeccEEEEECCCCceEEeccCCCceeeeeeEE
Q 013909          335 PNSHIECAWVIVNNSIIITGGTTEKHPMTKRMILVGEVFQFHLDSLTWSVIGKLPYRIKTTLTGF  399 (434)
Q Consensus       335 ~r~~~~~~~~~~~~~i~v~GG~~~~~~~~~~~~~~~~v~~yd~~~~~W~~~~~lp~~r~~~~~~~  399 (434)
                      +|..+++  ++++++|||+||.+...       .++++++||+++++|+++++||.+|+.|++++
T Consensus       232 ~r~~~~~--~~~~~~l~v~GG~~~~~-------~~~~v~~yd~~~~~W~~~~~~p~~R~~~~~~~  287 (288)
T d1zgka1         232 RRSALGI--TVHQGRIYVLGGYDGHT-------FLDSVECYDPDTDTWSEVTRMTSGRSGVGVAV  287 (288)
T ss_dssp             CCBSCEE--EEETTEEEEECCBCSSC-------BCCEEEEEETTTTEEEEEEECSSCCBSCEEEE
T ss_pred             cccceEE--EEECCEEEEEecCCCCe-------ecceEEEEECCCCEEEECCCCCCCcEeEEEEE
Confidence            9987654  88899999999987655       67899999999999999999999999998765
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1su3a2 b.66.1.1 (A:271-465) Collagenase (MMP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pexa_ b.66.1.1 (A:) Collagenase-3 (MMP-13), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pexa_ b.66.1.1 (A:) Collagenase-3 (MMP-13), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1itva_ b.66.1.1 (A:) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1su3a2 b.66.1.1 (A:271-465) Collagenase (MMP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1itva_ b.66.1.1 (A:) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1gena_ b.66.1.1 (A:) Gelatinase A (MMP-2), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qhua1 b.66.1.1 (A:24-215) Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure