Citrus Sinensis ID: 013929

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430---
MTCMIDLNGKRPLEIDGDDDCHHQRNKSLKLSNSRKTAGTSREQSDDDQGSDDNLQSEDNQQADDHQQSNAGHSSDLDSLIQPIGRDNSISCLIRCSRSDYGSIASLNQSFRSLIRSGELYRLRRLNGVIEHWVYFSCHLLEWEAFDPIRRRWMHLPRMTSNECFMCSDKESLAVGTELLVFGRELTAHHISHVIYRYSILTNSWSSGMRMNAPRCLFGSASLGEIAILAGGSDLEGNILSSAEMYNSETQTWKVLPSMKNPRKMCSGVFMDGKFYVIGGIGGSDSKVLTCGEEYDLETETWTEIPNMSPARGGAARGTEMPASAEAPPLVAVVNNELYAADYADMEVRKYDKERRLWFTIGRLPERANSMNGWGLAFRACGDRLIVIGGPKASGEGFIELNSWVPSEGPPQWNLLARKQSANFVYNCAVMGC
cEEEEEccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccccHHHHHccHHHHHHcccccEEEEccccccEEEEEEEEEEccEEEEEccccccEEEcccccccccccccccEEEEEccEEEEEcccccccccccEEEEEEcccccEEcccccccccccEEEEEEccEEEEEcccccccccccEEEEEEcccccEEEcccccccccccEEEEEccEEEEEccccccccccccEEEEEEcccccEEEcccccccccccccccccccccccccEEEEEccEEEEEEccccEEEEEEcccccEEEEccccccccccccccEEEEEEccEEEEEEccccccccEEEEEEEEccccccccEEEcccccccEEEEEEEEcc
cEEEEEEcccccEEEcccccccEEccccccccccccEccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccccccccccHHHccEEEEEccEEEEEccccccccEEEEEEEccccEEEEccccccEEEcccccccccccccccEEEEEccEEEEEcccccccccccEEEEEcccccccEEccccccccccEEEEEEccEEEEEEccccccccccEEEEEccccccEEEcccccccccccEEEEEccEEEEEEcccccccccccEEEEEccccccEEEEccccccccccEEEccccccccccccEEEEccEEEEEEccccEEEEEcccccEEEEEccccccccccccEEEEEEEEccEEEEEEccccccccEEEEEEEcccccccccEEEccccccccEEEEEEEcc
mtcmidlngkrpleidgdddchhqrnkslklsnsrktagtsreqsdddqgsddnlqsednqqaddhqqsnaghssdldsliqpigrdnsisclircsrsdygsiaSLNQSFRSLIRSGELYRLRRLNGVIEHWVYFSCHLleweafdpirrrwmhlprmtsnecfmcsdkesLAVGTELLVFGRELTAHHISHVIYRYSILTNswssgmrmnaprclfgsasLGEIAILaggsdlegnILSSAEMYNSETqtwkvlpsmknprkmcsgvfmdgkfyviggiggsdskvltcgeeydletetwteipnmsparggaargtempasaeapplvaVVNNelyaadyadmeVRKYDKERRLWFTIgrlperansmngwglafrACGDrliviggpkasgegfielnswvpsegppqwnlLARKQSANFVYNCAVMGC
mtcmidlngkrpleidgdddchhqrnkslklsnsrktagtsreqsdddqgSDDNLQSEDNQQADDHQQSNAGHSSDLDSLIQPIGRDNSISCLIRCSRSDYGSIASLNQSFRSLIRSGELYRLRRLNGVIEHWVYFSCHLLEWEAFDPIRRRWMHLPRMTSNECFMCSDKESLAVGTELLVFGRELTAHHISHVIYRYSILTNSWSSGMRMNAPRCLFGSASLGEIAILAGGSDLEGNILSSAEMYNSETQtwkvlpsmknPRKMCSGVFMDGKFYVIGGIGGSDSKVLTCGEEYDLEtetwteipnmsPARGGAARGTEMPASAEAPPLVAVVNNELYAADYADMEVRKYDKERRLWFTIgrlperansmnGWGLAFRACGDRLIVIGGPKASGEGFIELNSWVPSEGPPQWNLLARKQSANFVYNCAVMGC
MTCMIDLNGKRPLEIDGDDDCHHQRNKSLKLSNSRKTAGTSREQSDDDQGSDDNLQSEDNQQADDHQQSNAGHSSDLDSLIQPIGRDNSISCLIRCSRSDYGSIASLNQSFRSLIRSGELYRLRRLNGVIEHWVYFSCHLLEWEAFDPIRRRWMHLPRMTSNECFMCSDKESLAVGTELLVFGRELTAHHISHVIYRYSILTNSWSSGMRMNAPRCLFGSASLGEIAILAGGSDLEGNILSSAEMYNSETQTWKVLPSMKNPRKMCSGVFMDGKFYVIGGIGGSDSKVLTCGEEYDLETETWTEIPNMSPARGGAARGTEMPASAEAPPLVAVVNNELYAADYADMEVRKYDKERRLWFTIGRLPERANSMNGWGLAFRACGDRLIVIGGPKASGEGFIELNSWVPSEGPPQWNLLARKQSANFVYNCAVMGC
**********************************************************************************PIGRDNSISCLIRCSRSDYGSIASLNQSFRSLIRSGELYRLRRLNGVIEHWVYFSCHLLEWEAFDPIRRRWMHLPRMTSNECFMCSDKESLAVGTELLVFGRELTAHHISHVIYRYSILTNSWSSGMRMNAPRCLFGSASLGEIAILAGGSDLEGNILSSAEMYNSETQTWKVLPSMKNPRKMCSGVFMDGKFYVIGGIGGSDSKVLTCGEEYDLETETWTE*************************LVAVVNNELYAADYADMEVRKYDKERRLWFTIGRLPERANSMNGWGLAFRACGDRLIVIGGPKASGEGFIELNSWVPSEGPPQWNLLARKQSANFVYNCAVM**
********************************************************************************IQPIGRDNSISCLIRCSRSDYGSIASLNQSFRSLIRSGELYRLRRLNGVIEHWVYFSCHLLEWEAFDPIRRRWMHLPRMTSNECFMCSDKESLAVGTELLVFGRELTAHHISHVIYRYSILTNSWSSGMRMNAPRCLFGSASLGEIAILAGGSDLEGNILSSAEMYNSETQTWKVLPSMKNPRKMCSGVFMDGKFYVIGGIGGSDSKVLTCGEEYDLETETWTEIPNMSPARGGAARGTEMPASAEAPPLVAVVNNELYAADYADMEVRKYDKERRLWFTIGRLPERANSMNGWGLAFRACGDRLIVIGGPKASGEGFIELNSWVPSEGPPQWNLLARKQSANFVYNCAVMGC
MTCMIDLNGKRPLEIDGDDDCHHQRN*************************************************DLDSLIQPIGRDNSISCLIRCSRSDYGSIASLNQSFRSLIRSGELYRLRRLNGVIEHWVYFSCHLLEWEAFDPIRRRWMHLPRMTSNECFMCSDKESLAVGTELLVFGRELTAHHISHVIYRYSILTNSWSSGMRMNAPRCLFGSASLGEIAILAGGSDLEGNILSSAEMYNSETQTWKVLPSMKNPRKMCSGVFMDGKFYVIGGIGGSDSKVLTCGEEYDLETETWTEIPNMS**************SAEAPPLVAVVNNELYAADYADMEVRKYDKERRLWFTIGRLPERANSMNGWGLAFRACGDRLIVIGGPKASGEGFIELNSWVPSEGPPQWNLLARKQSANFVYNCAVMGC
MTCMIDLNGKRPLEIDGDDDCHHQ*****************************************************DSLIQPIGRDNSISCLIRCSRSDYGSIASLNQSFRSLIRSGELYRLRRLNGVIEHWVYFSCHLLEWEAFDPIRRRWMHLPRMTSNECFMCSDKESLAVGTELLVFGRELTAHHISHVIYRYSILTNSWSSGMRMNAPRCLFGSASLGEIAILAGGSDLEGNILSSAEMYNSETQTWKVLPSMKNPRKMCSGVFMDGKFYVIGGIGGSDSKVLTCGEEYDLETETWTEIPNMSPARGGAARGTEMPASAEAPPLVAVVNNELYAADYADMEVRKYDKERRLWFTIGRLPERANSMNGWGLAFRACGDRLIVIGGPKASGEGFIELNSWVPSEGPPQWNLLARKQSANFVYNCAVMGC
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTCMIDLNGKRPLEIDGDDDCHHQRNKSLKLSNSRKTAGTSREQSDDDQGSDDNLQSEDNQQADDHQQSNAGHSSDLDSLIQPIGRDNSISCLIRCSRSDYGSIASLNQSFRSLIRSGELYRLRRLNGVIEHWVYFSCHLLEWEAFDPIRRRWMHLPRMTSNECFMCSDKESLAVGTELLVFGRELTAHHISHVIYRYSILTNSWSSGMRMNAPRCLFGSASLGEIAILAGGSDLEGNILSSAEMYNSETQTWKVLPSMKNPRKMCSGVFMDGKFYVIGGIGGSDSKVLTCGEEYDLETETWTEIPNMSPARGGAARGTEMPASAEAPPLVAVVNNELYAADYADMEVRKYDKERRLWFTIGRLPERANSMNGWGLAFRACGDRLIVIGGPKASGEGFIELNSWVPSEGPPQWNLLARKQSANFVYNCAVMGC
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query433 2.2.26 [Sep-21-2011]
Q8L736467 F-box/kelch-repeat protei yes no 0.960 0.890 0.681 1e-167
Q84M94421 F-box/kelch-repeat protei no no 0.870 0.895 0.673 1e-150
Q9CA63451 F-box/kelch-repeat protei no no 0.785 0.753 0.669 1e-136
Q9FKJ0393 F-box/kelch-repeat protei no no 0.812 0.895 0.462 3e-90
Q9LI89422 F-box/kelch-repeat protei no no 0.755 0.774 0.365 3e-55
Q9CAG8376 F-box/kelch-repeat protei no no 0.459 0.529 0.283 6e-18
Q93W93434 F-box/kelch-repeat protei no no 0.667 0.665 0.258 3e-17
Q0WW40383 F-box/kelch-repeat protei no no 0.690 0.780 0.226 8e-17
Q9LMR5359 F-box/kelch-repeat protei no no 0.676 0.816 0.256 6e-16
Q70JS2 1499 Ring canal kelch homolog N/A no 0.461 0.133 0.277 3e-14
>sp|Q8L736|SKI11_ARATH F-box/kelch-repeat protein SKIP11 OS=Arabidopsis thaliana GN=SKIP11 PE=1 SV=2 Back     alignment and function desciption
 Score =  587 bits (1513), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 297/436 (68%), Positives = 338/436 (77%), Gaps = 20/436 (4%)

Query: 8   NGKRPLEIDGDDDCHHQRNKSLKL---------SNSRKTAGTSREQSDDDQGSDDNLQSE 58
           NGKR LE+ G+     ++ KSLKL          +S  +     EQ+D   G   + + E
Sbjct: 42  NGKRALEVVGE----VRQTKSLKLMGFSIIYDSDSSDYSLSGGEEQADAAIGDGSSSRQE 97

Query: 59  DNQQADDHQQSNAGHSSDLDSLIQPIGRDNSISCLIRCSRSDYGSIASLNQSFRSLIRSG 118
             QQ+D +   N G SSD  SLI  IGRDNSI CLIRCSRSDYGSIASLN++FRSL++SG
Sbjct: 98  QEQQSDFND--NGGDSSDSHSLINEIGRDNSIDCLIRCSRSDYGSIASLNRNFRSLVKSG 155

Query: 119 ELYRLRRLNGVIEHWVYFSCHLLEWEAFDPIRRRWMHLPRMTSNECFMCSDKESLAVGTE 178
           E+YRLRR NG +EHWVYFSC LLEW AFDP+ RRWM LP M S+  FMC+DKESLAVGT+
Sbjct: 156 EIYRLRRQNGFVEHWVYFSCQLLEWVAFDPVERRWMQLPTMPSSVTFMCADKESLAVGTD 215

Query: 179 LLVFGRELTAHHISHVIYRYSILTNSWSSGMRMNAPRCLFGSASLGEIAILAGGSDLEGN 238
           LLV G++      SHVIYRYS+LTNSWSSGM+MN+PRCLFGSASLGEIAI AGG D +G 
Sbjct: 216 LLVLGKD---DFSSHVIYRYSLLTNSWSSGMKMNSPRCLFGSASLGEIAIFAGGCDSQGK 272

Query: 239 ILSSAEMYNSETQTWKVLPSMKNPRKMCSGVFMDGKFYVIGGIGGSDSKVLTCGEEYDLE 298
           IL  AEMYNSE QTW  LP M  PRKMCSGVFMDGKFYVIGGIGG+DSK LTCGEEYDLE
Sbjct: 273 ILDFAEMYNSELQTWITLPRMNKPRKMCSGVFMDGKFYVIGGIGGADSKGLTCGEEYDLE 332

Query: 299 TETWTEIPNMSPARGGAARGTEMPASAEAPPLVAVVNNELYAADYADMEVRKYDKERRLW 358
           T+ WT+IP++SP R  A +    PA AEAPPLVAVVNN+LYAAD+ADMEVRKYDKE + W
Sbjct: 333 TKKWTQIPDLSPPRSRADQADMSPA-AEAPPLVAVVNNQLYAADHADMEVRKYDKENKKW 391

Query: 359 FTIGRLPERANSMNGWGLAFRACGDRLIVIGGPKASGEGFIELNSWVPSE-GPPQWNLLA 417
            T+GRLPERA S+NGWGLAFRACG+RLIVIGGPK SG GFIELNSW+PS+ GPPQW LL 
Sbjct: 392 LTVGRLPERAGSVNGWGLAFRACGERLIVIGGPKCSGGGFIELNSWIPSDGGPPQWTLLD 451

Query: 418 RKQSANFVYNCAVMGC 433
           RK S  FVYNCAVMGC
Sbjct: 452 RKHSPTFVYNCAVMGC 467
Component of SCF(ASK-cullin-F-box) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins.
Arabidopsis thaliana (taxid: 3702)
>sp|Q84M94|FBK15_ARATH F-box/kelch-repeat protein At1g26930 OS=Arabidopsis thaliana GN=At1g26930 PE=2 SV=1 Back     alignment and function description
>sp|Q9CA63|FBK29_ARATH F-box/kelch-repeat protein At1g74510 OS=Arabidopsis thaliana GN=At1g74510 PE=2 SV=1 Back     alignment and function description
>sp|Q9FKJ0|FK132_ARATH F-box/kelch-repeat protein At5g60570 OS=Arabidopsis thaliana GN=At5g60570 PE=2 SV=1 Back     alignment and function description
>sp|Q9LI89|FBK70_ARATH F-box/kelch-repeat protein At3g27150 OS=Arabidopsis thaliana GN=At3g27150 PE=2 SV=1 Back     alignment and function description
>sp|Q9CAG8|FBK28_ARATH F-box/kelch-repeat protein At1g67480 OS=Arabidopsis thaliana GN=At1g67480 PE=2 SV=1 Back     alignment and function description
>sp|Q93W93|FBK22_ARATH F-box/kelch-repeat protein At1g55270 OS=Arabidopsis thaliana GN=At1g55270 PE=2 SV=1 Back     alignment and function description
>sp|Q0WW40|FBK5_ARATH F-box/kelch-repeat protein At1g16250 OS=Arabidopsis thaliana GN=At1g16250 PE=2 SV=1 Back     alignment and function description
>sp|Q9LMR5|FK126_ARATH F-box/kelch-repeat protein At1g15670 OS=Arabidopsis thaliana GN=At1g15670 PE=2 SV=1 Back     alignment and function description
>sp|Q70JS2|KELC_ANOST Ring canal kelch homolog OS=Anopheles stephensi GN=kel PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query433
356526905 539 PREDICTED: F-box/kelch-repeat protein SK 0.893 0.717 0.783 0.0
359473368 541 PREDICTED: F-box/kelch-repeat protein SK 0.958 0.767 0.728 1e-180
357486773480 F-box/kelch-repeat protein SKIP11 [Medic 0.981 0.885 0.694 1e-179
255587925422 conserved hypothetical protein [Ricinus 0.900 0.924 0.747 1e-178
356499787 539 PREDICTED: F-box/kelch-repeat protein SK 0.956 0.768 0.728 1e-176
356567532 539 PREDICTED: F-box/kelch-repeat protein SK 0.893 0.717 0.773 1e-174
356498226 537 PREDICTED: F-box/kelch-repeat protein SK 0.986 0.795 0.608 1e-173
48210029513 kelch repeat-containing F-box family pro 0.967 0.816 0.640 1e-166
22655058467 predicted protein [Arabidopsis thaliana] 0.960 0.890 0.683 1e-165
15227057467 F-box/kelch-repeat protein SKIP11 [Arabi 0.960 0.890 0.681 1e-165
>gi|356526905|ref|XP_003532056.1| PREDICTED: F-box/kelch-repeat protein SKIP11-like [Glycine max] Back     alignment and taxonomy information
 Score =  645 bits (1664), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/393 (78%), Positives = 343/393 (87%), Gaps = 6/393 (1%)

Query: 41  SREQSDDDQGSDDNLQSEDNQQADDHQQSNAGHSSDLDSLIQPIGRDNSISCLIRCSRSD 100
           S EQ  + +   D L + D Q  DD ++ + G SSD  SL+  + RD+SI+CL RCSRSD
Sbjct: 153 SDEQKMEQEVEGDLLDAGDQQPPDDQEEHHGGDSSDSGSLLPRMNRDSSIACLSRCSRSD 212

Query: 101 YGSIASLNQSFRSLIRSGELYRLRRLNGVIEHWVYFSCHLLEWEAFDPIRRRWMHLPRMT 160
           YGS+ASLN+SFR+ IRSGELYR RRLNG+IEHW+YFSC LLEWEA+DPIR RWMHLPRM 
Sbjct: 213 YGSLASLNRSFRNTIRSGELYRWRRLNGIIEHWIYFSCALLEWEAYDPIRERWMHLPRMA 272

Query: 161 SNECFMCSDKESLAVGTELLVFGRELTAHHISHVIYRYSILTNSWSSGMRMNAPRCLFGS 220
           SNECFMCSDKESLAVGTELLVFGRE+     SHVIYRYS+LTNSW+SGMRMNAPRCLFGS
Sbjct: 273 SNECFMCSDKESLAVGTELLVFGREMR----SHVIYRYSLLTNSWTSGMRMNAPRCLFGS 328

Query: 221 ASLGEIAILAGGSDLEGNILSSAEMYNSETQTWKVLPSMKNPRKMCSGVFMDGKFYVIGG 280
           ASLGEIAILAGG DL+G+IL SAE+YNSE QTW++LPSM  PRKMCSGVFMDGKFYVIGG
Sbjct: 329 ASLGEIAILAGGCDLDGHILDSAELYNSENQTWELLPSMNKPRKMCSGVFMDGKFYVIGG 388

Query: 281 IGGSDSKVLTCGEEYDLETETWTEIPNMSPARGGAARGTEMPASAEAPPLVAVVNNELYA 340
           IGG DSK+LTCGEEY+++T TWTEIPNMSP R  +ARG EMPA+AEAPPLVAVVN+ELYA
Sbjct: 389 IGGKDSKLLTCGEEYNIQTRTWTEIPNMSPGR--SARGAEMPATAEAPPLVAVVNDELYA 446

Query: 341 ADYADMEVRKYDKERRLWFTIGRLPERANSMNGWGLAFRACGDRLIVIGGPKASGEGFIE 400
           ADYADMEV+KYDKERR+W TIGRLPERA SMNGWGLAFRACGD LIVIGGP+  GEGFIE
Sbjct: 447 ADYADMEVKKYDKERRVWVTIGRLPERAVSMNGWGLAFRACGDMLIVIGGPRTHGEGFIE 506

Query: 401 LNSWVPSEGPPQWNLLARKQSANFVYNCAVMGC 433
           LNSWVPSEGPPQWNLLARK+S NFVYNCAVMGC
Sbjct: 507 LNSWVPSEGPPQWNLLARKRSGNFVYNCAVMGC 539

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359473368|ref|XP_003631294.1| PREDICTED: F-box/kelch-repeat protein SKIP11-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|357486773|ref|XP_003613674.1| F-box/kelch-repeat protein SKIP11 [Medicago truncatula] gi|355515009|gb|AES96632.1| F-box/kelch-repeat protein SKIP11 [Medicago truncatula] Back     alignment and taxonomy information
>gi|255587925|ref|XP_002534442.1| conserved hypothetical protein [Ricinus communis] gi|223525283|gb|EEF27941.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|356499787|ref|XP_003518718.1| PREDICTED: F-box/kelch-repeat protein SKIP11-like [Glycine max] Back     alignment and taxonomy information
>gi|356567532|ref|XP_003551972.1| PREDICTED: F-box/kelch-repeat protein SKIP11-like [Glycine max] Back     alignment and taxonomy information
>gi|356498226|ref|XP_003517954.1| PREDICTED: F-box/kelch-repeat protein SKIP11-like isoform 1 [Glycine max] gi|356498228|ref|XP_003517955.1| PREDICTED: F-box/kelch-repeat protein SKIP11-like isoform 2 [Glycine max] Back     alignment and taxonomy information
>gi|48210029|gb|AAT40540.1| kelch repeat-containing F-box family protein, putative [Solanum demissum] Back     alignment and taxonomy information
>gi|22655058|gb|AAM98120.1| predicted protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|15227057|ref|NP_178390.1| F-box/kelch-repeat protein SKIP11 [Arabidopsis thaliana] gi|79316620|ref|NP_001030959.1| F-box/kelch-repeat protein SKIP11 [Arabidopsis thaliana] gi|79316634|ref|NP_001030960.1| F-box/kelch-repeat protein SKIP11 [Arabidopsis thaliana] gi|142994697|sp|Q8L736.2|SKI11_ARATH RecName: Full=F-box/kelch-repeat protein SKIP11; AltName: Full=SKP1-interacting partner 11 gi|3461814|gb|AAC32908.1| predicted by genefinder and genscan [Arabidopsis thaliana] gi|16974560|gb|AAL31196.1| At2g02870/T17M13.4 [Arabidopsis thaliana] gi|25090100|gb|AAN72228.1| At2g02870/T17M13.4 [Arabidopsis thaliana] gi|222423827|dbj|BAH19879.1| AT2G02870 [Arabidopsis thaliana] gi|330250542|gb|AEC05636.1| F-box/kelch-repeat protein SKIP11 [Arabidopsis thaliana] gi|330250543|gb|AEC05637.1| F-box/kelch-repeat protein SKIP11 [Arabidopsis thaliana] gi|330250544|gb|AEC05638.1| F-box/kelch-repeat protein SKIP11 [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query433
TAIR|locus:2056705467 AT2G02870 "AT2G02870" [Arabido 0.960 0.890 0.681 1.3e-155
TAIR|locus:2012547441 AT1G14330 "AT1G14330" [Arabido 0.849 0.834 0.740 1.2e-152
TAIR|locus:2202765421 AT1G26930 "AT1G26930" [Arabido 0.879 0.904 0.670 1.7e-139
TAIR|locus:2019215451 AT1G74510 "AT1G74510" [Arabido 0.960 0.922 0.577 2.4e-131
TAIR|locus:2175143393 AT5G60570 "AT5G60570" [Arabido 0.812 0.895 0.462 5.4e-86
TAIR|locus:2095138422 AT3G27150 "AT3G27150" [Arabido 0.757 0.777 0.366 3.4e-54
TAIR|locus:2168738415 AT5G40680 "AT5G40680" [Arabido 0.896 0.934 0.326 5.2e-49
TAIR|locus:2036119359 AT1G15670 "AT1G15670" [Arabido 0.489 0.590 0.314 1.7e-18
TAIR|locus:2008773376 AT1G67480 "AT1G67480" [Arabido 0.503 0.579 0.291 5.4e-17
TAIR|locus:2032855383 AT1G16250 "AT1G16250" [Arabido 0.688 0.778 0.228 6e-17
TAIR|locus:2056705 AT2G02870 "AT2G02870" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1517 (539.1 bits), Expect = 1.3e-155, P = 1.3e-155
 Identities = 297/436 (68%), Positives = 338/436 (77%)

Query:     8 NGKRPLEIDGDDDCHHQRNKSLKL---------SNSRKTAGTSREQSDDDQGSDDNLQSE 58
             NGKR LE+ G+     ++ KSLKL          +S  +     EQ+D   G   + + E
Sbjct:    42 NGKRALEVVGEV----RQTKSLKLMGFSIIYDSDSSDYSLSGGEEQADAAIGDGSSSRQE 97

Query:    59 DNQQADDHQQSNAGHSSDLDSLIQPIGRDNSISCLIRCSRSDYGSIASLNQSFRSLIRSG 118
               QQ+D +   N G SSD  SLI  IGRDNSI CLIRCSRSDYGSIASLN++FRSL++SG
Sbjct:    98 QEQQSDFND--NGGDSSDSHSLINEIGRDNSIDCLIRCSRSDYGSIASLNRNFRSLVKSG 155

Query:   119 ELYRLRRLNGVIEHWVYFSCHLLEWEAFDPIRRRWMHLPRMTSNECFMCSDKESLAVGTE 178
             E+YRLRR NG +EHWVYFSC LLEW AFDP+ RRWM LP M S+  FMC+DKESLAVGT+
Sbjct:   156 EIYRLRRQNGFVEHWVYFSCQLLEWVAFDPVERRWMQLPTMPSSVTFMCADKESLAVGTD 215

Query:   179 LLVFGRELTAHHISHVIYRYSILTNSWSSGMRMNAPRCLFGSASLGEIAILAGGSDLEGN 238
             LLV G++      SHVIYRYS+LTNSWSSGM+MN+PRCLFGSASLGEIAI AGG D +G 
Sbjct:   216 LLVLGKD---DFSSHVIYRYSLLTNSWSSGMKMNSPRCLFGSASLGEIAIFAGGCDSQGK 272

Query:   239 ILSSAEMYNSETQTWKVLPSMKNPRKMCSGVFMDGKFYVIGGIGGSDSKVLTCGEEYDLE 298
             IL  AEMYNSE QTW  LP M  PRKMCSGVFMDGKFYVIGGIGG+DSK LTCGEEYDLE
Sbjct:   273 ILDFAEMYNSELQTWITLPRMNKPRKMCSGVFMDGKFYVIGGIGGADSKGLTCGEEYDLE 332

Query:   299 TETWTEIPNMSPARGGAARGTEMPASAEAPPLVAVVNNELYAADYADMEVRKYDKERRLW 358
             T+ WT+IP++SP R  A +    PA AEAPPLVAVVNN+LYAAD+ADMEVRKYDKE + W
Sbjct:   333 TKKWTQIPDLSPPRSRADQADMSPA-AEAPPLVAVVNNQLYAADHADMEVRKYDKENKKW 391

Query:   359 FTIGRLPERANSMNGWGLAFRACGDRLIVIGGPKASGEGFIELNSWVPSEG-PPQWNLLA 417
              T+GRLPERA S+NGWGLAFRACG+RLIVIGGPK SG GFIELNSW+PS+G PPQW LL 
Sbjct:   392 LTVGRLPERAGSVNGWGLAFRACGERLIVIGGPKCSGGGFIELNSWIPSDGGPPQWTLLD 451

Query:   418 RKQSANFVYNCAVMGC 433
             RK S  FVYNCAVMGC
Sbjct:   452 RKHSPTFVYNCAVMGC 467
GO:0003674 "molecular_function" evidence=ND
GO:0008150 "biological_process" evidence=ND
GO:0009507 "chloroplast" evidence=ISM
GO:0005634 "nucleus" evidence=IDA
GO:0009610 "response to symbiotic fungus" evidence=RCA
GO:0016036 "cellular response to phosphate starvation" evidence=RCA
GO:0019375 "galactolipid biosynthetic process" evidence=RCA
GO:0042631 "cellular response to water deprivation" evidence=RCA
TAIR|locus:2012547 AT1G14330 "AT1G14330" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2202765 AT1G26930 "AT1G26930" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2019215 AT1G74510 "AT1G74510" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2175143 AT5G60570 "AT5G60570" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2095138 AT3G27150 "AT3G27150" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2168738 AT5G40680 "AT5G40680" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2036119 AT1G15670 "AT1G15670" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2008773 AT1G67480 "AT1G67480" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2032855 AT1G16250 "AT1G16250" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8L736SKI11_ARATHNo assigned EC number0.68110.96070.8907yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query433
PHA03098534 PHA03098, PHA03098, kelch-like protein; Provisiona 2e-14
PHA03098534 PHA03098, PHA03098, kelch-like protein; Provisiona 6e-12
pfam0134446 pfam01344, Kelch_1, Kelch motif 1e-08
smart0061247 smart00612, Kelch, Kelch domain 1e-07
pfam0134446 pfam01344, Kelch_1, Kelch motif 2e-07
smart0061247 smart00612, Kelch, Kelch domain 5e-06
pfam1341548 pfam13415, Kelch_3, Galactose oxidase, central dom 9e-06
pfam1396450 pfam13964, Kelch_6, Kelch motif 2e-05
PHA02790480 PHA02790, PHA02790, Kelch-like protein; Provisiona 7e-05
pfam0764648 pfam07646, Kelch_2, Kelch motif 3e-04
PRK14131 376 PRK14131, PRK14131, N-acetylneuraminic acid mutaro 3e-04
pfam1396450 pfam13964, Kelch_6, Kelch motif 4e-04
pfam1341849 pfam13418, Kelch_4, Galactose oxidase, central dom 8e-04
pfam1341849 pfam13418, Kelch_4, Galactose oxidase, central dom 0.001
pfam1341548 pfam13415, Kelch_3, Galactose oxidase, central dom 0.002
TIGR03548323 TIGR03548, mutarot_permut, cyclically-permuted mut 0.003
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information 
 Score = 74.8 bits (184), Expect = 2e-14
 Identities = 50/218 (22%), Positives = 73/218 (33%), Gaps = 30/218 (13%)

Query: 182 FGRELTAHHISHVIYRYSILTNSWSSGMRM---NAPRCLFGSASLGEIAILAGGSDLEGN 238
           FG  +  H    +     I   S  S +           FGS  L  +    GG +    
Sbjct: 249 FGSIIYIHITMSIFTYNYITNYSPLSEINTIIDIHYVYCFGSVVLNNVIYFIGGMNKNNL 308

Query: 239 ILSSAEMYNSETQTWKVLPSMKNPRKMCSGVFMDGKFYVIGGIGGSDSKVLTCGEEYDLE 298
            ++S   Y+++T++W  +P +  PRK       + + YVIGGI  S S  L   E +   
Sbjct: 309 SVNSVVSYDTKTKSWNKVPELIYPRKNPGVTVFNNRIYVIGGIYNSIS--LNTVESWKPG 366

Query: 299 TETWTEIPNMSPARGGAARGTEMPASAEAPPLVAVVNNELYAA------DYADMEVRKYD 352
              W E P +   R                  V  VNN +Y        D     V  + 
Sbjct: 367 ESKWREEPPLIFPRYNPC--------------VVNVNNLIYVIGGISKNDELLKTVECFS 412

Query: 353 KERRLWFTIGRLPERANSMNGWGLAFRACGDRLIVIGG 390
                W     LP    S  G    +     ++ VIGG
Sbjct: 413 LNTNKWSKGSPLPI---SHYGGCAIYH--DGKIYVIGG 445

Length = 534
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information
>gnl|CDD|201739 pfam01344, Kelch_1, Kelch motif Back     alignment and domain information
>gnl|CDD|128874 smart00612, Kelch, Kelch domain Back     alignment and domain information
>gnl|CDD|201739 pfam01344, Kelch_1, Kelch motif Back     alignment and domain information
>gnl|CDD|128874 smart00612, Kelch, Kelch domain Back     alignment and domain information
>gnl|CDD|222113 pfam13415, Kelch_3, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|206134 pfam13964, Kelch_6, Kelch motif Back     alignment and domain information
>gnl|CDD|165153 PHA02790, PHA02790, Kelch-like protein; Provisional Back     alignment and domain information
>gnl|CDD|116261 pfam07646, Kelch_2, Kelch motif Back     alignment and domain information
>gnl|CDD|237617 PRK14131, PRK14131, N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>gnl|CDD|206134 pfam13964, Kelch_6, Kelch motif Back     alignment and domain information
>gnl|CDD|205596 pfam13418, Kelch_4, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|205596 pfam13418, Kelch_4, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|222113 pfam13415, Kelch_3, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|211835 TIGR03548, mutarot_permut, cyclically-permuted mutarotase family protein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 433
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 100.0
PHA02713557 hypothetical protein; Provisional 100.0
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 100.0
PLN02153341 epithiospecifier protein 100.0
PLN02153341 epithiospecifier protein 100.0
PLN02193470 nitrile-specifier protein 100.0
TIGR03547346 muta_rot_YjhT mutatrotase, YjhT family. Members of 100.0
PHA03098534 kelch-like protein; Provisional 100.0
PHA02713557 hypothetical protein; Provisional 100.0
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 100.0
PLN02193470 nitrile-specifier protein 100.0
TIGR03547346 muta_rot_YjhT mutatrotase, YjhT family. Members of 100.0
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 100.0
PHA02790480 Kelch-like protein; Provisional 100.0
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 100.0
PHA03098534 kelch-like protein; Provisional 100.0
KOG4693392 consensus Uncharacterized conserved protein, conta 100.0
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 100.0
PHA02790480 Kelch-like protein; Provisional 100.0
KOG4693392 consensus Uncharacterized conserved protein, conta 100.0
KOG1230 521 consensus Protein containing repeated kelch motifs 99.95
KOG0379 482 consensus Kelch repeat-containing proteins [Genera 99.95
KOG0379 482 consensus Kelch repeat-containing proteins [Genera 99.94
KOG4152 830 consensus Host cell transcription factor HCFC1 [Ce 99.94
KOG1230 521 consensus Protein containing repeated kelch motifs 99.93
KOG4152 830 consensus Host cell transcription factor HCFC1 [Ce 99.92
COG3055381 Uncharacterized protein conserved in bacteria [Fun 99.79
COG3055 381 Uncharacterized protein conserved in bacteria [Fun 99.64
PF1396450 Kelch_6: Kelch motif 99.28
KOG2437 723 consensus Muskelin [Signal transduction mechanisms 99.17
KOG2437 723 consensus Muskelin [Signal transduction mechanisms 99.17
PF1396450 Kelch_6: Kelch motif 99.16
PF0134447 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is 99.03
PF1341549 Kelch_3: Galactose oxidase, central domain 98.95
PF0134447 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is 98.92
PF0764649 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is 98.91
PF1341549 Kelch_3: Galactose oxidase, central domain 98.91
PF1341849 Kelch_4: Galactose oxidase, central domain; PDB: 2 98.87
TIGR01640230 F_box_assoc_1 F-box protein interaction domain. Th 98.86
PF0764649 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is 98.83
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 98.79
PF1341849 Kelch_4: Galactose oxidase, central domain; PDB: 2 98.75
smart0061247 Kelch Kelch domain. 98.69
TIGR01640230 F_box_assoc_1 F-box protein interaction domain. Th 98.67
PLN03215373 ascorbic acid mannose pathway regulator 1; Provisi 98.65
smart0061247 Kelch Kelch domain. 98.65
PF1385442 Kelch_5: Kelch motif 98.45
PLN02772 398 guanylate kinase 98.43
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 98.42
PF1385442 Kelch_5: Kelch motif 98.36
PLN02772 398 guanylate kinase 98.36
PF1293747 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 98.32
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 98.0
smart0025641 FBOX A Receptor for Ubiquitination Targets. 97.96
PF0064648 F-box: F-box domain; InterPro: IPR001810 The F-box 97.87
KOG0281499 consensus Beta-TrCP (transducin repeats containing 97.87
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 97.82
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 97.81
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 97.81
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 97.78
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 97.77
PF07893342 DUF1668: Protein of unknown function (DUF1668); In 97.69
PF03089337 RAG2: Recombination activating protein 2; InterPro 97.65
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 97.38
PF07893342 DUF1668: Protein of unknown function (DUF1668); In 97.37
PF03089337 RAG2: Recombination activating protein 2; InterPro 97.1
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 96.97
PF12768281 Rax2: Cortical protein marker for cell polarity 96.64
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 96.37
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 96.34
PF12768281 Rax2: Cortical protein marker for cell polarity 96.31
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 96.25
PRK11028330 6-phosphogluconolactonase; Provisional 96.22
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 96.05
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 95.82
cd00094194 HX Hemopexin-like repeats.; Hemopexin is a heme-bi 95.63
KOG2055514 consensus WD40 repeat protein [General function pr 95.59
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 95.32
KOG0310 487 consensus Conserved WD40 repeat-containing protein 95.2
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 95.17
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 95.16
PF09910339 DUF2139: Uncharacterized protein conserved in arch 95.07
PRK05137435 tolB translocation protein TolB; Provisional 94.96
KOG2055514 consensus WD40 repeat protein [General function pr 94.92
PRK11028330 6-phosphogluconolactonase; Provisional 94.91
PRK04792448 tolB translocation protein TolB; Provisional 94.89
PRK00178430 tolB translocation protein TolB; Provisional 94.81
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 94.78
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 94.67
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 94.42
TIGR03075 527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 94.37
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 94.18
cd00216 488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 94.16
TIGR03075 527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 94.13
PF02191250 OLF: Olfactomedin-like domain; InterPro: IPR003112 93.97
PF08268129 FBA_3: F-box associated domain; InterPro: IPR01318 93.87
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 93.53
smart00284255 OLF Olfactomedin-like domains. 93.36
PRK04922433 tolB translocation protein TolB; Provisional 93.22
KOG0299479 consensus U3 snoRNP-associated protein (contains W 93.17
PLN00181793 protein SPA1-RELATED; Provisional 93.13
COG3386307 Gluconolactonase [Carbohydrate transport and metab 93.04
COG3823262 Glutamine cyclotransferase [Posttranslational modi 93.03
KOG0310 487 consensus Conserved WD40 repeat-containing protein 92.99
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 92.93
PRK00178430 tolB translocation protein TolB; Provisional 92.89
PRK04792448 tolB translocation protein TolB; Provisional 92.74
COG1520370 FOG: WD40-like repeat [Function unknown] 92.72
PF08268129 FBA_3: F-box associated domain; InterPro: IPR01318 92.58
PRK04043419 tolB translocation protein TolB; Provisional 92.41
KOG2997366 consensus F-box protein FBX9 [General function pre 92.26
PLN03215373 ascorbic acid mannose pathway regulator 1; Provisi 92.23
PRK05137435 tolB translocation protein TolB; Provisional 92.22
PLN029191057 haloacid dehalogenase-like hydrolase family protei 92.18
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 92.1
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 91.46
PRK03629429 tolB translocation protein TolB; Provisional 91.42
KOG0316307 consensus Conserved WD40 repeat-containing protein 90.9
KOG0316307 consensus Conserved WD40 repeat-containing protein 90.47
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 90.38
PRK02889427 tolB translocation protein TolB; Provisional 90.03
TIGR03074 764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 90.01
cd00094194 HX Hemopexin-like repeats.; Hemopexin is a heme-bi 89.56
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 89.5
PRK13684334 Ycf48-like protein; Provisional 89.49
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 89.12
PRK04922433 tolB translocation protein TolB; Provisional 89.09
COG1520370 FOG: WD40-like repeat [Function unknown] 88.73
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 88.48
PTZ00421 493 coronin; Provisional 87.77
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 87.76
PF02191250 OLF: Olfactomedin-like domain; InterPro: IPR003112 87.51
KOG0293519 consensus WD40 repeat-containing protein [Function 86.94
KOG2321 703 consensus WD40 repeat protein [General function pr 86.42
PRK03629429 tolB translocation protein TolB; Provisional 85.81
TIGR03074 764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 84.32
PF12217367 End_beta_propel: Catalytic beta propeller domain o 84.17
KOG0289506 consensus mRNA splicing factor [General function p 83.98
KOG0291 893 consensus WD40-repeat-containing subunit of the 18 83.53
KOG0646 476 consensus WD40 repeat protein [General function pr 83.3
smart00284255 OLF Olfactomedin-like domains. 82.74
KOG0266456 consensus WD40 repeat-containing protein [General 81.89
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 81.81
COG4946 668 Uncharacterized protein related to the periplasmic 81.69
PRK01742429 tolB translocation protein TolB; Provisional 80.55
COG4946 668 Uncharacterized protein related to the periplasmic 80.42
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information 
Probab=100.00  E-value=1.1e-43  Score=358.61  Aligned_cols=280  Identities=29%  Similarity=0.437  Sum_probs=244.9

Q ss_pred             CcceeeeccccCccccEEEEeeccceEEEEecCCCcEEeCCCCCCccccccCCceEEEECCEEEEECCCCCCcccceeEE
Q 013929          117 SGELYRLRRLNGVIEHWVYFSCHLLEWEAFDPIRRRWMHLPRMTSNECFMCSDKESLAVGTELLVFGRELTAHHISHVIY  196 (433)
Q Consensus       117 ~~~~~~~gg~~~~~~~~l~~~~~~~~~~~yd~~~~~W~~l~~~p~~~~~~~~~~~~~~~~~~iyv~GG~~~~~~~~~~~~  196 (433)
                      .+.++.+||..+..       ...+.++.|||.++.|..+++||.+|..    .+++++++.||++||++.+....+.++
T Consensus       284 ~~~l~~vGG~~~~~-------~~~~~ve~yd~~~~~w~~~a~m~~~r~~----~~~~~~~~~lYv~GG~~~~~~~l~~ve  352 (571)
T KOG4441|consen  284 SGKLVAVGGYNRQG-------QSLRSVECYDPKTNEWSSLAPMPSPRCR----VGVAVLNGKLYVVGGYDSGSDRLSSVE  352 (571)
T ss_pred             CCeEEEECCCCCCC-------cccceeEEecCCcCcEeecCCCCccccc----ccEEEECCEEEEEccccCCCcccceEE
Confidence            46688888887622       1357889999999999999999999864    457889999999999975555778999


Q ss_pred             EEEcCCCceecCCCCCCCcceeeEEEeCCEEEEEccCCCCCCcCCceEEEeCCCCCeEEcCCCCCCCcceeEEEECCEEE
Q 013929          197 RYSILTNSWSSGMRMNAPRCLFGSASLGEIAILAGGSDLEGNILSSAEMYNSETQTWKVLPSMKNPRKMCSGVFMDGKFY  276 (433)
Q Consensus       197 ~yd~~t~~W~~~~~~p~~r~~~~~~~~~~~iyv~GG~~~~~~~~~~~~~yd~~t~~W~~~~~~p~~r~~~~~~~~~g~ly  276 (433)
                      +|||.+++|+.+++|+.+|..+++++++|.||++||+++. ..+.++++|||.+++|+.+++|+.+|.++++++++|+||
T Consensus       353 ~YD~~~~~W~~~a~M~~~R~~~~v~~l~g~iYavGG~dg~-~~l~svE~YDp~~~~W~~va~m~~~r~~~gv~~~~g~iY  431 (571)
T KOG4441|consen  353 RYDPRTNQWTPVAPMNTKRSDFGVAVLDGKLYAVGGFDGE-KSLNSVECYDPVTNKWTPVAPMLTRRSGHGVAVLGGKLY  431 (571)
T ss_pred             EecCCCCceeccCCccCccccceeEEECCEEEEEeccccc-cccccEEEecCCCCcccccCCCCcceeeeEEEEECCEEE
Confidence            9999999999999999999999999999999999999976 578999999999999999999999999999999999999


Q ss_pred             EEccccCCCCcccceEEEEECCCCceEecCCCCCCCCCCCCCCcCCCCcCCCCEEEEECCEEEEEecCC-----CeEEEE
Q 013929          277 VIGGIGGSDSKVLTCGEEYDLETETWTEIPNMSPARGGAARGTEMPASAEAPPLVAVVNNELYAADYAD-----MEVRKY  351 (433)
Q Consensus       277 v~GG~~~~~~~~~~~v~~yd~~t~~W~~~~~~p~~r~~~~~~~~~~~~~~~~~~~~~~~~~ly~~gg~~-----~~i~~y  351 (433)
                      ++||.++.. ..++++++|||.+++|+.+++|+.+|.++              ++++.+++||++||..     ..+++|
T Consensus       432 i~GG~~~~~-~~l~sve~YDP~t~~W~~~~~M~~~R~~~--------------g~a~~~~~iYvvGG~~~~~~~~~VE~y  496 (571)
T KOG4441|consen  432 IIGGGDGSS-NCLNSVECYDPETNTWTLIAPMNTRRSGF--------------GVAVLNGKIYVVGGFDGTSALSSVERY  496 (571)
T ss_pred             EEcCcCCCc-cccceEEEEcCCCCceeecCCcccccccc--------------eEEEECCEEEEECCccCCCccceEEEE
Confidence            999998543 38899999999999999999999999997              7999999999999854     468999


Q ss_pred             eCCCCcEEEeccCCCcccCCCcccEEEEEeCCEEEEEcCCCCCCCCeeEEEEeecCCCCCCceEecccCCCcEEEEEEEe
Q 013929          352 DKERRLWFTIGRLPERANSMNGWGLAFRACGDRLIVIGGPKASGEGFIELNSWVPSEGPPQWNLLARKQSANFVYNCAVM  431 (433)
Q Consensus       352 d~~~~~W~~v~~lp~~~~~~~~~~~~~~~~~~~l~v~GG~~~~~~~~~~~~~~~~~~~~~~W~~v~~~p~~~~~~~~~v~  431 (433)
                      |+.+++|+.+.+|+.++..     +++++.+++||++||+++. .....+.+|++  .+++|+.+.++...+...+|+++
T Consensus       497 dp~~~~W~~v~~m~~~rs~-----~g~~~~~~~ly~vGG~~~~-~~l~~ve~ydp--~~d~W~~~~~~~~~~~~~~~~~~  568 (571)
T KOG4441|consen  497 DPETNQWTMVAPMTSPRSA-----VGVVVLGGKLYAVGGFDGN-NNLNTVECYDP--ETDTWTEVTEPESGRGGAGVAVI  568 (571)
T ss_pred             cCCCCceeEcccCcccccc-----ccEEEECCEEEEEecccCc-cccceeEEcCC--CCCceeeCCCccccccCcceEEe
Confidence            9999999999999998863     6788999999999997655 46677887765  78999999995556665555554

>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>KOG4693 consensus Uncharacterized conserved protein, contains kelch repeat [General function prediction only] Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>KOG4693 consensus Uncharacterized conserved protein, contains kelch repeat [General function prediction only] Back     alignment and domain information
>KOG1230 consensus Protein containing repeated kelch motifs [General function prediction only] Back     alignment and domain information
>KOG0379 consensus Kelch repeat-containing proteins [General function prediction only] Back     alignment and domain information
>KOG0379 consensus Kelch repeat-containing proteins [General function prediction only] Back     alignment and domain information
>KOG4152 consensus Host cell transcription factor HCFC1 [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG1230 consensus Protein containing repeated kelch motifs [General function prediction only] Back     alignment and domain information
>KOG4152 consensus Host cell transcription factor HCFC1 [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>COG3055 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG3055 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13964 Kelch_6: Kelch motif Back     alignment and domain information
>KOG2437 consensus Muskelin [Signal transduction mechanisms] Back     alignment and domain information
>KOG2437 consensus Muskelin [Signal transduction mechanisms] Back     alignment and domain information
>PF13964 Kelch_6: Kelch motif Back     alignment and domain information
>PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF13415 Kelch_3: Galactose oxidase, central domain Back     alignment and domain information
>PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF13415 Kelch_3: Galactose oxidase, central domain Back     alignment and domain information
>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B Back     alignment and domain information
>TIGR01640 F_box_assoc_1 F-box protein interaction domain Back     alignment and domain information
>PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B Back     alignment and domain information
>smart00612 Kelch Kelch domain Back     alignment and domain information
>TIGR01640 F_box_assoc_1 F-box protein interaction domain Back     alignment and domain information
>PLN03215 ascorbic acid mannose pathway regulator 1; Provisional Back     alignment and domain information
>smart00612 Kelch Kelch domain Back     alignment and domain information
>PF13854 Kelch_5: Kelch motif Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>PF13854 Kelch_5: Kelch motif Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>PF12937 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 2OVQ_B 1FS1_A 1FS2_C 1FQV_I 1LDK_E 2AST_B 2ASS_B Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>smart00256 FBOX A Receptor for Ubiquitination Targets Back     alignment and domain information
>PF00646 F-box: F-box domain; InterPro: IPR001810 The F-box domain was first described as a sequence motif found in cyclin-F that interacts with the protein SKP1 [, ] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function Back     alignment and domain information
>PF03089 RAG2: Recombination activating protein 2; InterPro: IPR004321 The variable portion of the genes encoding immunoglobulins and T cell receptors are assembled from component V, D, and J DNA segments by a site-specific recombination reaction termed V(D)J recombination Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function Back     alignment and domain information
>PF03089 RAG2: Recombination activating protein 2; InterPro: IPR004321 The variable portion of the genes encoding immunoglobulins and T cell receptors are assembled from component V, D, and J DNA segments by a site-specific recombination reaction termed V(D)J recombination Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>cd00094 HX Hemopexin-like repeats Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>PF09910 DUF2139: Uncharacterized protein conserved in archaea (DUF2139); InterPro: IPR016675 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>PF02191 OLF: Olfactomedin-like domain; InterPro: IPR003112 The olfactomedin-domain was first identified in olfactomedin, an extracellular matrix protein of the olfactory neuroepithelium [] Back     alignment and domain information
>PF08268 FBA_3: F-box associated domain; InterPro: IPR013187 This domain occurs in a diverse superfamily of genes in plants Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>smart00284 OLF Olfactomedin-like domains Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG3823 Glutamine cyclotransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG1520 FOG: WD40-like repeat [Function unknown] Back     alignment and domain information
>PF08268 FBA_3: F-box associated domain; InterPro: IPR013187 This domain occurs in a diverse superfamily of genes in plants Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2997 consensus F-box protein FBX9 [General function prediction only] Back     alignment and domain information
>PLN03215 ascorbic acid mannose pathway regulator 1; Provisional Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>cd00094 HX Hemopexin-like repeats Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG1520 FOG: WD40-like repeat [Function unknown] Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF02191 OLF: Olfactomedin-like domain; InterPro: IPR003112 The olfactomedin-domain was first identified in olfactomedin, an extracellular matrix protein of the olfactory neuroepithelium [] Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>PF12217 End_beta_propel: Catalytic beta propeller domain of bacteriophage endosialidase; InterPro: IPR024428 This entry represents the beta propeller domain of endosialidases, which consists of catalytically active part of the enzymes Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>smart00284 OLF Olfactomedin-like domains Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query433
2vpj_A301 Crystal Structure Of The Kelch Domain Of Human Klhl 5e-10
3ii7_A306 Crystal Structure Of The Kelch Domain Of Human Klhl 1e-09
1x2j_A316 Structural Basis For The Defects Of Human Lung Canc 2e-09
3vng_A309 Crystal Structure Of Keap1 In Complex With Syntheti 2e-09
2dyh_A318 Crystal Structure Of The Keap1 Protein In Complexed 2e-09
1u6d_X308 Crystal Structure Of The Kelch Domain Of Human Keap 2e-09
1u6d_X308 Crystal Structure Of The Kelch Domain Of Human Keap 4e-04
2xn4_A302 Crystal Structure Of The Kelch Domain Of Human Klhl 7e-08
1zgk_A308 1.35 Angstrom Structure Of The Kelch Domain Of Keap 2e-07
2woz_A318 The Novel Beta-Propeller Of The Btb-Kelch Protein K 1e-06
2eid_A 639 Galactose Oxidase W290g Mutant Length = 639 7e-04
4asc_A315 Crystal Structure Of The Kelch Domain Of Human Kbtb 8e-04
>pdb|2VPJ|A Chain A, Crystal Structure Of The Kelch Domain Of Human Klhl12 Length = 301 Back     alignment and structure 
Iteration: 1

 Score = 62.4 bits (150), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 58/225 (25%), Positives = 93/225 (41%), Gaps = 28/225 (12%)
Query: 144 EAFDPIRRRWMHLPRMTSNECFMCSDKESLAVGTELLVFGRELTAHHISHV-IYRYSILT 202
           E +DP  + W  LP +T    ++ S    +++   + V G       +S V    Y+   
Sbjct: 34  EKYDPKTQEWSFLPSITRKRRYVAS----VSLHDRIYVIGGYDGRSRLSSVECLDYTADE 89
Query: 203 NS-WSSGMRMNAPRCLFGSASLGEIAILAGGSDLEGNILSSAEMYNSETQTWKVLPSMKN 261
           +  W S   MN  R L G+ +LG++  ++GG D      +S E Y+     W +L  M+ 
Sbjct: 90  DGVWYSVAPMNVRRGLAGATTLGDMIYVSGGFD-GSRRHTSMERYDPNIDQWSMLGDMQT 148
Query: 262 PRKMCSGVFMDGKFYVIGGIGGSDSKVLTCGEEYDLETETWTEIPNMSPARGGAARGTEM 321
            R+    V   G  Y +GG  G +  +L   E+YD  T  WT +  M+  R GA      
Sbjct: 149 AREGAGLVVASGVIYCLGGYDGLN--ILNSVEKYDPHTGHWTNVTPMATKRSGAG----- 201
Query: 322 PASAEAPPLVAVVNNELYAADYAD-----MEVRKYDKERRLWFTI 361
                    VA++N+ +Y     D       V  Y+     W T+
Sbjct: 202 ---------VALLNDHIYVVGGFDGTAHLSSVEAYNIRTDSWTTV 237
>pdb|3II7|A Chain A, Crystal Structure Of The Kelch Domain Of Human Klhl7 Length = 306 Back     alignment and structure
>pdb|1X2J|A Chain A, Structural Basis For The Defects Of Human Lung Cancer Somatic Mutations In The Repression Activity Of Keap1 On Nrf2 Length = 316 Back     alignment and structure
>pdb|3VNG|A Chain A, Crystal Structure Of Keap1 In Complex With Synthetic Small Molecular Based On A Co-crystallization Length = 309 Back     alignment and structure
>pdb|2DYH|A Chain A, Crystal Structure Of The Keap1 Protein In Complexed With The N-Terminal Region Of The Nrf2 Transcription Factor Length = 318 Back     alignment and structure
>pdb|1U6D|X Chain X, Crystal Structure Of The Kelch Domain Of Human Keap1 Length = 308 Back     alignment and structure
>pdb|1U6D|X Chain X, Crystal Structure Of The Kelch Domain Of Human Keap1 Length = 308 Back     alignment and structure
>pdb|2XN4|A Chain A, Crystal Structure Of The Kelch Domain Of Human Klhl2 (mayven) Length = 302 Back     alignment and structure
>pdb|1ZGK|A Chain A, 1.35 Angstrom Structure Of The Kelch Domain Of Keap1 Length = 308 Back     alignment and structure
>pdb|2WOZ|A Chain A, The Novel Beta-Propeller Of The Btb-Kelch Protein Krp1 Provides The Binding Site For Lasp-1 That Is Necessary For Pseudopodia Extension Length = 318 Back     alignment and structure
>pdb|2EID|A Chain A, Galactose Oxidase W290g Mutant Length = 639 Back     alignment and structure
>pdb|4ASC|A Chain A, Crystal Structure Of The Kelch Domain Of Human Kbtbd5 Length = 315 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query433
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 3e-41
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 2e-32
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 8e-28
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 1e-25
2xn4_A 302 Kelch-like protein 2; structural protein, cytoskel 4e-11
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 1e-39
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 1e-30
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 7e-29
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 3e-25
1zgk_A 308 Kelch-like ECH-associated protein 1; beta-propelle 6e-05
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 3e-39
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 4e-30
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 8e-28
3ii7_A 306 Kelch-like protein 7; protein-binding, kelch-repea 6e-24
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 4e-16
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 6e-38
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 5e-30
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 2e-28
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 3e-25
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 5e-36
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 4e-27
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 5e-27
2woz_A 318 Kelch repeat and BTB domain-containing protein 10; 1e-18
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 1e-11
2woz_A 318 Kelch repeat and BTB domain-containing protein 10; 1e-08
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 2e-35
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 6e-34
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 2e-25
4asc_A 315 Kelch repeat and BTB domain-containing protein 5; 2e-18
4asc_A 315 Kelch repeat and BTB domain-containing protein 5; 7e-09
2uvk_A 357 YJHT; unknown function, hypothetical protein, sial 2e-19
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 7e-17
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 9e-15
2uvk_A 357 YJHT; unknown function, hypothetical protein, sial 4e-11
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 2e-04
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 7e-17
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 2e-13
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 1e-15
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 6e-09
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 8e-04
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
 Score =  147 bits (373), Expect = 3e-41
 Identities = 63/253 (24%), Positives = 91/253 (35%), Gaps = 32/253 (12%)

Query: 144 EAFDPIRRRWMHLPRMTSNECFMCSDKESLAVGTELLVFGRELTAHHISHVIYRYSILTN 203
           E +D    RW  +  + S  C        + +   +   G    +  +  V   Y  + +
Sbjct: 33  ECYDFKEERWHQVAELPSRRCRAGM----VYMAGLVFAVGGFNGSLRVRTV-DSYDPVKD 87

Query: 204 SWSSGMRMNAPRCLFGSASLGEIAILAGGSDLEGNILSSAEMYNSETQTWKVLPSMKNPR 263
            W+S   M   R   G+A L  +    GG D     LSS E YN ++  W  +  M   R
Sbjct: 88  QWTSVANMRDRRSTLGAAVLNGLLYAVGGFD-GSTGLSSVEAYNIKSNEWFHVAPMNTRR 146

Query: 264 KMCSGVFMDGKFYVIGGIGGSDSKVLTCGEEYDLETETWTEIPNMSPARGGAARGTEMPA 323
                  + G  Y +GG   +  + L+  E Y+  T  WT I  MS  R GA        
Sbjct: 147 SSVGVGVVGGLLYAVGGYDVASRQCLSTVECYNATTNEWTYIAEMSTRRSGAG------- 199

Query: 324 SAEAPPLVAVVNNELYAA----DYADM-EVRKYDKERRLWFTIGRLPE-RANSMNGWGLA 377
                  V V+NN LYA            V  YD     W  +  +   R N+    G+ 
Sbjct: 200 -------VGVLNNLLYAVGGHDGPLVRKSVEVYDPTTNAWRQVADMNMCRRNA----GVC 248

Query: 378 FRACGDRLIVIGG 390
             A    L V+GG
Sbjct: 249 --AVNGLLYVVGG 259
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Length = 656 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Length = 656 Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query433
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 100.0
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 100.0
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 100.0
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 100.0
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 100.0
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 100.0
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 100.0
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 100.0
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 100.0
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 100.0
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 100.0
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 100.0
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 100.0
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 100.0
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 100.0
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 100.0
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 100.0
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 99.97
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 99.02
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 98.87
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 98.83
1fs1_A53 SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L 98.59
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 98.41
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 98.34
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 98.11
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 98.11
2e31_A297 FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui 98.08
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 98.07
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 98.02
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 97.99
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 97.78
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 97.73
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 97.69
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 97.54
3jrp_A379 Fusion protein of protein transport protein SEC13 97.47
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 97.44
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 97.38
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 97.38
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 97.37
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 97.27
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 97.23
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 97.22
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 97.21
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 97.17
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 97.16
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 97.16
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 97.14
3jrp_A 379 Fusion protein of protein transport protein SEC13 97.13
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 97.12
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 97.08
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 97.07
4g56_B357 MGC81050 protein; protein arginine methyltransfera 97.02
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 96.95
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 96.95
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 96.92
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 96.91
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 96.9
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 96.87
2p4o_A306 Hypothetical protein; putative lactonase, structur 96.86
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 96.85
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 96.85
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 96.83
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 96.78
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 96.77
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 96.77
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 96.75
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 96.74
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 96.73
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 96.73
3v9f_A781 Two-component system sensor histidine kinase/RESP 96.73
3v65_B386 Low-density lipoprotein receptor-related protein; 96.67
2pm7_B297 Protein transport protein SEC13, protein transport 96.65
3ow8_A321 WD repeat-containing protein 61; structural genomi 96.63
3jro_A 753 Fusion protein of protein transport protein SEC13 96.62
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 96.56
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 96.55
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 96.53
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 96.53
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 96.51
4a2l_A 795 BT_4663, two-component system sensor histidine kin 96.51
3jro_A 753 Fusion protein of protein transport protein SEC13 96.48
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 96.46
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 96.43
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.42
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 96.4
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 96.38
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 96.36
3ow8_A321 WD repeat-containing protein 61; structural genomi 96.35
2pm7_B297 Protein transport protein SEC13, protein transport 96.32
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 96.3
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 96.29
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 96.29
3hfq_A 347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 96.28
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 96.27
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 96.23
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 96.21
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 96.18
2ad6_A 571 Methanol dehydrogenase subunit 1; PQQ configuratio 96.15
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 96.13
3l2o_B312 F-box only protein 4; small G protein fold, UBL co 96.11
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 96.11
3p5b_L400 Low density lipoprotein receptor variant; B-propel 96.1
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 96.09
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 96.04
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 95.99
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 95.99
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 95.99
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 95.96
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 95.94
1nir_A 543 Nitrite reductase; hemoprotein, denitrification, d 95.92
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 95.91
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 95.87
3dwl_C 377 Actin-related protein 2/3 complex subunit 1; prope 95.86
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 95.86
3v9f_A 781 Two-component system sensor histidine kinase/RESP 95.85
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 95.83
1w6s_A 599 Methanol dehydrogenase subunit 1; anisotropic, ele 95.82
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 95.82
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 95.82
2vdu_B 450 TRNA (guanine-N(7)-)-methyltransferase- associated 95.81
2fp8_A322 Strictosidine synthase; six bladed beta propeller 95.81
2fp8_A322 Strictosidine synthase; six bladed beta propeller 95.8
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 95.79
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 95.78
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 95.77
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 95.77
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 95.71
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 95.7
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 95.7
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 95.7
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 95.7
4a2l_A 795 BT_4663, two-component system sensor histidine kin 95.69
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 95.68
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 95.67
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 95.64
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 95.63
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 95.57
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 95.57
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 95.56
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 95.53
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 95.51
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 95.48
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 95.42
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 95.36
1w6s_A 599 Methanol dehydrogenase subunit 1; anisotropic, ele 95.35
3v65_B386 Low-density lipoprotein receptor-related protein; 95.35
3ott_A758 Two-component system sensor histidine kinase; beta 95.28
1qks_A 567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 95.26
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 95.25
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 95.25
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 95.17
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 95.14
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 95.12
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 95.06
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 95.03
4g56_B357 MGC81050 protein; protein arginine methyltransfera 94.92
2ad6_A 571 Methanol dehydrogenase subunit 1; PQQ configuratio 94.92
3ei3_B 383 DNA damage-binding protein 2; UV-damage, DDB, nucl 94.91
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 94.9
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 94.89
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 94.87
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 94.79
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 94.78
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 94.73
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 94.7
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 94.61
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 94.56
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 94.55
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 94.53
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 94.53
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 94.49
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 94.49
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 94.48
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 94.44
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 94.43
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 94.39
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 94.38
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 94.38
1pex_A207 Collagenase-3, MMP-13; C-terminal hemopexin-like d 94.35
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 94.34
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 94.27
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 94.23
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 94.21
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 94.05
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 94.03
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 94.0
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 93.97
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 93.96
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 93.95
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 93.93
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 93.9
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 93.82
4e54_B435 DNA damage-binding protein 2; beta barrel, double 93.6
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 93.52
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 93.5
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 93.24
4e54_B 435 DNA damage-binding protein 2; beta barrel, double 93.22
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 93.19
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 93.19
3mmy_A 368 MRNA export factor; mRNA export, nuclear protein; 93.14
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 93.05
2ymu_A577 WD-40 repeat protein; unknown function, two domain 93.0
2hz6_A 369 Endoplasmic reticulum to nucleus signalling 1 isof 92.99
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 92.97
1flg_A 582 Protein (quinoprotein ethanol dehydrogenase); supe 92.94
2ymu_A577 WD-40 repeat protein; unknown function, two domain 92.92
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 92.86
1qhu_A460 Protein (hemopexin); beta propeller, HAEM binding 92.79
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 92.77
2p4o_A306 Hypothetical protein; putative lactonase, structur 92.74
1flg_A 582 Protein (quinoprotein ethanol dehydrogenase); supe 92.66
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 92.64
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 92.62
1qhu_A460 Protein (hemopexin); beta propeller, HAEM binding 92.49
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 92.48
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 92.29
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 91.92
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 91.72
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 91.71
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 91.44
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 91.36
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 91.16
3c7x_A196 Matrix metalloproteinase-14; membrane protein inte 91.12
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 91.09
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 91.01
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 90.55
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 90.53
3ott_A 758 Two-component system sensor histidine kinase; beta 90.38
3oyo_A225 Hemopexin fold protein CP4; seeds, plant protein; 90.34
2xyi_A430 Probable histone-binding protein CAF1; transcripti 90.31
2qe8_A343 Uncharacterized protein; structural genomics, join 90.28
3ba0_A365 Macrophage metalloelastase; FULL-length MMP-12, he 90.04
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 89.99
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 89.98
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 89.94
1su3_A450 Interstitial collagenase; prodomain, hemopexin dom 89.83
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 89.66
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 89.65
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 89.22
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 89.21
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 89.07
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 88.89
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 88.77
1itv_A195 MMP9; adaptive molecular recognition, beta propell 88.69
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 88.26
3p5b_L400 Low density lipoprotein receptor variant; B-propel 88.19
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 88.04
4gga_A 420 P55CDC, cell division cycle protein 20 homolog; ce 88.04
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 88.01
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 87.9
2ece_A462 462AA long hypothetical selenium-binding protein; 87.9
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 87.77
1pby_B 337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 87.61
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 87.57
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 87.32
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 87.01
2hz6_A 369 Endoplasmic reticulum to nucleus signalling 1 isof 86.86
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 86.62
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 86.5
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 86.44
3b7f_A394 Glycosyl hydrolase, BNR repeat; 7-bladed beta-prop 86.3
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 86.14
3ju4_A 670 Endo-N-acetylneuraminidase; endonf, polysia, high- 85.7
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 85.05
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 84.91
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 84.9
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 84.02
4ggc_A 318 P55CDC, cell division cycle protein 20 homolog; ce 83.92
2xyi_A430 Probable histone-binding protein CAF1; transcripti 83.82
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 83.7
3kya_A496 Putative phosphatase; structural genomics, joint c 83.7
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 83.27
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 82.98
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 82.44
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 82.3
3b7f_A394 Glycosyl hydrolase, BNR repeat; 7-bladed beta-prop 82.21
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 82.04
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 82.01
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 81.31
1hxn_A219 Hemopexin, HPX; heme, binding protein; 1.80A {Oryc 81.15
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 81.14
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 81.08
3oyo_A225 Hemopexin fold protein CP4; seeds, plant protein; 81.05
3lp9_A227 LS-24; SEED albumin, plant protein; HET: SPM; 2.20 80.99
1k32_A 1045 Tricorn protease; protein degradation, substrate g 80.73
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 80.59
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
Probab=100.00  E-value=3e-45  Score=347.82  Aligned_cols=281  Identities=24%  Similarity=0.354  Sum_probs=243.5

Q ss_pred             HhhcCcceeeeccccCccccEEEEeeccceEEEEecCCCcEEeCCCCCCccccccCCceEEEECCEEEEECCCC---CCc
Q 013929          113 SLIRSGELYRLRRLNGVIEHWVYFSCHLLEWEAFDPIRRRWMHLPRMTSNECFMCSDKESLAVGTELLVFGREL---TAH  189 (433)
Q Consensus       113 ~ll~~~~~~~~gg~~~~~~~~l~~~~~~~~~~~yd~~~~~W~~l~~~p~~~~~~~~~~~~~~~~~~iyv~GG~~---~~~  189 (433)
                      ++..++.+|++||..+.         ..+++++||+.+++|..++++|.+|..    +++++++++||++||..   ...
T Consensus        20 ~~~~~~~i~v~GG~~~~---------~~~~~~~~d~~~~~W~~~~~~p~~r~~----~~~~~~~~~lyv~GG~~~~~~~~   86 (308)
T 1zgk_A           20 APKVGRLIYTAGGYFRQ---------SLSYLEAYNPSNGTWLRLADLQVPRSG----LAGCVVGGLLYAVGGRNNSPDGN   86 (308)
T ss_dssp             -CCCCCCEEEECCBSSS---------BCCCEEEEETTTTEEEECCCCSSCCBS----CEEEEETTEEEEECCEEEETTEE
T ss_pred             ccCCCCEEEEEeCcCCC---------CcceEEEEcCCCCeEeECCCCCccccc----ceEEEECCEEEEECCCcCCCCCC
Confidence            35678999999998332         367899999999999999999998854    45678899999999983   333


Q ss_pred             ccceeEEEEEcCCCceecCCCCCCCcceeeEEEeCCEEEEEccCCCCCCcCCceEEEeCCCCCeEEcCCCCCCCcceeEE
Q 013929          190 HISHVIYRYSILTNSWSSGMRMNAPRCLFGSASLGEIAILAGGSDLEGNILSSAEMYNSETQTWKVLPSMKNPRKMCSGV  269 (433)
Q Consensus       190 ~~~~~~~~yd~~t~~W~~~~~~p~~r~~~~~~~~~~~iyv~GG~~~~~~~~~~~~~yd~~t~~W~~~~~~p~~r~~~~~~  269 (433)
                      ...+++++||+.+++|++++++|.+|..|++++++++|||+||.+.. ..++++++||+.+++|+.++++|.+|..++++
T Consensus        87 ~~~~~~~~~d~~~~~W~~~~~~p~~r~~~~~~~~~~~iyv~GG~~~~-~~~~~~~~yd~~~~~W~~~~~~p~~r~~~~~~  165 (308)
T 1zgk_A           87 TDSSALDCYNPMTNQWSPCAPMSVPRNRIGVGVIDGHIYAVGGSHGC-IHHNSVERYEPERDEWHLVAPMLTRRIGVGVA  165 (308)
T ss_dssp             EECCCEEEEETTTTEEEECCCCSSCCBTCEEEEETTEEEEECCEETT-EECCCEEEEETTTTEEEECCCCSSCCBSCEEE
T ss_pred             eecceEEEECCCCCeEeECCCCCcCccccEEEEECCEEEEEcCCCCC-cccccEEEECCCCCeEeECCCCCccccceEEE
Confidence            46678999999999999999999999999999999999999998764 45789999999999999999999999999999


Q ss_pred             EECCEEEEEccccCCCCcccceEEEEECCCCceEecCCCCCCCCCCCCCCcCCCCcCCCCEEEEECCEEEEEecC-----
Q 013929          270 FMDGKFYVIGGIGGSDSKVLTCGEEYDLETETWTEIPNMSPARGGAARGTEMPASAEAPPLVAVVNNELYAADYA-----  344 (433)
Q Consensus       270 ~~~g~lyv~GG~~~~~~~~~~~v~~yd~~t~~W~~~~~~p~~r~~~~~~~~~~~~~~~~~~~~~~~~~ly~~gg~-----  344 (433)
                      +++++||++||.++.  ..++++++||+.+++|+.++++|.+|..+              ++++++++||++||.     
T Consensus       166 ~~~~~iyv~GG~~~~--~~~~~~~~yd~~~~~W~~~~~~p~~r~~~--------------~~~~~~~~iyv~GG~~~~~~  229 (308)
T 1zgk_A          166 VLNRLLYAVGGFDGT--NRLNSAECYYPERNEWRMITAMNTIRSGA--------------GVCVLHNCIYAAGGYDGQDQ  229 (308)
T ss_dssp             EETTEEEEECCBCSS--CBCCCEEEEETTTTEEEECCCCSSCCBSC--------------EEEEETTEEEEECCBCSSSB
T ss_pred             EECCEEEEEeCCCCC--CcCceEEEEeCCCCeEeeCCCCCCccccc--------------eEEEECCEEEEEeCCCCCCc
Confidence            999999999998743  34788999999999999999999999987              788999999999985     


Q ss_pred             CCeEEEEeCCCCcEEEeccCCCcccCCCcccEEEEEeCCEEEEEcCCCCCCCCeeEEEEeecCCCCCCceEecccCCCcE
Q 013929          345 DMEVRKYDKERRLWFTIGRLPERANSMNGWGLAFRACGDRLIVIGGPKASGEGFIELNSWVPSEGPPQWNLLARKQSANF  424 (433)
Q Consensus       345 ~~~i~~yd~~~~~W~~v~~lp~~~~~~~~~~~~~~~~~~~l~v~GG~~~~~~~~~~~~~~~~~~~~~~W~~v~~~p~~~~  424 (433)
                      .+++++||+++++|+++.++|.++.     +++++.++++|||+||.... .....+.+|  |+.+++|+.+++||.+|.
T Consensus       230 ~~~v~~yd~~~~~W~~~~~~p~~r~-----~~~~~~~~~~i~v~GG~~~~-~~~~~v~~y--d~~~~~W~~~~~~p~~r~  301 (308)
T 1zgk_A          230 LNSVERYDVETETWTFVAPMKHRRS-----ALGITVHQGRIYVLGGYDGH-TFLDSVECY--DPDTDTWSEVTRMTSGRS  301 (308)
T ss_dssp             CCCEEEEETTTTEEEECCCCSSCCB-----SCEEEEETTEEEEECCBCSS-CBCCEEEEE--ETTTTEEEEEEECSSCCB
T ss_pred             cceEEEEeCCCCcEEECCCCCCCcc-----ceEEEEECCEEEEEcCcCCC-cccceEEEE--cCCCCEEeecCCCCCCcc
Confidence            3789999999999999999998875     36777889999999998653 233445545  447899999999999999


Q ss_pred             EEEEEEe
Q 013929          425 VYNCAVM  431 (433)
Q Consensus       425 ~~~~~v~  431 (433)
                      .|+++++
T Consensus       302 ~~~~~~l  308 (308)
T 1zgk_A          302 GVGVAVT  308 (308)
T ss_dssp             SCEEEEC
T ss_pred             cceeEeC
Confidence            9999985
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>1pex_A Collagenase-3, MMP-13; C-terminal hemopexin-like domain of matrix- metalloproteinase, metalloprotease; 2.70A {Homo sapiens} SCOP: b.66.1.1 Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>1qhu_A Protein (hemopexin); beta propeller, HAEM binding and transport, iron metabolism, binding protein; HET: HEM; 2.30A {Oryctolagus cuniculus} SCOP: b.66.1.1 b.66.1.1 PDB: 1qjs_A* Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1qhu_A Protein (hemopexin); beta propeller, HAEM binding and transport, iron metabolism, binding protein; HET: HEM; 2.30A {Oryctolagus cuniculus} SCOP: b.66.1.1 b.66.1.1 PDB: 1qjs_A* Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3c7x_A Matrix metalloproteinase-14; membrane protein interaction, Pro-MMP-2, TIMP-2, metastasis, calcium, cleavage on PAIR of basic residues, hydrolase; 1.70A {Homo sapiens} Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>3oyo_A Hemopexin fold protein CP4; seeds, plant protein; 2.10A {Vigna unguiculata} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3ba0_A Macrophage metalloelastase; FULL-length MMP-12, hemopexin domain, catalytic domain, domain interaction., calcium, extracellular matrix; 3.00A {Homo sapiens} PDB: 2jxy_A Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>1su3_A Interstitial collagenase; prodomain, hemopexin domain, exocite, structural proteomics in europe, spine, structural genomics, hydrolase; HET: EPE; 2.20A {Homo sapiens} SCOP: a.20.1.2 b.66.1.1 d.92.1.11 PDB: 2clt_A 1fbl_A* Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>1itv_A MMP9; adaptive molecular recognition, beta propeller, dimer, hydrolase; 1.95A {Homo sapiens} SCOP: b.66.1.1 Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3b7f_A Glycosyl hydrolase, BNR repeat; 7-bladed beta-propeller fold, structural genomics, joint CEN structural genomics, JCSG; 2.20A {Ralstonia eutropha} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3ju4_A Endo-N-acetylneuraminidase; endonf, polysia, high-resolution, glycosidase, hydrolase; HET: SLB; 0.98A {Enterobacteria phage K1F} PDB: 3gvl_A* 3gvj_A* 3gvk_A* 1v0e_A 1v0f_A* Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>3b7f_A Glycosyl hydrolase, BNR repeat; 7-bladed beta-propeller fold, structural genomics, joint CEN structural genomics, JCSG; 2.20A {Ralstonia eutropha} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1hxn_A Hemopexin, HPX; heme, binding protein; 1.80A {Oryctolagus cuniculus} SCOP: b.66.1.1 Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>3oyo_A Hemopexin fold protein CP4; seeds, plant protein; 2.10A {Vigna unguiculata} Back     alignment and structure
>3lp9_A LS-24; SEED albumin, plant protein; HET: SPM; 2.20A {Lathyrus sativus} PDB: 3s0l_A 3v6n_A 4hsd_A 3s18_A Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 433
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 8e-14
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 9e-09
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 9e-07
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 2e-04
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 4e-04
d1zgka1 288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 6e-04
d1k3ia3387 b.69.1.1 (A:151-537) Galactose oxidase, central do 9e-12
d1k3ia3387 b.69.1.1 (A:151-537) Galactose oxidase, central do 8e-10
d1k3ia3387 b.69.1.1 (A:151-537) Galactose oxidase, central do 1e-07
d1k3ia3387 b.69.1.1 (A:151-537) Galactose oxidase, central do 2e-07
d1k3ia3 387 b.69.1.1 (A:151-537) Galactose oxidase, central do 4e-07
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure

class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: Kelch motif
family: Kelch motif
domain: Kelch-like ECH-associated protein 1, KEAP1
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 69.2 bits (167), Expect = 8e-14
 Identities = 45/191 (23%), Positives = 65/191 (34%), Gaps = 12/191 (6%)

Query: 126 LNGVIEHWVYFSCHLLEWEAFDPIRRRWMHLPRMTSNECFMCSDKESLAVGTELLVFGRE 185
             G     ++ +         D        L R       + +       G         
Sbjct: 106 AVGGSHGCIHHNSVERYEPERDEWHLVAPMLTRRIGVGVAVLNRLLYAVGGF-------- 157

Query: 186 LTAHHISHVIYRYSILTNSWSSGMRMNAPRCLFGSASLGEIAILAGGSDLEGNILSSAEM 245
               +  +    Y    N W     MN  R   G   L      AGG D +   L+S E 
Sbjct: 158 -DGTNRLNSAECYYPERNEWRMITAMNTIRSGAGVCVLHNCIYAAGGYDGQDQ-LNSVER 215

Query: 246 YNSETQTWKVLPSMKNPRKMCSGVFMDGKFYVIGGIGGSDSKVLTCGEEYDLETETWTEI 305
           Y+ ET+TW  +  MK+ R         G+ YV+GG  G     L   E YD +T+TW+E+
Sbjct: 216 YDVETETWTFVAPMKHRRSALGITVHQGRIYVLGGYDGH--TFLDSVECYDPDTDTWSEV 273

Query: 306 PNMSPARGGAA 316
             M+  R G  
Sbjct: 274 TRMTSGRSGVG 284
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query433
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 100.0
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 100.0
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 99.96
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 99.95
d1fs1a141 Skp2 {Human (Homo sapiens) [TaxId: 9606]} 98.7
d2ovrb1102 F-box/WD repeat-containing protein 7, FBXW7 {Human 97.79
d1nexb1100 Cdc4 F-box and linker domains {Baker's yeast (Sacc 97.47
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 97.2
d1p22a1118 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 97.18
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 96.98
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 96.79
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 96.48
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 96.46
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 96.43
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 96.21
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 96.2
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 96.03
d1k8kc_ 371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 95.87
d1pexa_192 Collagenase-3 (MMP-13), C-terminal domain {Human ( 95.82
d1su3a2195 Collagenase (MMP1), C-terminal domain {Human (Homo 95.62
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 95.59
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 95.4
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 95.32
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 95.29
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 95.24
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 94.91
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 94.82
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 94.27
d1itva_195 Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 94.18
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 94.14
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 93.83
d1kv9a2 560 Quinoprotein alcohol dehydrogenase, N-terminal dom 93.8
d1qhua1192 Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 93.55
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 93.47
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 93.42
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 92.89
d1gena_200 Gelatinase A (MMP-2), C-terminal domain {Human (Ho 92.58
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 92.49
d1k32a3 360 Tricorn protease domain 2 {Archaeon Thermoplasma a 92.31
d1tbga_340 beta1-subunit of the signal-transducing G protein 92.31
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 91.75
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 91.17
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 91.15
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 90.81
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 90.3
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 89.82
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 89.79
d1kv9a2 560 Quinoprotein alcohol dehydrogenase, N-terminal dom 89.41
d1pexa_192 Collagenase-3 (MMP-13), C-terminal domain {Human ( 89.19
d1su3a2195 Collagenase (MMP1), C-terminal domain {Human (Homo 89.18
d1kb0a2 573 Quinoprotein alcohol dehydrogenase, N-terminal dom 89.06
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 88.79
d2ad6a1 571 Methanol dehydrogenase, heavy chain {Methylophilus 88.71
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 88.66
d1qhua1192 Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 87.9
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 87.77
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 87.24
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 86.83
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 86.59
d1tbga_340 beta1-subunit of the signal-transducing G protein 86.46
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 86.43
d1itva_195 Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 86.26
d1vyhc1 317 Platelet-activating factor acetylhydrolase IB subu 84.91
d1flga_ 582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 83.77
d1flga_ 582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 83.02
d1kb0a2 573 Quinoprotein alcohol dehydrogenase, N-terminal dom 81.93
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 81.1
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: Kelch motif
family: Kelch motif
domain: Kelch-like ECH-associated protein 1, KEAP1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=2.5e-40  Score=307.83  Aligned_cols=276  Identities=25%  Similarity=0.384  Sum_probs=238.6

Q ss_pred             CcceeeeccccCccccEEEEeeccceEEEEecCCCcEEeCCCCCCccccccCCceEEEECCEEEEECCCCC---Ccccce
Q 013929          117 SGELYRLRRLNGVIEHWVYFSCHLLEWEAFDPIRRRWMHLPRMTSNECFMCSDKESLAVGTELLVFGRELT---AHHISH  193 (433)
Q Consensus       117 ~~~~~~~gg~~~~~~~~l~~~~~~~~~~~yd~~~~~W~~l~~~p~~~~~~~~~~~~~~~~~~iyv~GG~~~---~~~~~~  193 (433)
                      +..+|++||....         ..+++++||+.+++|.+++++|.+|..    +++++++++|||+||...   .....+
T Consensus         4 g~~iyv~GG~~~~---------~~~~~~~yd~~t~~W~~~~~~p~~R~~----~~~~~~~~~iyv~GG~~~~~~~~~~~~   70 (288)
T d1zgka1           4 GRLIYTAGGYFRQ---------SLSYLEAYNPSNGTWLRLADLQVPRSG----LAGCVVGGLLYAVGGRNNSPDGNTDSS   70 (288)
T ss_dssp             CCCEEEECCBSSS---------BCCCEEEEETTTTEEEECCCCSSCCBS----CEEEEETTEEEEECCEEEETTEEEECC
T ss_pred             CCEEEEECCcCCC---------CCceEEEEECCCCeEEECCCCCCccce----eEEEEECCEEEEEeCcccCCCCccccc
Confidence            5678999998754         367899999999999999999999854    456888999999999742   234567


Q ss_pred             eEEEEEcCCCceecCCCCCCCcceeeEEEeCCEEEEEccCCCCCCcCCceEEEeCCCCCeEEcCCCCCCCcceeEEEECC
Q 013929          194 VIYRYSILTNSWSSGMRMNAPRCLFGSASLGEIAILAGGSDLEGNILSSAEMYNSETQTWKVLPSMKNPRKMCSGVFMDG  273 (433)
Q Consensus       194 ~~~~yd~~t~~W~~~~~~p~~r~~~~~~~~~~~iyv~GG~~~~~~~~~~~~~yd~~t~~W~~~~~~p~~r~~~~~~~~~g  273 (433)
                      ++++||+.+++|++++++|.+|..|++++++++||++||..+. ..+..++.||+.++.|...+.++.+|..+++++.++
T Consensus        71 ~~~~yd~~~~~w~~~~~~p~~r~~~~~~~~~~~i~~~gg~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~~  149 (288)
T d1zgka1          71 ALDCYNPMTNQWSPCAPMSVPRNRIGVGVIDGHIYAVGGSHGC-IHHNSVERYEPERDEWHLVAPMLTRRIGVGVAVLNR  149 (288)
T ss_dssp             CEEEEETTTTEEEECCCCSSCCBTCEEEEETTEEEEECCEETT-EECCCEEEEETTTTEEEECCCCSSCCBSCEEEEETT
T ss_pred             hhhhcccccccccccccccceecceeccccceeeEEecceecc-cccceeeeeccccCccccccccccccccceeeeeee
Confidence            8999999999999999999999999999999999999998765 467889999999999999999999999999999999


Q ss_pred             EEEEEccccCCCCcccceEEEEECCCCceEecCCCCCCCCCCCCCCcCCCCcCCCCEEEEECCEEEEEecCC-----CeE
Q 013929          274 KFYVIGGIGGSDSKVLTCGEEYDLETETWTEIPNMSPARGGAARGTEMPASAEAPPLVAVVNNELYAADYAD-----MEV  348 (433)
Q Consensus       274 ~lyv~GG~~~~~~~~~~~v~~yd~~t~~W~~~~~~p~~r~~~~~~~~~~~~~~~~~~~~~~~~~ly~~gg~~-----~~i  348 (433)
                      ++|++||...  ......++.||+.+++|...+.++..+..+              ++++.+++||++||..     ...
T Consensus       150 ~~~~~GG~~~--~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~--------------~~~~~~~~i~i~GG~~~~~~~~~~  213 (288)
T d1zgka1         150 LLYAVGGFDG--TNRLNSAECYYPERNEWRMITAMNTIRSGA--------------GVCVLHNCIYAAGGYDGQDQLNSV  213 (288)
T ss_dssp             EEEEECCBCS--SCBCCCEEEEETTTTEEEECCCCSSCCBSC--------------EEEEETTEEEEECCBCSSSBCCCE
T ss_pred             cceEecCccc--ccccceEEEeeccccccccccccccccccc--------------cccceeeeEEEecCccccccccce
Confidence            9999999873  346678999999999999999888888775              7899999999999743     688


Q ss_pred             EEEeCCCCcEEEeccCCCcccCCCcccEEEEEeCCEEEEEcCCCCCCCCeeEEEEeecCCCCCCceEecccCCCcEEEEE
Q 013929          349 RKYDKERRLWFTIGRLPERANSMNGWGLAFRACGDRLIVIGGPKASGEGFIELNSWVPSEGPPQWNLLARKQSANFVYNC  428 (433)
Q Consensus       349 ~~yd~~~~~W~~v~~lp~~~~~~~~~~~~~~~~~~~l~v~GG~~~~~~~~~~~~~~~~~~~~~~W~~v~~~p~~~~~~~~  428 (433)
                      +.||..+++|..++++|.++.     +++++.++++|||+||.+.. .....+.+|++  .+++|+++++||.+|..|++
T Consensus       214 ~~~~~~~~~~~~~~~~p~~r~-----~~~~~~~~~~l~v~GG~~~~-~~~~~v~~yd~--~~~~W~~~~~~p~~R~~~~~  285 (288)
T d1zgka1         214 ERYDVETETWTFVAPMKHRRS-----ALGITVHQGRIYVLGGYDGH-TFLDSVECYDP--DTDTWSEVTRMTSGRSGVGV  285 (288)
T ss_dssp             EEEETTTTEEEECCCCSSCCB-----SCEEEEETTEEEEECCBCSS-CBCCEEEEEET--TTTEEEEEEECSSCCBSCEE
T ss_pred             eeeeecceeeecccCccCccc-----ceEEEEECCEEEEEecCCCC-eecceEEEEEC--CCCEEEECCCCCCCcEeEEE
Confidence            999999999999999888875     36778899999999998553 34445555544  78999999999999999998


Q ss_pred             EE
Q 013929          429 AV  430 (433)
Q Consensus       429 ~v  430 (433)
                      ||
T Consensus       286 ~~  287 (288)
T d1zgka1         286 AV  287 (288)
T ss_dssp             EE
T ss_pred             EE
Confidence            87
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1pexa_ b.66.1.1 (A:) Collagenase-3 (MMP-13), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1su3a2 b.66.1.1 (A:271-465) Collagenase (MMP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1itva_ b.66.1.1 (A:) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1qhua1 b.66.1.1 (A:24-215) Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1gena_ b.66.1.1 (A:) Gelatinase A (MMP-2), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1pexa_ b.66.1.1 (A:) Collagenase-3 (MMP-13), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1su3a2 b.66.1.1 (A:271-465) Collagenase (MMP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qhua1 b.66.1.1 (A:24-215) Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1itva_ b.66.1.1 (A:) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure